[ { "uniprot_canonical_ac": "P98160-1", "uniprot_ac": "P98160", "uniprot_id": "PGBM_HUMAN", "mass": { "chemical_mass": 468830.0, "monoisotopic_mass": 468830.0 }, "refseq": { "ac": "NP_001278789", "name": "basement membrane-specific heparan sulfate proteoglycan core protein isoform a precursor", "summary": "This gene encodes the perlecan protein, which consists of a core protein to which three long chains of glycosaminoglycans (heparan sulfate or chondroitin sulfate) are attached. The perlecan protein is a large multidomain proteoglycan that binds to and cross-links many extracellular matrix components and cell-surface molecules. It has been shown that this protein interacts with laminin, prolargin, collagen type IV, FGFBP1, FBLN2, FGF7 and transthyretin, etc., and it plays essential roles in multiple biological activities. Perlecan is a key component of the vascular extracellular matrix, where it helps to maintain the endothelial barrier function. It is a potent inhibitor of smooth muscle cell proliferation and is thus thought to help maintain vascular homeostasis. It can also promote growth factor (e.g., FGF2) activity and thus stimulate endothelial growth and re-generation. It is a major component of basement membranes, where it is involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. Mutations in this gene cause Schwartz-Jampel syndrome type 1, Silverman-Handmaker type of dyssegmental dysplasia, and tardive dyskinesia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" }, "gene_names": [ { "name": "HSPG2", "type": "recommended", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" } ] }, { "name": "HSPG2", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "HSPG", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "PLC", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "PRCAN", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "SJA", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "SJS1", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "SJS", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] } ], "protein_names": [ { "name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "type": "recommended", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160/entry#names_and_taxonomy" } ] }, { "name": "HSPG", "type": "synonym", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160/entry#names_and_taxonomy" } ] }, { "name": "PLC", "type": "synonym", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160/entry#names_and_taxonomy" } ] }, { "name": "Perlecan", "type": "synonym", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160/entry#names_and_taxonomy" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein isoform a precursor", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "endorepellin (domain V region)", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] }, { "name": "perlecan proteoglycan", "type": "synonym", "evidence": [ { "id": "NP_001278789", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] } ], "function": [ { "annotation": "Anti-angiogenic and anti-tumor peptide that inhibits endothelial cell migration, collagen-induced endothelial tube morphogenesis and blood vessel growth in the chorioallantoic membrane. Blocks endothelial cell adhesion to fibronectin and type I collagen. Anti-tumor agent in neovascularization. Interaction with its ligand, integrin alpha2/beta1, is required for the anti-angiogenic properties. Evokes a reduction in phosphorylation of receptor tyrosine kinases via alpha2/beta1 integrin-mediated activation of the tyrosine phosphatase, PTPN6.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#function" } ] }, { "annotation": "Dyssegmental dysplasia Rolland-Desbuquois type is caused by pathogenic variants in HSPG2 - a founder haplotype shared in five patients.", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" }, { "database": "PubMed", "id": "38424183", "url": "https://glygen.org/publication/PubMed/38424183" } ] }, { "annotation": "Has anti-angiogenic properties that require binding of calcium ions for full activity.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#function" } ] }, { "annotation": "Identification of B-cell-related HSPG2 and CDSN as susceptibility loci for Kawasaki disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" }, { "database": "PubMed", "id": "37453912", "url": "https://glygen.org/publication/PubMed/37453912" } ] }, { "annotation": "Integral component of basement membranes. Component of the glomerular basement membrane (GBM), responsible for the fixed negative electrostatic membrane charge, and which provides a barrier which is both size- and charge-selective. It serves as an attachment substrate for cells. Plays essential roles in vascularization. Critical for normal heart development and for regulating the vascular response to injury. Also required for avascular cartilage development (PubMed:12435733, PubMed:15591058, PubMed:19789387). In muscle, it is essential for localizing acetylcholinesterase (AChE) at the neuromuscular junctions (NMJ), most probably acting as an adapter that links the acetylcholinesterase collagenic tail peptide (COLQ) to alpha-dystroglycan, and is therefore involved in the down-regulation of colinergic synaptic transmission (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#function" }, { "database": "PubMed", "id": "12435733", "url": "https://glygen.org/publication/PubMed/12435733" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" }, { "database": "UniProtKB", "id": "Q05793", "url": "https://www.uniprot.org/uniprotkb/Q05793#function" }, { "database": "PubMed", "id": "19789387", "url": "https://glygen.org/publication/PubMed/19789387" } ] }, { "annotation": "Perlecan (HSPG2) promotes structural, contractile, and metabolic development of human cardiomyocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" }, { "database": "PubMed", "id": "38198277", "url": "https://glygen.org/publication/PubMed/38198277" } ] }, { "annotation": "Perlecan: Roles in osteoarthritis and potential treating target. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" }, { "database": "PubMed", "id": "36379311", "url": "https://glygen.org/publication/PubMed/36379311" } ] }, { "annotation": "This gene encodes the perlecan protein, which consists of a core protein to which three long chains of glycosaminoglycans (heparan sulfate or chondroitin sulfate) are attached. The perlecan protein is a large multidomain proteoglycan that binds to and cross-links many extracellular matrix components and cell-surface molecules. It has been shown that this protein interacts with laminin, prolargin, collagen type IV, FGFBP1, FBLN2, FGF7 and transthyretin, etc., and it plays essential roles in multiple biological activities. Perlecan is a key component of the vascular extracellular matrix, where it helps to maintain the endothelial barrier function. It is a potent inhibitor of smooth muscle cell proliferation and is thus thought to help maintain vascular homeostasis. It can also promote growth factor (e.g., FGF2) activity and thus stimulate endothelial growth and re-generation. It is a major component of basement membranes, where it is involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. Mutations in this gene cause Schwartz-Jampel syndrome type 1, Silverman-Handmaker type of dyssegmental dysplasia, and tardive dyskinesia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ] } ], "disease": [ { "disease_id": "DOID:0060770", "recommended_name": { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "dextro-looped transposition of the great arteries", "description": "A congenital heart disease characterized by complete inversion of the great vessels where the aorta incorrectly arises from the right ventricle and the pulmonary artery incorrectly arises from the left ventricle." }, "synonyms": [ { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "congenitally uncorrected transposition of the great vessels", "description": "" }, { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "ventriculoarterial discordance with atrioventricular concordance", "description": "" }, { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "D-TGA", "description": "" }, { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "DTGA1", "description": "" }, { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "isolated ventriculoarterial discordance", "description": "" }, { "id": "DOID:0060770", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060770", "name": "congenitally uncorrected transposition of the great arteries", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "obsolete transposition of the great arteries, dextro-looped", "description": "OBSOLETE. Any dextro-looped transposition of the great arteries in which the cause of the disease is a mutation in the MED13L gene." }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "DTGA", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "DTGA1", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "MED13L dextro-looped transposition of the great arteries", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "dextro-looped transposition of the great arteries 1", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "dextro-looped transposition of the great arteries caused by mutation in MED13L", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "dextro-looped transposition of the great arteries type 1", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "transposition of the great arteries, dextro-looped type 1", "description": "" }, { "id": "MONDO:0012128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012128", "name": "transposition of the great arteries, dextro-looped 1", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060770" } ] }, { "disease_id": "DOID:0090005", "recommended_name": { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Schwartz-Jampel syndrome 1", "description": "A syndrome characterized by neuromyotonia and chondrodysplasia that has_material_basis_in hypomorphic mutations in the HSPG2 gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Aberfeld syndrome", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Burton skeletal dysplasia", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Burton syndrome", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Catel-Hempel syndrome", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Schwartz-Jampel syndrome type 1", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Schwartz-Jampel-Aberfeld syndrome", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "Catel-Hempel type dysostosis enchondralis metaepiphysaria", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "myotonic chondrodystrophy", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "osteochondromuscular dystrophy", "description": "" }, { "id": "DOID:0090005", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090005", "name": "myotonic myopathy, dwarfism, chondrodystrophy, ocular and facial anomalies", "description": "" }, { "id": "MONDO:0100435", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100435", "name": "Schwartz-Jampel syndrome type 1", "description": "" }, { "id": "MONDO:0100435", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100435", "name": "SJA syndrome", "description": "" }, { "id": "MONDO:0100435", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100435", "name": "SJS1", "description": "" }, { "id": "MONDO:0100435", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100435", "name": "Schwartz-Jampel syndrome type 1", "description": "" }, { "id": "MONDO:0100435", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100435", "name": "Schwartz-Jampel syndrome, type 1", "description": "" }, { "id": "MIM:255800", "resource": "MIM", "url": "https://www.omim.org/entry/255800", "name": "Schwartz-Jampel syndrome", "description": "Schwartz-Jampel syndrome" } ], "unlinked_id_list": [], "evidence": [ { "id": "255800", "database": "MIM", "url": "https://www.omim.org/entry/255800" }, { "id": "0090005", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090005" } ] }, { "disease_id": "DOID:0090032", "recommended_name": { "id": "DOID:0090032", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0090032", "name": "Silverman-Handmaker type dyssegmental dysplasia", "description": "An osteochondrodysplasia characterized by short-limbed dwarfism, anisospondyly, and neonatal lethality that has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the gene encoding perlecan (HSPG2) on chromosome 1p36." }, "synonyms": [ { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "Silverman-Handmaker type dyssegmental dysplasia", "description": "Dyssegmental dysplasia, Silverman-Handmaker type is a rare, genetic, primary bone dysplasia, and lethal form of neonatal short-limbed dwarfism, characterized by anisospondyly, severe short stature and limb shortening, metaphyseal flaring and distinct dysmorphic features (i.e. flat facial appearance, abnormal ears, short neck, narrow thorax). Additional features may include other skeletal findings (e.g. joint contractures, bowed limbs, talipes equinovarus) and urogenital and cardiovascular abnormalities." }, { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "Anisospondylic camptomicromelic dwarfism Silverman-Handmaker type", "description": "" }, { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "DDSH", "description": "" }, { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "dyssegmental dwarfism Silverman-Handmaker type", "description": "" }, { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "dyssegmental dysplasia Silverman-Handmaker type", "description": "" }, { "id": "MONDO:0009140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009140", "name": "dyssegmental dysplasia, Silverman-Handmaker type", "description": "" }, { "id": "MIM:224410", "resource": "MIM", "url": "https://www.omim.org/entry/224410", "name": "Dyssegmental dysplasia Silverman-Handmaker type", "description": "Dyssegmental dysplasia Silverman-Handmaker type" } ], "unlinked_id_list": [], "evidence": [ { "id": "224410", "database": "MIM", "url": "https://www.omim.org/entry/224410" }, { "id": "0090032", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090032" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "unlinked_id_list": [ "DOID:13731", "DOID:11130" ], "evidence": [ { "id": "10763", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:13481", "recommended_name": { "id": "DOID:13481", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:13481", "name": "thanatophoric dysplasia", "description": "An osteochondrodysplasia that results_in short arms and legs with excess folds of skin." }, "synonyms": [ { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dysplasia type 1", "description": "Thanatophoric dysplasia type 1 (TD1) is a form of TD characterized by short, bowed femurs, micromelia, narrow thorax, and brachydactyly." }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "TD1", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dwarfism type 1", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dysplasia, type 1", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "type 1 thanatophoric dysplasia", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "PLSD San Diego type", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dwarfism 1", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dysplasia type I", "description": "" }, { "id": "MONDO:0008546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008546", "name": "thanatophoric dysplasia, type I", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dysplasia type 2", "description": "Thanatophoric dysplasia characterized by a cloverleaf-like skull and straight femurs." }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "TD2", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "cloverleaf skull-micromelic bone dysplasia syndrome", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dwarfism type 2", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dwarfism-cloverleaf skull syndrome", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dysplasia, type 2", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "type 2 thanatophoric dysplasia", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dwarfism - cloverleaf skull", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dysplasia type II", "description": "" }, { "id": "MONDO:0008547", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008547", "name": "thanatophoric dysplasia, type II", "description": "" }, { "id": "MONDO:0010114", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010114", "name": "thanatophoric dysplasia, Glasgow variant", "description": "" }, { "id": "MONDO:0010114", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010114", "name": "thanatophoric dysplasia, Glasgow variant", "description": "" }, { "id": "MIM:187600", "resource": "MIM", "url": "https://www.omim.org/entry/187600", "name": "Thanatophoric dysplasia 1", "description": "Thanatophoric dysplasia 1" }, { "id": "MIM:187601", "resource": "MIM", "url": "https://www.omim.org/entry/187601", "name": "Thanatophoric dysplasia 2", "description": "Thanatophoric dysplasia 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "13481", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13481" } ] }, { "disease_id": "DOID:2256", "recommended_name": { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "osteochondrodysplasia", "description": "A bone development disease that results_in defective development of cartilage or bone." }, "synonyms": [ { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "Cartilage Development disorder", "description": "" }, { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "Congenital anomaly of cartilage", "description": "" }, { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "Osteochondrodysplasia syndrome", "description": "" }, { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "chondrodystrophy", "description": "" }, { "id": "DOID:2256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2256", "name": "skeletal dysplasia", "description": "" } ], "unlinked_id_list": [ "DOID:0112284", "DOID:0070305", "DOID:0080049", "DOID:0080942", "DOID:0112280" ], "evidence": [ { "id": "2256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2256" } ] }, { "disease_id": "DOID:3407", "recommended_name": { "id": "DOID:3407", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3407", "name": "carotid artery disease", "description": "" }, "synonyms": [ { "id": "DOID:3407", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3407", "name": "disorder of carotid artery", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3407", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3407" } ] }, { "disease_id": "DOID:4195", "recommended_name": { "id": "DOID:4195", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4195", "name": "hyperglycemia", "description": "" }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "4195", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4195" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 4197, "end_pos": 4197, "sequence_org": "D", "sequence_mut": "I", "comment": "Abolishes BMP1-mediated cleavage of endorepellin.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] }, { "start_pos": 4258, "end_pos": 4258, "sequence_org": "D", "sequence_mut": "A", "comment": "Retains proper folding. Reduced calcium ion binding.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] }, { "start_pos": 4327, "end_pos": 4327, "sequence_org": "N", "sequence_mut": "A", "comment": "Retains proper folding. Reduced calcium ion binding.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "86.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "93.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "94.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0700275", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700275", "name": "prostate cancer, hereditary", "description": "An instance of prostate cancer that is caused by an inherited genomic modification in an individual. Familial prostate cancer (FPC) is a malignant tumor of the prostate with an early onset. FPC is either asymptomatic or causes mictionary symptoms, erectile dysfunction, bone pain, venous compression and infectious or inflammatory syndrome (for the metastatic forms). It is also characterized by familial antecedents." }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:610997", "resource": "MIM", "url": "https://www.omim.org/entry/610997", "name": "Prostate cancer, hereditary, 9", "description": "Prostate cancer, hereditary, 9" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ], "unlinked_id_list": [ "DOID:1542" ], "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3973", "DOID:0080524", "DOID:0080525" ], "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3675", "DOID:4455" ], "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P98160", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P98160" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "HSPG2", "url": "https://www.uniprot.org/uniprotkb/P98160", "locus": { "chromosome": "1", "start_pos": 21822244, "end_pos": 21937310, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000142798", "url": "https://www.ensembl.org/id/ENSG00000142798" } ] } } ], "crossref": [ { "id": "HGNC:5273", "url": "https://alliancegenome.org/gene/HGNC:5273", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSG00000142798", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142798", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P98160", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00054", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00055", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00055", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00096", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00110", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00110", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00112", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00112", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05743", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05743", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05754", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05754", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5465297", "url": "https://www.ebi.ac.uk/chembl/target/inspect/CHEMBL5465297", "database": "ChEMBL", "categories": [ "Chemical" ] }, { "id": "HSPG2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HSPG2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3339", "url": "https://www.ncbi.nlm.nih.gov/gene/3339", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653", "database": "GlyConnect", "categories": [ "Glycomics", "Glycoproteomics" ] }, { "id": "5273", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:5273", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "3339", "url": "https://hpo.jax.org/browse/gene/NCBIGene:3339", "database": "HPO", "categories": [ "Other" ] }, { "id": "3SH4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SH4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SH5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SH5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1017538", "url": "https://www.iedb.org/epitope/1017538", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1050029", "url": "https://www.iedb.org/epitope/1050029", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1056331", "url": "https://www.iedb.org/epitope/1056331", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1058334", "url": "https://www.iedb.org/epitope/1058334", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1059059", "url": "https://www.iedb.org/epitope/1059059", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1080167", "url": "https://www.iedb.org/epitope/1080167", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1084532", "url": "https://www.iedb.org/epitope/1084532", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1085355", "url": "https://www.iedb.org/epitope/1085355", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1086078", "url": "https://www.iedb.org/epitope/1086078", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088208", "url": "https://www.iedb.org/epitope/1088208", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088248", "url": "https://www.iedb.org/epitope/1088248", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088886", "url": "https://www.iedb.org/epitope/1088886", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088968", "url": "https://www.iedb.org/epitope/1088968", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089126", "url": "https://www.iedb.org/epitope/1089126", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089423", "url": "https://www.iedb.org/epitope/1089423", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089424", "url": "https://www.iedb.org/epitope/1089424", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089725", "url": "https://www.iedb.org/epitope/1089725", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089889", "url": "https://www.iedb.org/epitope/1089889", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1090274", "url": "https://www.iedb.org/epitope/1090274", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1090307", "url": "https://www.iedb.org/epitope/1090307", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1090309", "url": "https://www.iedb.org/epitope/1090309", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1090311", "url": "https://www.iedb.org/epitope/1090311", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1091169", "url": "https://www.iedb.org/epitope/1091169", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1092004", "url": "https://www.iedb.org/epitope/1092004", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1092306", "url": "https://www.iedb.org/epitope/1092306", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1092322", "url": "https://www.iedb.org/epitope/1092322", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1093669", "url": "https://www.iedb.org/epitope/1093669", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1093670", "url": "https://www.iedb.org/epitope/1093670", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1094439", "url": "https://www.iedb.org/epitope/1094439", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1096165", "url": "https://www.iedb.org/epitope/1096165", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097592", "url": "https://www.iedb.org/epitope/1097592", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097593", "url": "https://www.iedb.org/epitope/1097593", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097594", "url": "https://www.iedb.org/epitope/1097594", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097771", "url": "https://www.iedb.org/epitope/1097771", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097772", "url": "https://www.iedb.org/epitope/1097772", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1098148", "url": "https://www.iedb.org/epitope/1098148", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1098932", "url": "https://www.iedb.org/epitope/1098932", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1098933", "url": "https://www.iedb.org/epitope/1098933", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1099653", "url": "https://www.iedb.org/epitope/1099653", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1100275", "url": "https://www.iedb.org/epitope/1100275", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1100481", "url": "https://www.iedb.org/epitope/1100481", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1100482", "url": "https://www.iedb.org/epitope/1100482", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1100483", "url": "https://www.iedb.org/epitope/1100483", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1100997", "url": "https://www.iedb.org/epitope/1100997", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1101116", "url": "https://www.iedb.org/epitope/1101116", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1102551", "url": "https://www.iedb.org/epitope/1102551", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1102895", "url": "https://www.iedb.org/epitope/1102895", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1106328", "url": "https://www.iedb.org/epitope/1106328", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1106411", "url": "https://www.iedb.org/epitope/1106411", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1106440", "url": "https://www.iedb.org/epitope/1106440", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1106441", "url": "https://www.iedb.org/epitope/1106441", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1107272", "url": "https://www.iedb.org/epitope/1107272", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1107273", "url": "https://www.iedb.org/epitope/1107273", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1107300", "url": "https://www.iedb.org/epitope/1107300", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108129", "url": "https://www.iedb.org/epitope/1108129", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108131", "url": "https://www.iedb.org/epitope/1108131", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108529", "url": "https://www.iedb.org/epitope/1108529", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108657", "url": "https://www.iedb.org/epitope/1108657", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108658", "url": "https://www.iedb.org/epitope/1108658", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108659", "url": "https://www.iedb.org/epitope/1108659", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108796", "url": "https://www.iedb.org/epitope/1108796", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108797", "url": "https://www.iedb.org/epitope/1108797", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108936", "url": "https://www.iedb.org/epitope/1108936", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1109242", "url": "https://www.iedb.org/epitope/1109242", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1109387", "url": "https://www.iedb.org/epitope/1109387", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1109802", "url": "https://www.iedb.org/epitope/1109802", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1111248", "url": "https://www.iedb.org/epitope/1111248", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1111929", "url": "https://www.iedb.org/epitope/1111929", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1112402", "url": "https://www.iedb.org/epitope/1112402", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1112919", "url": "https://www.iedb.org/epitope/1112919", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113063", "url": "https://www.iedb.org/epitope/1113063", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113064", "url": "https://www.iedb.org/epitope/1113064", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113756", "url": "https://www.iedb.org/epitope/1113756", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113972", "url": "https://www.iedb.org/epitope/1113972", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1114325", "url": "https://www.iedb.org/epitope/1114325", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1115428", "url": "https://www.iedb.org/epitope/1115428", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117822", "url": "https://www.iedb.org/epitope/1117822", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1118304", "url": "https://www.iedb.org/epitope/1118304", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1119210", "url": "https://www.iedb.org/epitope/1119210", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1119587", "url": "https://www.iedb.org/epitope/1119587", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1119737", "url": "https://www.iedb.org/epitope/1119737", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1120341", "url": "https://www.iedb.org/epitope/1120341", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1120470", "url": "https://www.iedb.org/epitope/1120470", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1120723", "url": "https://www.iedb.org/epitope/1120723", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1120788", "url": "https://www.iedb.org/epitope/1120788", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1120959", "url": "https://www.iedb.org/epitope/1120959", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1121947", "url": "https://www.iedb.org/epitope/1121947", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1122795", "url": "https://www.iedb.org/epitope/1122795", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1123316", "url": "https://www.iedb.org/epitope/1123316", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1123454", "url": "https://www.iedb.org/epitope/1123454", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1123611", "url": "https://www.iedb.org/epitope/1123611", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1129073", "url": "https://www.iedb.org/epitope/1129073", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1140903", "url": "https://www.iedb.org/epitope/1140903", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1141962", "url": "https://www.iedb.org/epitope/1141962", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142036", "url": "https://www.iedb.org/epitope/1142036", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142037", "url": "https://www.iedb.org/epitope/1142037", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142879", "url": "https://www.iedb.org/epitope/1142879", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142889", "url": "https://www.iedb.org/epitope/1142889", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142988", "url": "https://www.iedb.org/epitope/1142988", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1142989", "url": "https://www.iedb.org/epitope/1142989", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1143645", "url": "https://www.iedb.org/epitope/1143645", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1144668", "url": "https://www.iedb.org/epitope/1144668", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1144821", "url": "https://www.iedb.org/epitope/1144821", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1146074", "url": "https://www.iedb.org/epitope/1146074", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1156450", "url": "https://www.iedb.org/epitope/1156450", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1156512", "url": "https://www.iedb.org/epitope/1156512", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1157756", "url": "https://www.iedb.org/epitope/1157756", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1157792", "url": "https://www.iedb.org/epitope/1157792", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1158467", "url": "https://www.iedb.org/epitope/1158467", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1160518", "url": "https://www.iedb.org/epitope/1160518", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1160519", "url": "https://www.iedb.org/epitope/1160519", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1164001", "url": "https://www.iedb.org/epitope/1164001", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1164277", "url": "https://www.iedb.org/epitope/1164277", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1164326", "url": "https://www.iedb.org/epitope/1164326", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1164327", "url": "https://www.iedb.org/epitope/1164327", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1165449", "url": "https://www.iedb.org/epitope/1165449", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1165450", "url": "https://www.iedb.org/epitope/1165450", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1165451", "url": "https://www.iedb.org/epitope/1165451", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1169801", "url": "https://www.iedb.org/epitope/1169801", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1170831", "url": "https://www.iedb.org/epitope/1170831", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1171088", "url": "https://www.iedb.org/epitope/1171088", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1171196", "url": "https://www.iedb.org/epitope/1171196", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1171197", "url": "https://www.iedb.org/epitope/1171197", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1171392", "url": "https://www.iedb.org/epitope/1171392", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1174270", "url": "https://www.iedb.org/epitope/1174270", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1174844", "url": "https://www.iedb.org/epitope/1174844", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1175576", "url": "https://www.iedb.org/epitope/1175576", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1178120", "url": "https://www.iedb.org/epitope/1178120", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1178966", "url": "https://www.iedb.org/epitope/1178966", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1179833", "url": "https://www.iedb.org/epitope/1179833", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1179835", "url": "https://www.iedb.org/epitope/1179835", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1179836", "url": "https://www.iedb.org/epitope/1179836", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1179837", "url": "https://www.iedb.org/epitope/1179837", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180003", "url": "https://www.iedb.org/epitope/1180003", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180005", "url": "https://www.iedb.org/epitope/1180005", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180006", "url": "https://www.iedb.org/epitope/1180006", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180605", "url": "https://www.iedb.org/epitope/1180605", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180606", "url": "https://www.iedb.org/epitope/1180606", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180607", "url": "https://www.iedb.org/epitope/1180607", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1180921", "url": "https://www.iedb.org/epitope/1180921", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1185180", "url": "https://www.iedb.org/epitope/1185180", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1185181", "url": "https://www.iedb.org/epitope/1185181", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1187780", "url": "https://www.iedb.org/epitope/1187780", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1192934", "url": "https://www.iedb.org/epitope/1192934", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1192946", "url": "https://www.iedb.org/epitope/1192946", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1195129", "url": "https://www.iedb.org/epitope/1195129", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1218535", "url": "https://www.iedb.org/epitope/1218535", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1218536", "url": "https://www.iedb.org/epitope/1218536", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1224884", "url": "https://www.iedb.org/epitope/1224884", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1226664", "url": "https://www.iedb.org/epitope/1226664", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1267123", "url": "https://www.iedb.org/epitope/1267123", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1273595", "url": "https://www.iedb.org/epitope/1273595", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1276062", "url": "https://www.iedb.org/epitope/1276062", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1289080", "url": "https://www.iedb.org/epitope/1289080", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1297974", "url": "https://www.iedb.org/epitope/1297974", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1301843", "url": "https://www.iedb.org/epitope/1301843", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1350639", "url": "https://www.iedb.org/epitope/1350639", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1364927", "url": "https://www.iedb.org/epitope/1364927", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1365588", "url": "https://www.iedb.org/epitope/1365588", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144302", "url": "https://www.iedb.org/epitope/144302", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144321", "url": "https://www.iedb.org/epitope/144321", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144359", "url": "https://www.iedb.org/epitope/144359", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144548", "url": "https://www.iedb.org/epitope/144548", "database": "IEDB", "categories": [ "Other" ] }, { "id": "152983", "url": "https://www.iedb.org/epitope/152983", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1598474", "url": "https://www.iedb.org/epitope/1598474", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1598497", "url": "https://www.iedb.org/epitope/1598497", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1599225", "url": "https://www.iedb.org/epitope/1599225", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1600004", "url": "https://www.iedb.org/epitope/1600004", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1606434", "url": "https://www.iedb.org/epitope/1606434", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1606722", "url": "https://www.iedb.org/epitope/1606722", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1613669", "url": "https://www.iedb.org/epitope/1613669", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1616097", "url": "https://www.iedb.org/epitope/1616097", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1623493", "url": "https://www.iedb.org/epitope/1623493", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1715980", "url": "https://www.iedb.org/epitope/1715980", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1854870", "url": "https://www.iedb.org/epitope/1854870", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1892843", "url": "https://www.iedb.org/epitope/1892843", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1927459", "url": "https://www.iedb.org/epitope/1927459", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1973904", "url": "https://www.iedb.org/epitope/1973904", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1974541", "url": "https://www.iedb.org/epitope/1974541", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1974562", "url": "https://www.iedb.org/epitope/1974562", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1975239", "url": "https://www.iedb.org/epitope/1975239", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1975242", "url": "https://www.iedb.org/epitope/1975242", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1980397", "url": "https://www.iedb.org/epitope/1980397", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1980399", "url": "https://www.iedb.org/epitope/1980399", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1981637", "url": "https://www.iedb.org/epitope/1981637", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1985643", "url": "https://www.iedb.org/epitope/1985643", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1987967", "url": "https://www.iedb.org/epitope/1987967", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1989834", "url": "https://www.iedb.org/epitope/1989834", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1996094", "url": "https://www.iedb.org/epitope/1996094", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1997394", "url": "https://www.iedb.org/epitope/1997394", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1997497", "url": "https://www.iedb.org/epitope/1997497", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2004756", "url": "https://www.iedb.org/epitope/2004756", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2004785", "url": "https://www.iedb.org/epitope/2004785", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2005651", "url": "https://www.iedb.org/epitope/2005651", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2006732", "url": "https://www.iedb.org/epitope/2006732", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2007226", "url": "https://www.iedb.org/epitope/2007226", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2008196", "url": "https://www.iedb.org/epitope/2008196", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2008478", "url": "https://www.iedb.org/epitope/2008478", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2009148", "url": "https://www.iedb.org/epitope/2009148", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2010175", "url": "https://www.iedb.org/epitope/2010175", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2015204", "url": "https://www.iedb.org/epitope/2015204", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2016998", "url": "https://www.iedb.org/epitope/2016998", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2017666", "url": "https://www.iedb.org/epitope/2017666", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2018245", "url": "https://www.iedb.org/epitope/2018245", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2018643", "url": "https://www.iedb.org/epitope/2018643", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2018889", "url": "https://www.iedb.org/epitope/2018889", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2018958", "url": "https://www.iedb.org/epitope/2018958", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2020157", "url": "https://www.iedb.org/epitope/2020157", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2020716", "url": "https://www.iedb.org/epitope/2020716", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2020882", "url": "https://www.iedb.org/epitope/2020882", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2021595", "url": "https://www.iedb.org/epitope/2021595", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2021982", "url": "https://www.iedb.org/epitope/2021982", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2021995", "url": "https://www.iedb.org/epitope/2021995", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2022565", "url": "https://www.iedb.org/epitope/2022565", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2023297", "url": "https://www.iedb.org/epitope/2023297", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2028353", "url": "https://www.iedb.org/epitope/2028353", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2031260", "url": "https://www.iedb.org/epitope/2031260", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2034665", "url": "https://www.iedb.org/epitope/2034665", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2034987", "url": "https://www.iedb.org/epitope/2034987", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2035128", "url": "https://www.iedb.org/epitope/2035128", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2035281", "url": "https://www.iedb.org/epitope/2035281", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2037983", "url": "https://www.iedb.org/epitope/2037983", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2037984", "url": "https://www.iedb.org/epitope/2037984", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2038937", "url": "https://www.iedb.org/epitope/2038937", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2039679", "url": "https://www.iedb.org/epitope/2039679", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2039706", "url": "https://www.iedb.org/epitope/2039706", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2039965", "url": "https://www.iedb.org/epitope/2039965", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2040077", "url": "https://www.iedb.org/epitope/2040077", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2040651", "url": "https://www.iedb.org/epitope/2040651", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2041476", "url": "https://www.iedb.org/epitope/2041476", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2041573", "url": "https://www.iedb.org/epitope/2041573", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2041574", "url": "https://www.iedb.org/epitope/2041574", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2042406", "url": "https://www.iedb.org/epitope/2042406", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2042441", "url": "https://www.iedb.org/epitope/2042441", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2042541", "url": "https://www.iedb.org/epitope/2042541", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2043281", "url": "https://www.iedb.org/epitope/2043281", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2043632", "url": "https://www.iedb.org/epitope/2043632", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2044705", "url": "https://www.iedb.org/epitope/2044705", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2045778", "url": "https://www.iedb.org/epitope/2045778", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2046310", "url": "https://www.iedb.org/epitope/2046310", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2046631", "url": "https://www.iedb.org/epitope/2046631", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2046864", "url": "https://www.iedb.org/epitope/2046864", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2047786", "url": "https://www.iedb.org/epitope/2047786", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2049149", "url": "https://www.iedb.org/epitope/2049149", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2049255", "url": "https://www.iedb.org/epitope/2049255", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2050286", "url": "https://www.iedb.org/epitope/2050286", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2053922", "url": "https://www.iedb.org/epitope/2053922", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2054204", "url": "https://www.iedb.org/epitope/2054204", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2054275", "url": "https://www.iedb.org/epitope/2054275", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2055448", "url": "https://www.iedb.org/epitope/2055448", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2055632", "url": "https://www.iedb.org/epitope/2055632", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2055637", "url": "https://www.iedb.org/epitope/2055637", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2056446", "url": "https://www.iedb.org/epitope/2056446", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2057432", "url": "https://www.iedb.org/epitope/2057432", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2057838", "url": "https://www.iedb.org/epitope/2057838", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2057936", "url": "https://www.iedb.org/epitope/2057936", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2058113", "url": "https://www.iedb.org/epitope/2058113", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2058709", "url": "https://www.iedb.org/epitope/2058709", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2058767", "url": "https://www.iedb.org/epitope/2058767", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2059179", "url": "https://www.iedb.org/epitope/2059179", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2060307", "url": "https://www.iedb.org/epitope/2060307", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2060527", "url": "https://www.iedb.org/epitope/2060527", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2065470", "url": "https://www.iedb.org/epitope/2065470", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2066064", "url": "https://www.iedb.org/epitope/2066064", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2069806", "url": "https://www.iedb.org/epitope/2069806", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2071874", "url": "https://www.iedb.org/epitope/2071874", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2121117", "url": "https://www.iedb.org/epitope/2121117", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2121463", "url": "https://www.iedb.org/epitope/2121463", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2122598", "url": "https://www.iedb.org/epitope/2122598", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2123924", "url": "https://www.iedb.org/epitope/2123924", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2123979", "url": "https://www.iedb.org/epitope/2123979", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2125055", "url": "https://www.iedb.org/epitope/2125055", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2125859", "url": "https://www.iedb.org/epitope/2125859", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2127226", "url": "https://www.iedb.org/epitope/2127226", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2128101", "url": "https://www.iedb.org/epitope/2128101", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2128452", "url": "https://www.iedb.org/epitope/2128452", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2129060", "url": "https://www.iedb.org/epitope/2129060", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2129061", "url": "https://www.iedb.org/epitope/2129061", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2130432", "url": "https://www.iedb.org/epitope/2130432", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2130605", "url": "https://www.iedb.org/epitope/2130605", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2130639", "url": "https://www.iedb.org/epitope/2130639", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2139924", "url": "https://www.iedb.org/epitope/2139924", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2143800", "url": "https://www.iedb.org/epitope/2143800", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2254681", "url": "https://www.iedb.org/epitope/2254681", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2255324", "url": "https://www.iedb.org/epitope/2255324", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2264267", "url": "https://www.iedb.org/epitope/2264267", "database": "IEDB", "categories": [ "Other" ] }, { "id": "239382", "url": "https://www.iedb.org/epitope/239382", "database": "IEDB", "categories": [ "Other" ] }, { "id": "471545", "url": "https://www.iedb.org/epitope/471545", "database": "IEDB", "categories": [ "Other" ] }, { "id": "485466", "url": "https://www.iedb.org/epitope/485466", "database": "IEDB", "categories": [ "Other" ] }, { "id": "487139", "url": "https://www.iedb.org/epitope/487139", "database": "IEDB", "categories": [ "Other" ] }, { "id": "504175", "url": "https://www.iedb.org/epitope/504175", "database": "IEDB", "categories": [ "Other" ] }, { "id": "510154", "url": "https://www.iedb.org/epitope/510154", "database": "IEDB", "categories": [ "Other" ] }, { "id": "540859", "url": "https://www.iedb.org/epitope/540859", "database": "IEDB", "categories": [ "Other" ] }, { "id": "541393", "url": "https://www.iedb.org/epitope/541393", "database": "IEDB", "categories": [ "Other" ] }, { "id": "542387", "url": "https://www.iedb.org/epitope/542387", "database": "IEDB", "categories": [ "Other" ] }, { "id": "542966", "url": "https://www.iedb.org/epitope/542966", "database": "IEDB", "categories": [ "Other" ] }, { "id": "543869", "url": "https://www.iedb.org/epitope/543869", "database": "IEDB", "categories": [ "Other" ] }, { "id": "544009", "url": "https://www.iedb.org/epitope/544009", "database": "IEDB", "categories": [ "Other" ] }, { "id": "544494", "url": "https://www.iedb.org/epitope/544494", "database": "IEDB", "categories": [ "Other" ] }, { "id": "544870", "url": "https://www.iedb.org/epitope/544870", "database": "IEDB", "categories": [ "Other" ] }, { "id": "544913", "url": "https://www.iedb.org/epitope/544913", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545656", "url": "https://www.iedb.org/epitope/545656", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545816", "url": "https://www.iedb.org/epitope/545816", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545817", "url": "https://www.iedb.org/epitope/545817", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545859", "url": "https://www.iedb.org/epitope/545859", "database": "IEDB", "categories": [ "Other" ] }, { "id": "562039", "url": "https://www.iedb.org/epitope/562039", "database": "IEDB", "categories": [ "Other" ] }, { "id": "562115", "url": "https://www.iedb.org/epitope/562115", "database": "IEDB", "categories": [ "Other" ] }, { "id": "562250", "url": "https://www.iedb.org/epitope/562250", "database": "IEDB", "categories": [ "Other" ] }, { "id": "562492", "url": "https://www.iedb.org/epitope/562492", "database": "IEDB", "categories": [ "Other" ] }, { "id": "581422", "url": "https://www.iedb.org/epitope/581422", "database": "IEDB", "categories": [ "Other" ] }, { "id": "590300", "url": "https://www.iedb.org/epitope/590300", "database": "IEDB", "categories": [ "Other" ] }, { "id": "591986", "url": "https://www.iedb.org/epitope/591986", "database": "IEDB", "categories": [ "Other" ] }, { "id": "591987", "url": "https://www.iedb.org/epitope/591987", "database": "IEDB", "categories": [ "Other" ] }, { "id": "592225", "url": "https://www.iedb.org/epitope/592225", "database": "IEDB", "categories": [ "Other" ] }, { "id": "592363", "url": "https://www.iedb.org/epitope/592363", "database": "IEDB", "categories": [ "Other" ] }, { "id": "592915", "url": "https://www.iedb.org/epitope/592915", "database": "IEDB", "categories": [ "Other" ] }, { "id": "593022", "url": "https://www.iedb.org/epitope/593022", "database": "IEDB", "categories": [ "Other" ] }, { "id": "593111", "url": "https://www.iedb.org/epitope/593111", "database": "IEDB", "categories": [ "Other" ] }, { "id": "603063", "url": "https://www.iedb.org/epitope/603063", "database": "IEDB", "categories": [ "Other" ] }, { "id": "616198", "url": "https://www.iedb.org/epitope/616198", "database": "IEDB", "categories": [ "Other" ] }, { "id": "618512", "url": "https://www.iedb.org/epitope/618512", "database": "IEDB", "categories": [ "Other" ] }, { "id": "624268", "url": "https://www.iedb.org/epitope/624268", "database": "IEDB", "categories": [ "Other" ] }, { "id": "625366", "url": "https://www.iedb.org/epitope/625366", "database": "IEDB", "categories": [ "Other" ] }, { "id": "627429", "url": "https://www.iedb.org/epitope/627429", "database": "IEDB", "categories": [ "Other" ] }, { "id": "642717", "url": "https://www.iedb.org/epitope/642717", "database": "IEDB", "categories": [ "Other" ] }, { "id": "675882", "url": "https://www.iedb.org/epitope/675882", "database": "IEDB", "categories": [ "Other" ] }, { "id": "735355", "url": "https://www.iedb.org/epitope/735355", "database": "IEDB", "categories": [ "Other" ] }, { "id": "770774", "url": "https://www.iedb.org/epitope/770774", "database": "IEDB", "categories": [ "Other" ] }, { "id": "772930", "url": "https://www.iedb.org/epitope/772930", "database": "IEDB", "categories": [ "Other" ] }, { "id": "774600", "url": "https://www.iedb.org/epitope/774600", "database": "IEDB", "categories": [ "Other" ] }, { "id": "777376", "url": "https://www.iedb.org/epitope/777376", "database": "IEDB", "categories": [ "Other" ] }, { "id": "777855", "url": "https://www.iedb.org/epitope/777855", "database": "IEDB", "categories": [ "Other" ] }, { "id": "778326", "url": "https://www.iedb.org/epitope/778326", "database": "IEDB", "categories": [ "Other" ] }, { "id": "779023", "url": "https://www.iedb.org/epitope/779023", "database": "IEDB", "categories": [ "Other" ] }, { "id": "815331", "url": "https://www.iedb.org/epitope/815331", "database": "IEDB", "categories": [ "Other" ] }, { "id": "821745", "url": "https://www.iedb.org/epitope/821745", "database": "IEDB", "categories": [ "Other" ] }, { "id": "875294", "url": "https://www.iedb.org/epitope/875294", "database": "IEDB", "categories": [ "Other" ] }, { "id": "875319", "url": "https://www.iedb.org/epitope/875319", "database": "IEDB", "categories": [ "Other" ] }, { "id": "876184", "url": "https://www.iedb.org/epitope/876184", "database": "IEDB", "categories": [ "Other" ] }, { "id": "876673", "url": "https://www.iedb.org/epitope/876673", "database": "IEDB", "categories": [ "Other" ] }, { "id": "876938", "url": "https://www.iedb.org/epitope/876938", "database": "IEDB", "categories": [ "Other" ] }, { "id": "877760", "url": "https://www.iedb.org/epitope/877760", "database": "IEDB", "categories": [ "Other" ] }, { "id": "877818", "url": "https://www.iedb.org/epitope/877818", "database": "IEDB", "categories": [ "Other" ] }, { "id": "878544", "url": "https://www.iedb.org/epitope/878544", "database": "IEDB", "categories": [ "Other" ] }, { "id": "878666", "url": "https://www.iedb.org/epitope/878666", "database": "IEDB", "categories": [ "Other" ] }, { "id": "878800", "url": "https://www.iedb.org/epitope/878800", "database": "IEDB", "categories": [ "Other" ] }, { "id": "879062", "url": "https://www.iedb.org/epitope/879062", "database": "IEDB", "categories": [ "Other" ] }, { "id": "879718", "url": "https://www.iedb.org/epitope/879718", "database": "IEDB", "categories": [ "Other" ] }, { "id": "880982", "url": "https://www.iedb.org/epitope/880982", "database": "IEDB", "categories": [ "Other" ] }, { "id": "883496", "url": "https://www.iedb.org/epitope/883496", "database": "IEDB", "categories": [ "Other" ] }, { "id": "883750", "url": "https://www.iedb.org/epitope/883750", "database": "IEDB", "categories": [ "Other" ] }, { "id": "883859", "url": "https://www.iedb.org/epitope/883859", "database": "IEDB", "categories": [ "Other" ] }, { "id": "883876", "url": "https://www.iedb.org/epitope/883876", "database": "IEDB", "categories": [ "Other" ] }, { "id": "885127", "url": "https://www.iedb.org/epitope/885127", "database": "IEDB", "categories": [ "Other" ] }, { "id": "917183", "url": "https://www.iedb.org/epitope/917183", "database": "IEDB", "categories": [ "Other" ] }, { "id": "931317", "url": "https://www.iedb.org/epitope/931317", "database": "IEDB", "categories": [ "Other" ] }, { "id": "933906", "url": "https://www.iedb.org/epitope/933906", "database": "IEDB", "categories": [ "Other" ] }, { "id": "936854", "url": "https://www.iedb.org/epitope/936854", "database": "IEDB", "categories": [ "Other" ] }, { "id": "941478", "url": "https://www.iedb.org/epitope/941478", "database": "IEDB", "categories": [ "Other" ] }, { "id": "943417", "url": "https://www.iedb.org/epitope/943417", "database": "IEDB", "categories": [ "Other" ] }, { "id": "989171", "url": "https://www.iedb.org/epitope/989171", "database": "IEDB", "categories": [ "Other" ] }, { "id": "991658", "url": "https://www.iedb.org/epitope/991658", "database": "IEDB", "categories": [ "Other" ] }, { "id": "994027", "url": "https://www.iedb.org/epitope/994027", "database": "IEDB", "categories": [ "Other" ] }, { "id": "994028", "url": "https://www.iedb.org/epitope/994028", "database": "IEDB", "categories": [ "Other" ] }, { "id": "994029", "url": "https://www.iedb.org/epitope/994029", "database": "IEDB", "categories": [ "Other" ] }, { "id": "994879", "url": "https://www.iedb.org/epitope/994879", "database": "IEDB", "categories": [ "Other" ] }, { "id": "996452", "url": "https://www.iedb.org/epitope/996452", "database": "IEDB", "categories": [ "Other" ] }, { "id": "P98160", "url": "https://www.ebi.ac.uk/intact/interactors/id:P98160*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000082", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000082", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001791", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001791", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001881", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001881", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002049", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002049", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013098", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013098", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023415", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023415", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050440", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050440", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050685", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050685", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050958", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050958", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR056863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR056863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3339", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:3339", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "142461", "url": "http://www.omim.org/entry/142461", "database": "MIM", "categories": [ "Other" ] }, { "id": "224410", "url": "http://www.omim.org/entry/224410", "database": "MIM", "categories": [ "Other" ] }, { "id": "255800", "url": "http://www.omim.org/entry/255800", "database": "MIM", "categories": [ "Other" ] }, { "id": "P98160", "url": "https://oglcnac.org/atlas/detail/P98160", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "ISCFCAG", "url": "https://omabrowser.org/oma/group/ISCFCAG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0U1RQT3", "url": "https://www.orthodb.org/?gene=A0A0U1RQT3", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A2R8YH07", "url": "https://www.orthodb.org/?gene=A0A2R8YH07", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A3B3IT11", "url": "https://www.orthodb.org/?gene=A0A3B3IT11", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0Y5A9", "url": "https://www.orthodb.org/?gene=H0Y5A9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H7BYA5", "url": "https://www.orthodb.org/?gene=H7BYA5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "P98160", "url": "https://www.orthodb.org/?gene=P98160", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574:SF444", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574:SF444", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12231", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12231", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12231:SF267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12231:SF267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24270", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24270", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24270:SF55", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24270:SF55", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45080", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45080", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45080:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45080:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "pdb_00003sh4", "url": "https://www.rcsb.org/structure/pdb_00003sh4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sh5", "url": "https://www.rcsb.org/structure/pdb_00003sh5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SH4", "url": "https://www.rcsb.org/structure/3SH4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SH5", "url": "https://www.rcsb.org/structure/3SH5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00008", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00008", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00052", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00052", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00053", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00053", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00054", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00054", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00057", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00057", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF07679", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07679", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13895", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13895", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13927", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13927", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF24973", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF24973", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P98160", "url": "https://pharos.nih.gov/targets/P98160", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000056734", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056734", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056735", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056735", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056736", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056736", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056737", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056737", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056738", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056738", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056739", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056739", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056740", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056740", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056741", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056741", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056742", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056742", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056743", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056743", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056744", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056744", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056745", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056745", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056746", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056746", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056747", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056747", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056748", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056748", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056749", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056749", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056750", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056750", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056751", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056751", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056752", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056752", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056753", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056753", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056754", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056754", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056755", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056755", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056756", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056756", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056757", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056757", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056758", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056758", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056759", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056759", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056760", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056760", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056761", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056761", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056762", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056762", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056763", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056763", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056764", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056764", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056765", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056765", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056766", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056766", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056767", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056767", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056768", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056768", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056769", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056769", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056770", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056770", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056771", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056771", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056772", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056772", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056773", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056773", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056774", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056774", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056775", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056775", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056776", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056776", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056777", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056777", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056778", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056778", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056779", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056779", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056780", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056780", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056781", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056781", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056782", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056782", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056783", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056783", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056784", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056784", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000056785", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056785", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:P98160", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:P98160", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3560801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3656237", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040", "database": "UniCarbKB", "categories": [] }, { "id": "A0A0U1RQT3", "url": "https://www.uniprot.org/uniprotkb/A0A0U1RQT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RQT3-1", "url": "https://www.uniprot.org/uniprotkb/A0A0U1RQT3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YH07", "url": "https://www.uniprot.org/uniprotkb/A0A2R8YH07", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YH07-1", "url": "https://www.uniprot.org/uniprotkb/A0A2R8YH07-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IT11", "url": "https://www.uniprot.org/uniprotkb/A0A3B3IT11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IT11-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B3IT11-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5A9", "url": "https://www.uniprot.org/uniprotkb/H0Y5A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5A9-1", "url": "https://www.uniprot.org/uniprotkb/H0Y5A9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BYA5", "url": "https://www.uniprot.org/uniprotkb/H7BYA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BYA5-1", "url": "https://www.uniprot.org/uniprotkb/H7BYA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P98160-1", "url": "https://www.uniprot.org/uniprotkb/P98160-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVEVHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQASGTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILRLPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAEGQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLDLNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLVSPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS", "length": 4391, "header": "sp|P98160-1|PGBM_HUMAN Isoform 1 of Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4 CANONICAL=P98160-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RQT3-1", "url": "https://www.uniprot.org/uniprotkb/A0A0U1RQT3/entry", "sequence": { "sequence": "XNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGLLLYSGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEE", "length": 307, "header": "tr|A0A0U1RQT3-1|A0A0U1RQT3_HUMAN Computationally mapped isoform of Heparan sulfate proteoglycan 2 OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=1 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21833577, "end_pos": 21829993, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000635682.1", "url": "https://www.ensembl.org/id/ENST00000635682.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000489161.1", "url": "https://www.ensembl.org/id/ENSP00000489161.1" } ] } }, { "isoform_ac": "A0A2R8YH07-1", "url": "https://www.uniprot.org/uniprotkb/A0A2R8YH07/entry", "sequence": { "sequence": "ISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHESFYWQLPETYQGDKGEAYFARMRRAHQNRTSLSEEQLRAAVTAGRIPEPPEGRDWAQRASQVDEAQRRMDAEIWQLLSSFAAQPQPPPQGLSPHPQPAAALRAAPPPSSSSSSSSSSASLSFSPGSQFSLSYEGFSLLPGSLYYWQLPRAFLGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQIT", "length": 236, "header": "tr|A0A2R8YH07-1|A0A2R8YH07_HUMAN Computationally mapped isoform of Heparan sulfate proteoglycan 2 OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=1 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21872377, "end_pos": 21865717, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000644714.1", "url": "https://www.ensembl.org/id/ENST00000644714.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496473.1", "url": "https://www.ensembl.org/id/ENSP00000496473.1" } ] } }, { "isoform_ac": "A0A3B3IT11-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B3IT11/entry", "sequence": { "sequence": "XYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTAQTPPPPPAAVAVAVTPVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCED", "length": 288, "header": "tr|A0A3B3IT11-1|A0A3B3IT11_HUMAN Computationally mapped isoform of Heparan sulfate proteoglycan 2 OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=1 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21890694, "end_pos": 21887236, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374673.4", "url": "https://www.ensembl.org/id/ENST00000374673.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000497688.1", "url": "https://www.ensembl.org/id/ENSP00000497688.1" } ] } }, { "isoform_ac": "H0Y5A9-1", "url": "https://www.uniprot.org/uniprotkb/H0Y5A9/entry", "sequence": { "sequence": "XTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKVSPNPCPCGACSAPLPRPCGEIRQHLVEAETWAWGAGHGGQGRGCP", "length": 197, "header": "tr|H0Y5A9-1|PGBM_HUMAN Computationally mapped isoform of Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=1 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21874706, "end_pos": 21872859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000427897.1", "url": "https://www.ensembl.org/id/ENST00000427897.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000397573.1", "url": "https://www.ensembl.org/id/ENSP00000397573.1" } ] } }, { "isoform_ac": "H7BYA5-1", "url": "https://www.uniprot.org/uniprotkb/H7BYA5/entry", "sequence": { "sequence": "XGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQESRTWTRAAKGRIYARPMDLGGRPRPVPSWLSKVGGWLQASAKSREQR", "length": 109, "header": "tr|H7BYA5-1|H7BYA5_HUMAN Computationally mapped isoform of Heparan sulfate proteoglycan 2 OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=2 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21839006, "end_pos": 21835493, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374676.4", "url": "https://www.ensembl.org/id/ENST00000374676.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000363808.5", "url": "https://www.ensembl.org/id/ENSP00000363808.5" } ] } }, { "isoform_ac": "P98160-1", "url": "https://www.uniprot.org/uniprotkb/P98160/entry#P98160-1", "sequence": { "sequence": "MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVEVHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQASGTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILRLPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAEGQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLDLNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLVSPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS", "length": 4391, "header": "sp|P98160-1|PGBM_HUMAN Isoform 1 of Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4 CANONICAL=P98160-1" }, "locus": { "chromosome": "1", "start_pos": 21937217, "end_pos": 21823319, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374695.8", "url": "https://www.ensembl.org/id/ENST00000374695.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000363827.3", "url": "https://www.ensembl.org/id/ENSP00000363827.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1145, "start_aa": "Thr", "end_pos": 1145, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1145", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1147, "start_aa": "Thr", "end_pos": 1147, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1147", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TPSGLYLGTCER", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1147, "start_aa": "Thr", "end_pos": 1158, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011000001111001.00100.01001" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010011000001111000.00100.01001" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001101000.00100.01001" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100001.00100.01001" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G23719VF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111000.00100.01001" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01001" }, { "glytoucan_ac": "G36379GD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00100.01001" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100100.00100.01001" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSNTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37268159", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37268159" }, { "id": "TP6640575", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00100.01001" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111001.00100.01001" }, { "glytoucan_ac": "G47702MW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01001" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G64409MC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001110000.00100.01001" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01001" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101000.00100.01001" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G90734RJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000011000001100100.00100.01001" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.00100.01001" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000001000001100000.00100.01001" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1862, "start_aa": "Thr", "end_pos": 1862, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1862", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1862, "start_aa": "Thr", "end_pos": 1862, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1862", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1862, "start_aa": "Thr", "end_pos": 1862, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1862", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1862, "start_aa": "Thr", "end_pos": 1862, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1862", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1869, "start_aa": "Ser", "end_pos": 1869, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1869", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1876, "start_aa": "Thr", "end_pos": 1876, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1876", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1876, "start_aa": "Thr", "end_pos": 1876, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1876", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1896, "start_aa": "Thr", "end_pos": 1896, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1896", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPAVEPTDQAQYLCR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1920, "start_aa": "Leu", "end_pos": 1934, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 210, "start_aa": "Asn", "end_pos": 210, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn210", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001101000.00100.01001" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EASITVSVLHGTHSGPSYTPVPGSTRPIR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2127, "start_aa": "Glu", "end_pos": 2155, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "HGTHSGPSYTPVPGSTRPIRIEPSSSHVAEGQTL", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2136, "start_aa": "His", "end_pos": 2169, "end_aa": "Leu", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2138, "start_aa": "Thr", "end_pos": 2138, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2138", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2138, "start_aa": "T", "end_pos": 2138, "end_aa": "T", "residue": "T", "site_lbl": "T2138", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2140, "start_aa": "Ser", "end_pos": 2140, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2140", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2140, "start_aa": "Ser", "end_pos": 2140, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2140", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2143, "start_aa": "Ser", "end_pos": 2143, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2143", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SYT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2143, "start_aa": "Ser", "end_pos": 2145, "end_aa": "Thr", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2145, "start_aa": "Thr", "end_pos": 2145, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2145", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2145, "start_aa": "Thr", "end_pos": 2145, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2145", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2145, "start_aa": "Thr", "end_pos": 2145, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2145", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2150, "start_aa": "Ser", "end_pos": 2150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2150", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2150, "start_aa": "Ser", "end_pos": 2151, "end_aa": "Thr", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2151, "start_aa": "Thr", "end_pos": 2151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2151", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2160, "start_aa": "Ser", "end_pos": 2160, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2160", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2161, "start_aa": "Ser", "end_pos": 2161, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2161", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2223, "start_aa": "Thr", "end_pos": 2223, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2223", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2429, "start_aa": "Ser", "end_pos": 2429, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2429", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01000" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2429, "start_aa": "Ser", "end_pos": 2429, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2429", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2429, "start_aa": "Ser", "end_pos": 2429, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2429", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01000" }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 251, "start_aa": "Thr", "end_pos": 251, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr251", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.010100100001111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LSGSHSQGVAYPVR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2524, "start_aa": "Leu", "end_pos": 2537, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SGS", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2525, "start_aa": "Ser", "end_pos": 2527, "end_aa": "Ser", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2529, "start_aa": "Ser", "end_pos": 2529, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2529", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2541, "start_aa": "Ser", "end_pos": 2541, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2541", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2559, "start_aa": "Ser", "end_pos": 2559, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2559", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2559, "start_aa": "Ser", "end_pos": 2559, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2559", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2591, "start_aa": "Thr", "end_pos": 2591, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2591", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G40740AD", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 260, "start_aa": "Thr", "end_pos": 260, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr260", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.110100100001111110.00010.01000" }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 260, "start_aa": "Thr", "end_pos": 260, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr260", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.0100000.1100000000.010111110111111100.00010.01000" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 260, "start_aa": "Thr", "end_pos": 260, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr260", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 261, "start_aa": "Thr", "end_pos": 261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr261", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 2627, "start_aa": "Ser", "end_pos": 2627, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2627", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2637, "start_aa": "Ser", "end_pos": 2637, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2637", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2638, "start_aa": "Ser", "end_pos": 2638, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2638", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2646, "start_aa": "Thr", "end_pos": 2646, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2646", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QPPVTHAPQPLLPGSVRPLPCGPQEAACR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 265, "start_aa": "Gln", "end_pos": 293, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Thr", "end_pos": 269, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr269", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Thr", "end_pos": 269, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr269", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Thr", "end_pos": 269, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr269", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 269, "start_aa": "Thr", "end_pos": 269, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr269", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Thr", "end_pos": 269, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr269", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2716, "start_aa": "Ser", "end_pos": 2716, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2716", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2719, "start_aa": "Ser", "end_pos": 2719, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2719", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2719, "start_aa": "Ser", "end_pos": 2719, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2719", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2721, "start_aa": "Ser", "end_pos": 2721, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2721", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 279, "start_aa": "Ser", "end_pos": 279, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser279", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 279, "start_aa": "Ser", "end_pos": 279, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser279", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 279, "start_aa": "Ser", "end_pos": 279, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser279", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2815, "start_aa": "Ser", "end_pos": 2815, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2815", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2816, "start_aa": "Ser", "end_pos": 2816, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2816", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AYDGLSLPEDIETVTASQMR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 28, "start_aa": "Ala", "end_pos": 47, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 2995, "start_aa": "Ser", "end_pos": 2995, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2995", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3032, "start_aa": "Thr", "end_pos": 3032, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3032", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NQELEDNVHISPNGSIITIVGTRPSNHGTYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3072, "start_aa": "Asn", "end_pos": 3072, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3072", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 3072, "start_aa": "Asn", "end_pos": 3072, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3072", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 3105, "start_aa": "Asn", "end_pos": 3105, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3105", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "001000000000000000000.00010000000000.0.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ISSTPAKLEQR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3149, "start_aa": "Ile", "end_pos": 3159, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3152, "start_aa": "Thr", "end_pos": 3152, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3152", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 3279, "start_aa": "Asn", "end_pos": 3279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3279", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "001000000000000000000.00010000000000.0.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3392, "start_aa": "Thr", "end_pos": 3392, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3392", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3393, "start_aa": "Ser", "end_pos": 3393, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3393", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3398, "start_aa": "Ser", "end_pos": 3398, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3398", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3398, "start_aa": "Ser", "end_pos": 3398, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3398", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01001" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3398, "start_aa": "Ser", "end_pos": 3398, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3398", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01001" }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3398, "start_aa": "Ser", "end_pos": 3398, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3398", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010100100001111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3399, "start_aa": "Thr", "end_pos": 3399, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3399", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3401, "start_aa": "Thr", "end_pos": 3401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3401", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3405, "start_aa": "Thr", "end_pos": 3405, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3405", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3412, "start_aa": "Ser", "end_pos": 3412, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3412", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3521, "start_aa": "Thr", "end_pos": 3521, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3521", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 361, "start_aa": "Thr", "end_pos": 361, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr361", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3630, "start_aa": "Ser", "end_pos": 3630, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3630", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G00273SJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G02528FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00100.01001" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010011000001111000.00100.01001" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01001" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001101000.00100.01001" }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111101.00100.01001" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100001.00100.01001" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001" }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000011100100.00100.01001" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001" }, { "glytoucan_ac": "G15664MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000011111000.00100.01001" }, { "glytoucan_ac": "G17208MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G18647XP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111001.00100.01001" }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101000.00010.01001" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010101000011111101.00100.01001" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01001" }, { "glytoucan_ac": "G23719VF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00010.01001" }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001" }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000111000011101100.00010.01001" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G29184RN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G29299MO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101001.00100.01001" }, { "glytoucan_ac": "G31028YV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000100000001100100.00010.01001" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111000.00100.01001" }, { "glytoucan_ac": "G35253PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000010000001110000.00100.01001" }, { "glytoucan_ac": "G36379GD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00100.01001" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100100.00100.01001" }, { "glytoucan_ac": "G37509XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000001111000.00100.01001" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G40206WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100100.00010.01001" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41840AI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01001" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111001.00100.01001" }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01001" }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001010000.00010.01001" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G47702MW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G47950XN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001" }, { "glytoucan_ac": "G50856PC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001" }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G59924QI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001101000.00100.01001" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01001" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101001.00100.01001" }, { "glytoucan_ac": "G64409MC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001110000.00100.01001" }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G73430PD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101100.00100.01001" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G77547TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101001.00100.01001" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111101.00010.01001" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011100101.00100.01001" }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000011110101.00100.01001" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G84349RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100001111101.00100.01001" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001" }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01001" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101001.00100.01001" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G88891KO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000100000001100000.00100.01001" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000000.00010.01001" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.00100.01001" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G96091TT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111001.00100.01001" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01001" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G00273SJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G01485JJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111000.00100.01000" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01000" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011000001111001.00100.01000" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010011000001111000.00100.01000" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001101000.00100.01000" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G17208MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G22572EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001110001.00100.01000" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01000" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01000" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111000.00100.01000" }, { "glytoucan_ac": "G37995HC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01000" }, { "glytoucan_ac": "G43734MM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001100100.00010.01000" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111001.00100.01000" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G60834IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101000.00100.01000" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01000" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101001.00100.01000" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G75418YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01000" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000" }, { "glytoucan_ac": "G84862VB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001110000.00100.01000" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01000" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01000" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000011000001100000.00100.01000" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101001.00100.01000" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G89045VA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101000.00100.01000" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.00100.01000" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000001000001100000.00100.01000" }, { "glytoucan_ac": "G94470IW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 3847, "start_aa": "Thr", "end_pos": 3847, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3847", "evidence": [ { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "P98160", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 3933, "start_aa": "Ser", "end_pos": 3933, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3933", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01001" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000" }, { "glytoucan_ac": "G47950XN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "PVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01000" }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000100.00010.01000" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 4068, "start_aa": "Asn", "end_pos": 4068, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4068", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ], "filter_code": "001000000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 4171, "start_aa": "Ser", "end_pos": 4171, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4171", "evidence": [ { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "P98160", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "P98160", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P98160" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 4179, "start_aa": "Ser", "end_pos": 4179, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4179", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01000" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 4193, "start_aa": "Ser", "end_pos": 4193, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4193", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" }, { "id": "25326458", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25326458" } ], "filter_code": "000000000000000100000.00000000001000.00.01001" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "T", "end_pos": 42, "end_aa": "T", "residue": "T", "site_lbl": "T42", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ], "filter_code": "000000000000000010000.00000010000000.00.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 4386, "start_aa": "Thr", "end_pos": 4386, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr4386", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 49, "start_aa": "Thr", "end_pos": 49, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr49", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "Y", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 52, "start_aa": "Tyr", "end_pos": 52, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr52", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000268", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000268" } ], "filter_code": "000000000000000000100.00000000001000.00.01001" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 554, "start_aa": "Asn", "end_pos": 554, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn554", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 554, "start_aa": "Asn", "end_pos": 554, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn554", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 554, "start_aa": "Asn", "end_pos": 554, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn554", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 554, "start_aa": "Asn", "end_pos": 554, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn554", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Thr", "end_pos": 563, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr563", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (heparan sulfate) serine", "icn3d_view": {}, "start_pos": 65, "start_aa": "Ser", "end_pos": 65, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser65", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01000" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (heparan sulfate) serine", "icn3d_view": {}, "start_pos": 71, "start_aa": "Ser", "end_pos": 71, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser71", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (heparan sulfate) serine", "icn3d_view": {}, "start_pos": 76, "start_aa": "Ser", "end_pos": 76, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser76", "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" } ], "filter_code": "000000000000000100000.00000000001000.0.01001" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G02528FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00100.01001" }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000100.00100.01001" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01001" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011000001111001.00100.01001" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01001" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001" }, { "glytoucan_ac": "G26330YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000100000001100000.00010.01001" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001" }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100100.00100.01001" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101100.00100.01001" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01001" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01001" }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001101100.00010.01001" }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01001" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001" }, { "glytoucan_ac": "G49906RN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVNFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000001101100.00010.01001" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001" }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001110101.00010.01001" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01001" }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G69521XL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101000.00100.01001" }, { "glytoucan_ac": "G70223PD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010110100001100100.00100.01001" }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101000.00010.01001" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000111000001101100.00010.01001" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G84225JN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001" }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101101.00100.01001" }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "653", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01001" }, { "glytoucan_ac": "G99668VU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100000.00100.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNECADGSFHLSTR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 902, "start_aa": "Leu", "end_pos": 916, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNECADGSFHLSTRNPDGCLK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 902, "start_aa": "Leu", "end_pos": 923, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 914, "start_aa": "Ser", "end_pos": 914, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser914", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 914, "start_aa": "Ser", "end_pos": 915, "end_aa": "Thr", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 915, "start_aa": "Thr", "end_pos": 915, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr915", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 915, "start_aa": "Thr", "end_pos": 915, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr915", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 915, "start_aa": "Thr", "end_pos": 915, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr915", "evidence": [ { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 972, "start_aa": "Thr", "end_pos": 972, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr972", "evidence": [ { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 972, "start_aa": "Thr", "end_pos": 972, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr972", "evidence": [ { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "000000000000000010000.00000000001000.00.01001" } ], "phosphorylation": [ { "start_pos": 2843, "end_pos": 2843, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr2843" }, { "start_pos": 472, "end_pos": 472, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser472" }, { "start_pos": 477, "end_pos": 477, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Tyr477" }, { "start_pos": 478, "end_pos": 478, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr478" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Comprehensive Glycoprofiling of Oral Tumors Associates N-Glycosylation With Lymph Node Metastasis and Patient Survival.", "journal": "Molecular & cellular proteomics : MCP", "date": "2023-07", "authors": "Carnielli Carolina Moretto, Melo de Lima Morais Thayn\u00e1, Malta de S\u00e1 Patroni F\u00e1bio, Prado Ribeiro Ana Carolina, Brand\u00e3o Tha\u00eds Bianca, Sobroza Evandro, Matos Leandro Luongo, Kowalski Luiz Paulo, Paes Leme Adriana Franco, Kawahara Rebeca, Thaysen-Andersen Morten", "evidence": [ { "database": "GlyTableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "reference": [ { "type": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" } ] }, { "title": "In-depth analysis of the tear fluid glycoproteome reveals diverse lacritin glycosylation and spliceoforms.", "journal": "bioRxiv : the preprint server for biology", "date": "2025-06-18", "authors": "Chang Vincent, Mahoney Keira E, Lian Isaac, Chen Ryan, Chung Nara, Paaske Utheim Tor, Karlsson Niclas G, Malaker Stacy A", "evidence": [ { "database": "GlyTableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "reference": [ { "type": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Deep quantitative glycoproteomics reveals gut microbiome induced remodeling of the brain glycoproteome", "journal": "bioRxiv", "date": "2023", "authors": "Potel C.M., Burtscher M.L., Garrido-Rodriguez M., Brauer-Nikonow A., Becher I., Typas A., Zimmermann M., Savitski M.", "evidence": [ { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "reference": [ { "type": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "Relocating the active site of activated protein C eliminates the need for its protein S cofactor. A fluorescence resonance energy transfer study.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yegneswaran S, Smirnov MD, Safa O, Esmon NL, Esmon CT, Johnson AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "10026158", "url": "https://glygen.org/publication/PubMed/10026158" } ] }, { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "Membrane targeting and stabilization of sarcospan is mediated by the sarcoglycan subcomplex.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Crosbie RH, Lebakken CS, Holt KH, Venzke DP, Straub V, Lee JC, Grady RM, Chamberlain JS, Sanes JR, Campbell KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10189375", "url": "https://glygen.org/publication/PubMed/10189375" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.", "journal": "The Biochemical journal", "date": "1999", "authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10229672", "url": "https://glygen.org/publication/PubMed/10229672" } ] }, { "title": "The tumor suppressor EXT-like gene EXTL2 encodes an alpha1, 4-N-acetylhexosaminyltransferase that transfers N-acetylgalactosamine and N-acetylglucosamine to the common glycosaminoglycan-protein linkage region. The key enzyme for the chain initiation of heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "1999-05-14", "authors": "Kitagawa H, Shimakawa H, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "10318803", "url": "https://glygen.org/publication/PubMed/10318803" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.", "journal": "FEBS letters", "date": "1999", "authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10386589", "url": "https://glygen.org/publication/PubMed/10386589" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "Loss of the sarcoglycan complex and sarcospan leads to muscular dystrophy in beta-sarcoglycan-deficient mice.", "journal": "Human molecular genetics", "date": "1999", "authors": "Araishi K, Sasaoka T, Imamura M, Noguchi S, Hama H, Wakabayashi E, Yoshida M, Hori T, Ozawa E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10441321", "url": "https://glygen.org/publication/PubMed/10441321" } ] }, { "title": "Human heparanase. Purification, characterization, cloning, and expression.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Toyoshima M, Nakajima M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "10446189", "url": "https://glygen.org/publication/PubMed/10446189" } ] }, { "title": "Mucopolysaccharidosis type I: characterization of novel mutations affecting alpha-L-iduronidase activity.", "journal": "Clinical genetics", "date": "1999", "authors": "Lee-Chen GJ, Lin SP, Tang YF, Chin YW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "10466419", "url": "https://glygen.org/publication/PubMed/10466419" } ] }, { "title": "Cloning and expression of a proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I. A seventh member of the human beta4-galactosyltransferase gene family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Almeida R, Levery SB, Mandel U, Kresse H, Schwientek T, Bennett EP, Clausen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10473568", "url": "https://glygen.org/publication/PubMed/10473568" } ] }, { "title": "Mutation analysis of hereditary multiple exostoses in the Chinese.", "journal": "Human genetics", "date": "1999", "authors": "Xu L, Xia J, Jiang H, Zhou J, Li H, Wang D, Pan Q, Long Z, Fan C, Deng HX", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "10480354", "url": "https://glygen.org/publication/PubMed/10480354" } ] }, { "title": "Molecular basis for the progeroid variant of Ehlers-Danlos syndrome. Identification and characterization of two mutations in galactosyltransferase I gene.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Okajima T, Fukumoto S, Furukawa K, Urano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10506123", "url": "https://glygen.org/publication/PubMed/10506123" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "Different dystrophin-like complexes are expressed in neurons and glia.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Blake DJ, Hawkes R, Benson MA, Beesley PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10545507", "url": "https://glygen.org/publication/PubMed/10545507" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "The putative tumor suppressors EXT1 and EXT2 form a stable complex that accumulates in the Golgi apparatus and catalyzes the synthesis of heparan sulfate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "McCormick C, Duncan G, Goutsos KT, Tufaro F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "10639137", "url": "https://glygen.org/publication/PubMed/10639137" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase having different specificities for hexuronic acid adjacent to the targeted N-sulfoglucosamine.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Habuchi H, Tanaka M, Habuchi O, Yoshida K, Suzuki H, Ban K, Kimata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "10644753", "url": "https://glygen.org/publication/PubMed/10644753" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Expression of heparan sulphate L-iduronyl 2-O-sulphotransferase in human kidney 293 cells results in increased D-glucuronyl 2-O-sulphation.", "journal": "The Biochemical journal", "date": "2000", "authors": "Rong J, Habuchi H, Kimata K, Lindahl U, Kusche-Gullberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "10677367", "url": "https://glygen.org/publication/PubMed/10677367" } ] }, { "title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.", "journal": "Cancer research", "date": "2000", "authors": "Guo H, Li R, Zucker S, Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10706100", "url": "https://glygen.org/publication/PubMed/10706100" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "Heparan sulfate proteoglycans on the cell surface: versatile coordinators of cellular functions.", "journal": "The international journal of biochemistry & cell biology", "date": "2000", "authors": "Tumova S, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "10716625", "url": "https://glygen.org/publication/PubMed/10716625" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10809722", "url": "https://glygen.org/publication/PubMed/10809722" } ] }, { "title": "Anti-angiogenic cues from vascular basement membrane collagen.", "journal": "Cancer research", "date": "2000", "authors": "Colorado PC, Torre A, Kamphaus G, Maeshima Y, Hopfer H, Takahashi K, Volk R, Zamborsky ED, Herman S, Sarkar PK, Ericksen MB, Dhanabal M, Simons M, Post M, Kufe DW, Weichselbaum RR, Sukhatme VP, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10811134", "url": "https://glygen.org/publication/PubMed/10811134" } ] }, { "title": "Structure/function of the human Ga1beta1,3-glucuronosyltransferase. Dimerization and functional activity are mediated by two crucial cysteine residues.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ouzzine M, Gulberti S, Netter P, Magdalou J, Fournel-Gigleux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10842173", "url": "https://glygen.org/publication/PubMed/10842173" } ] }, { "title": "Assembly of multiple dystrobrevin-containing complexes in the kidney.", "journal": "Journal of cell science", "date": "2000-08", "authors": "Loh N Y, Newey S E, Davies K E, Blake D J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10893187", "url": "https://glygen.org/publication/PubMed/10893187" } ] }, { "title": "Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.", "journal": "Nature structural biology", "date": "2000-08", "authors": "Huang X, Poy F, Zhang R, Joachimiak A, Sudol M, Eck M J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10932245", "url": "https://glygen.org/publication/PubMed/10932245" } ] }, { "title": "Molecular and genetic characterization of sarcospan: insights into sarcoglycan-sarcospan interactions.", "journal": "Human molecular genetics", "date": "2000-08-12", "authors": "Crosbie R H, Lim L E, Moore S A, Hirano M, Hays A P, Maybaum S W, Collin H, Dovico S A, Stolle C A, Fardeau M, Tom\u00e9 F M, Campbell K P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "10942431", "url": "https://glygen.org/publication/PubMed/10942431" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10986281", "url": "https://glygen.org/publication/PubMed/10986281" } ] }, { "title": "Cloning and expression profiling of Hpa2, a novel mammalian heparanase family member.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "McKenzie E, Tyson K, Stamps A, Smith P, Turner P, Barry R, Hircock M, Patel S, Barry E, Stubberfield C, Terrett J, Page M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "11027606", "url": "https://glygen.org/publication/PubMed/11027606" } ] }, { "title": "The soluble endothelial protein C receptor binds to activated neutrophils: involvement of proteinase-3 and CD11b/CD18.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Kurosawa S, Esmon CT, Stearns-Kurosawa DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "11035113", "url": "https://glygen.org/publication/PubMed/11035113" } ] }, { "title": "Integrins as receptors for laminins.", "journal": "Microscopy research and technique", "date": "2000", "authors": "Belkin AM, Stepp MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11054877", "url": "https://glygen.org/publication/PubMed/11054877" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Multiple isozymes of heparan sulfate/heparin GlcNAc N-deacetylase/GlcN N-sulfotransferase. Structure and activity of the fourth member, NDST4.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Aikawa J, Grobe K, Tsujimoto M, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "11087757", "url": "https://glygen.org/publication/PubMed/11087757" } ] }, { "title": "Molecular cloning and expression of human UDP-d-Xylose:proteoglycan core protein beta-d-xylosyltransferase and its first isoform XT-II.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Gotting C, Kuhn J, Zahn R, Brinkmann T, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "11099377", "url": "https://glygen.org/publication/PubMed/11099377" } ] }, { "title": "Perlecan, the major proteoglycan of basement membranes, is altered in patients with Schwartz-Jampel syndrome (chondrodystrophic myotonia).", "journal": "Nature genetics", "date": "2000", "authors": "Nicole S, Davoine CS, Topaloglu H, Cattolico L, Barral D, Beighton P, Hamida CB, Hammouda H, Cruaud C, White PS, Samson D, Urtizberea JA, Lehmann-Horn F, Weissenbach J, Hentati F, Fontaine B", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "dbSNP", "id": "rs137853248", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853248" } ], "reference": [ { "type": "PubMed", "id": "11101850", "url": "https://glygen.org/publication/PubMed/11101850" } ] }, { "title": "Fibroblast growth factor-binding protein is a novel partner for perlecan protein core.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Mongiat M, Otto J, Oldershaw R, Ferrer F, Sato JD, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "11148217", "url": "https://glygen.org/publication/PubMed/11148217" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "Diminished levels of the putative tumor suppressor proteins EXT1 and EXT2 in exostosis chondrocytes.", "journal": "Cell motility and the cytoskeleton", "date": "2001", "authors": "Bernard MA, Hall CE, Hogue DA, Cole WG, Scott A, Snuggs MB, Clines GA, Ludecke HJ, Lovett M, Van Winkle WB, Hecht JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "11169766", "url": "https://glygen.org/publication/PubMed/11169766" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Initial sequencing and analysis of the human genome.", "journal": "Nature", "date": "2001", "authors": "Lander ES, Linton LM, Birren B, Nusbaum C, Zody MC, Baldwin J, Devon K, Dewar K, Doyle M, FitzHugh W, Funke R, Gage D, Harris K, Heaford A, Howland J, Kann L, Lehoczky J, LeVine R, McEwan P, McKernan K, Meldrim J, Mesirov JP, Miranda C, Morris W, Naylor J, Raymond C, Rosetti M, Santos R, Sheridan A, Sougnez C, Stange-Thomann Y, Stojanovic N, Subramanian A, Wyman D, Rogers J, Sulston J, Ainscough R, Beck S, Bentley D, Burton J, Clee C, Carter N, Coulson A, Deadman R, Deloukas P, Dunham A, Dunham I, Durbin R, French L, Grafham D, Gregory S, Hubbard T, Humphray S, Hunt A, Jones M, Lloyd C, McMurray A, Matthews L, Mercer S, Milne S, Mullikin JC, Mungall A, Plumb R, Ross M, Shownkeen R, Sims S, Waterston RH, Wilson RK, Hillier LW, McPherson JD, Marra MA, Mardis ER, Fulton LA, Chinwalla AT, Pepin KH, Gish WR, Chissoe SL, Wendl MC, Delehaunty KD, Miner TL, Delehaunty A, Kramer JB, Cook LL, Fulton RS, Johnson DL, Minx PJ, Clifton SW, Hawkins T, Branscomb E, Predki P, Richardson P, Wenning S, Slezak T, Doggett N, Cheng JF, Olsen A, Lucas S, Elkin C, Uberbacher E, Frazier M, Gibbs RA, Muzny DM, Scherer SE, Bouck JB, Sodergren EJ, Worley KC, Rives CM, Gorrell JH, Metzker ML, Naylor SL, Kucherlapati RS, Nelson DL, Weinstock GM, Sakaki Y, Fujiyama A, Hattori M, Yada T, Toyoda A, Itoh T, Kawagoe C, Watanabe H, Totoki Y, Taylor T, Weissenbach J, Heilig R, Saurin W, Artiguenave F, Brottier P, Bruls T, Pelletier E, Robert C, Wincker P, Smith DR, Doucette-Stamm L, Rubenfield M, Weinstock K, Lee HM, Dubois J, Rosenthal A, Platzer M, Nyakatura G, Taudien S, Rump A, Yang H, Yu J, Wang J, Huang G, Gu J, Hood L, Rowen L, Madan A, Qin S, Davis RW, Federspiel NA, Abola AP, Proctor MJ, Myers RM, Schmutz J, Dickson M, Grimwood J, Cox DR, Olson MV, Kaul R, Raymond C, Shimizu N, Kawasaki K, Minoshima S, Evans GA, Athanasiou M, Schultz R, Roe BA, Chen F, Pan H, Ramser J, Lehrach H, Reinhardt R, McCombie WR, de la Bastide M, Dedhia N, Blocker H, Hornischer K, Nordsiek G, Agarwala R, Aravind L, Bailey JA, Bateman A, Batzoglou S, Birney E, Bork P, Brown DG, Burge CB, Cerutti L, Chen HC, Church D, Clamp M, Copley RR, Doerks T, Eddy SR, Eichler EE, Furey TS, Galagan J, Gilbert JG, Harmon C, Hayashizaki Y, Haussler D, Hermjakob H, Hokamp K, Jang W, Johnson LS, Jones TA, Kasif S, Kaspryzk A, Kennedy S, Kent WJ, Kitts P, Koonin EV, Korf I, Kulp D, Lancet D, Lowe TM, McLysaght A, Mikkelsen T, Moran JV, Mulder N, Pollara VJ, Ponting CP, Schuler G, Schultz J, Slater G, Smit AF, Stupka E, Szustakowki J, Thierry-Mieg D, Thierry-Mieg J, Wagner L, Wallis J, Wheeler R, Williams A, Wolf YI, Wolfe KH, Yang SP, Yeh RF, Collins F, Guyer MS, Peterson J, Felsenfeld A, Wetterstrand KA, Patrinos A, Morgan MJ, de Jong P, Catanese JJ, Osoegawa K, Shizuya H, Choi S, Chen YJ, Szustakowki J", "evidence": [ { "database": "UniProtKB", "id": "H0Y5A9", "url": "https://www.uniprot.org/uniprotkb/H0Y5A9" } ], "reference": [ { "type": "PubMed", "id": "11237011", "url": "https://glygen.org/publication/PubMed/11237011" } ] }, { "title": "Endothelial cell protein C receptor plays an important role in protein C activation in vivo.", "journal": "Blood", "date": "2001", "authors": "Taylor FB Jr, Peer GT, Lockhart MS, Ferrell G, Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "11238108", "url": "https://glygen.org/publication/PubMed/11238108" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "Characterization of the D-glucuronyl C5-epimerase involved in the biosynthesis of heparin and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Li JP, Gong F, El Darwish K, Jalkanen M, Lindahl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "11274177", "url": "https://glygen.org/publication/PubMed/11274177" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "Cloning, Golgi localization, and enzyme activity of the full-length heparin/heparan sulfate-glucuronic acid C5-epimerase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Crawford BE, Olson SK, Esko JD, Pinhal MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "11279150", "url": "https://glygen.org/publication/PubMed/11279150" } ] }, { "title": "Dyssegmental dysplasia, Silverman-Handmaker type, is caused by functional null mutations of the perlecan gene.", "journal": "Nat. Genet.", "date": "2001", "authors": "Arikawa-Hirasawa E, Wilcox W R, Le A H, Silverman N, Govindraj P, Hassell J R, Yamada Y", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "11279527", "url": "https://glygen.org/publication/PubMed/11279527" } ] }, { "title": "Extensive repertoire of membrane-bound and soluble dendritic cell-specific ICAM-3-grabbing nonintegrin 1 (DC-SIGN1) and DC-SIGN2 isoforms. Inter-individual variation in expression of DC-SIGN transcripts.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mummidi S, Catano G, Lam L, Hoefle A, Telles V, Begum K, Jimenez F, Ahuja SS, Ahuja SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "11337487", "url": "https://glygen.org/publication/PubMed/11337487" } ] }, { "title": "Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hogan A, Shepherd L, Chabot J, Quenneville S, Prescott SM, Topham MK, Gee SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "11352924", "url": "https://glygen.org/publication/PubMed/11352924" } ] }, { "title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11375993", "url": "https://glygen.org/publication/PubMed/11375993" } ] }, { "title": "Human tumor suppressor EXT gene family members EXTL1 and EXTL3 encode alpha 1,4- N-acetylglucosaminyltransferases that likely are involved in heparan sulfate/ heparin biosynthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-06-19", "authors": "Kim B T, Kitagawa H, Tamura J, Saito T, Kusche-Gullberg M, Lindahl U, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "11390981", "url": "https://glygen.org/publication/PubMed/11390981" } ] }, { "title": "Etiological point mutations in the hereditary multiple exostoses gene EXT1: a functional analysis of heparan sulfate polymerase activity.", "journal": "American journal of human genetics", "date": "2001", "authors": "Cheung PK, McCormick C, Crawford BE, Esko JD, Tufaro F, Duncan G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "11391482", "url": "https://glygen.org/publication/PubMed/11391482" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Specific disruption of a schwann cell dystrophin-related protein complex in a demyelinating neuropathy.", "journal": "Neuron", "date": "2001", "authors": "Sherman DL, Fabrizi C, Gillespie CS, Brophy PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "11430802", "url": "https://glygen.org/publication/PubMed/11430802" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein.", "journal": "Nature immunology", "date": "2001-08", "authors": "Tripp R A, Jones L P, Haynes L M, Zheng H, Murphy P M, Anderson L J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960" } ], "reference": [ { "type": "PubMed", "id": "11477410", "url": "https://glygen.org/publication/PubMed/11477410" } ] }, { "title": "The interaction of dystrophin with beta-dystroglycan is regulated by tyrosine phosphorylation.", "journal": "Cellular signalling", "date": "2001", "authors": "Ilsley JL, Sudol M, Winder SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "11495720", "url": "https://glygen.org/publication/PubMed/11495720" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "Biosynthesis of the linkage region of glycosaminoglycans: cloning and activity of galactosyltransferase II, the sixth member of the beta 1,3-galactosyltransferase family (beta 3GalT6).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Bai X, Zhou D, Brown JR, Crawford BE, Hennet T, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "11551958", "url": "https://glygen.org/publication/PubMed/11551958" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3.", "journal": "Nature", "date": "2001", "authors": "Alexopoulou L, Holt AC, Medzhitov R, Flavell RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "11607032", "url": "https://glygen.org/publication/PubMed/11607032" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "The heterogeneous nuclear ribonucleoprotein K (hnRNP K) interacts with dengue virus core protein.", "journal": "DNA and cell biology", "date": "2001", "authors": "Chang CJ, Luh HW, Wang SH, Lin HJ, Lee SC, Hu ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "11747608", "url": "https://glygen.org/publication/PubMed/11747608" } ] }, { "title": "Bivalirudin: a direct thrombin inhibitor.", "journal": "Clinical therapeutics", "date": "2002", "authors": "Gladwell TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "11833835", "url": "https://glygen.org/publication/PubMed/11833835" } ] }, { "title": "Not all perlecans are created equal: interactions with fibroblast growth factor (FGF) 2 and FGF receptors.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Knox S, Merry C, Stringer S, Melrose J, Whitelock J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "11847221", "url": "https://glygen.org/publication/PubMed/11847221" } ] }, { "title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.", "journal": "Carcinogenesis", "date": "2002", "authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11872628", "url": "https://glygen.org/publication/PubMed/11872628" } ] }, { "title": "UDP-glucuronate decarboxylase, a key enzyme in proteoglycan synthesis: cloning, characterization, and localization.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Moriarity JL, Hurt KJ, Resnick AC, Storm PB, Laroy W, Schnaar RL, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "11877387", "url": "https://glygen.org/publication/PubMed/11877387" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "Structural and functional mutations of the perlecan gene cause Schwartz-Jampel syndrome, with myotonic myopathy and chondrodysplasia.", "journal": "American journal of human genetics", "date": "2002-05", "authors": "Arikawa-Hirasawa Eri, Le Alexander H, Nishino Ichizo, Nonaka Ikuya, Ho Nicola C, Francomano Clair A, Govindraj Prasanthi, Hassell John R, Devaney Joseph M, Spranger J\u00fcrgen, Stevenson Roger E, Iannaccone Susan, Dalakas Marinos C, Yamada Yoshihiko", "evidence": [ { "database": "dbSNP", "id": "rs748523693", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748523693" } ], "reference": [ { "type": "PubMed", "id": "11941538", "url": "https://glygen.org/publication/PubMed/11941538" } ] }, { "title": "The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Tu Hongmin, Sasaki Takako, Snellman Anne, G\u00f6hring Walter, Piril\u00e4 Paivi, Timpl Rupert, Pihlajaniemi Taina", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "11956183", "url": "https://glygen.org/publication/PubMed/11956183" } ] }, { "title": "Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).", "journal": "Clinical & experimental metastasis", "date": "2002", "authors": "Tsuji T, Kawada Y, Kai-Murozono M, Komatsu S, Han SA, Takeuchi K, Mizushima H, Miyazaki K, Irimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11964076", "url": "https://glygen.org/publication/PubMed/11964076" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "Activation of endothelial cell protease activated receptor 1 by the protein C pathway.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Riewald M, Petrovan RJ, Donner A, Mueller BM, Ruf W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "12052963", "url": "https://glygen.org/publication/PubMed/12052963" } ] }, { "title": "Heparan sulfate 3-O-sulfotransferase isoform 5 generates both an antithrombin-binding site and an entry receptor for herpes simplex virus, type 1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Xia G, Chen J, Tiwari V, Ju W, Li JP, Malmstrom A, Shukla D, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "12138164", "url": "https://glygen.org/publication/PubMed/12138164" } ] }, { "title": "Zeta-sarcoglycan, a novel component of the sarcoglycan complex, is reduced in muscular dystrophy.", "journal": "Human molecular genetics", "date": "2002", "authors": "Wheeler MT, Zarnegar S, McNally EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "12189167", "url": "https://glygen.org/publication/PubMed/12189167" } ] }, { "title": "Structural recognition by recombinant human heparanase that plays critical roles in tumor metastasis. Hierarchical sulfate groups with different effects and the essential target disulfated trisaccharide sequence.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Okada Y, Yamada S, Toyoshima M, Dong J, Nakajima M, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "12213822", "url": "https://glygen.org/publication/PubMed/12213822" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Laminin modulates morphogenic properties of the collagen XVIII endostatin domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Javaherian K, Park SY, Pickl WF, LaMontagne KR, Sjin RT, Gillies S, Lo KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "12237301", "url": "https://glygen.org/publication/PubMed/12237301" } ] }, { "title": "Endorepellin, a novel inhibitor of angiogenesis derived from the C terminus of perlecan.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mongiat M, Sweeney SM, San Antonio JD, Fu J, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "12435733", "url": "https://glygen.org/publication/PubMed/12435733" } ] }, { "title": "Human heparanase is localized within lysosomes in a stable form.", "journal": "Experimental cell research", "date": "2002", "authors": "Goldshmidt O, Nadav L, Aingorn H, Irit C, Feinstein N, Ilan N, Zamir E, Geiger B, Vlodavsky I, Katz BZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "12441129", "url": "https://glygen.org/publication/PubMed/12441129" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "Biosynthesis of heparan sulphate with diverse structures and functions: two alternatively spliced forms of human heparan sulphate 6-O-sulphotransferase-2 having different expression patterns and properties.", "journal": "The Biochemical journal", "date": "2003", "authors": "Habuchi H, Miyake G, Nogami K, Kuroiwa A, Matsuda Y, Kusche-Gullberg M, Habuchi O, Tanaka M, Kimata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "12492399", "url": "https://glygen.org/publication/PubMed/12492399" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "Cloning, characterization, and chromosome mapping of the human GlcAT-S gene.", "journal": "Journal of human genetics", "date": "2002", "authors": "Marcos I, Galan JJ, Borrego S, Antinolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "12522689", "url": "https://glygen.org/publication/PubMed/12522689" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "Perlecan protein core interacts with extracellular matrix protein 1 (ECM1), a glycoprotein involved in bone formation and angiogenesis.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Mongiat Maurizio, Fu Jian, Oldershaw Rachel, Greenhalgh Robert, Gown Allen M, Iozzo Renato V", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "12604605", "url": "https://glygen.org/publication/PubMed/12604605" } ] }, { "title": "DC-SIGN (CD209) mediates dengue virus infection of human dendritic cells.", "journal": "The Journal of experimental medicine", "date": "2003-04-07", "authors": "Tassaneetrithep Boonrat, Burgess Timothy H, Granelli-Piperno Angela, Trumpfheller Christine, Finke Jennifer, Sun Wellington, Eller Michael A, Pattanapanyasat Kovit, Sarasombath Suttipant, Birx Deborah L, Steinman Ralph M, Schlesinger Sarah, Marovich Mary A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "12682107", "url": "https://glygen.org/publication/PubMed/12682107" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.", "journal": "Cancer research", "date": "2003", "authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12727852", "url": "https://glygen.org/publication/PubMed/12727852" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "The calpain system.", "journal": "Physiological reviews", "date": "2003", "authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12843408", "url": "https://glygen.org/publication/PubMed/12843408" } ] }, { "title": "Heparin-induced substrate behavior of antithrombin Cambridge II.", "journal": "Blood", "date": "2003", "authors": "Mushunje A, Zhou A, Carrell RW, Huntington JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "12907439", "url": "https://glygen.org/publication/PubMed/12907439" } ] }, { "title": "Heterodimer formation is essential for heparanase enzymatic activity.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Levy-Adam F, Miao HQ, Heinrikson RL, Vlodavsky I, Ilan N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "12927802", "url": "https://glygen.org/publication/PubMed/12927802" } ] }, { "title": "A 71-kilodalton protein is a major product of the Duchenne muscular dystrophy gene in brain and other nonmuscle tissues.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992-06-15", "authors": "Lederfein D, Levy Z, Augier N, Mornet D, Morris G, Fuchs O, Yaffe D, Nudel U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "1319059", "url": "https://glygen.org/publication/PubMed/1319059" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Martin-Serrano J, Yarovoy A, Perez-Caballero D, Bieniasz PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "14519844", "url": "https://glygen.org/publication/PubMed/14519844" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "C-terminal and heparin-binding domains of collagenic tail subunit are both essential for anchoring acetylcholinesterase at the synapse.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Kimbell Lewis M, Ohno Kinji, Engel Andrew G, Rotundo Richard L", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "14702351", "url": "https://glygen.org/publication/PubMed/14702351" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Specific in vivo phosphorylation sites determine the assembly dynamics of vimentin intermediate filaments.", "journal": "Journal of cell science", "date": "2004", "authors": "Eriksson JE, He T, Trejo-Skalli AV, Harmala-Brasken AS, Hellman J, Chou YH, Goldman RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ] }, { "title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "14973287", "url": "https://glygen.org/publication/PubMed/14973287" } ] }, { "title": "Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Diebold SS, Kaisho T, Hemmi H, Akira S, Reis e Sousa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "14976261", "url": "https://glygen.org/publication/PubMed/14976261" } ] }, { "title": "The factor V activation paradox.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Orfeo T, Brufatto N, Nesheim ME, Xu H, Butenas S, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "14982929", "url": "https://glygen.org/publication/PubMed/14982929" } ] }, { "title": "Structural basis for acceptor substrate recognition of a human glucuronyltransferase, GlcAT-P, an enzyme critical in the biosynthesis of the carbohydrate epitope HNK-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kakuda S, Shiba T, Ishiguro M, Tagawa H, Oka S, Kajihara Y, Kawasaki T, Wakatsuki S, Kato R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "14993226", "url": "https://glygen.org/publication/PubMed/14993226" } ] }, { "title": "Characterization of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) spike glycoprotein-mediated viral entry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Simmons G, Reeves JD, Rennekamp AJ, Amberg SM, Piefer AJ, Bates P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15010527", "url": "https://glygen.org/publication/PubMed/15010527" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Molecular cloning and characterization of a human multisubstrate specific nucleotide-sugar transporter homologous to Drosophila fringe connection.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Suda T, Kamiyama S, Suzuki M, Kikuchi N, Nakayama K, Narimatsu H, Jigami Y, Aoki T, Nishihara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "15082721", "url": "https://glygen.org/publication/PubMed/15082721" } ] }, { "title": "The non-structural 3 (NS3) protein of dengue virus type 2 interacts with human nuclear receptor binding protein and is associated with alterations in membrane structure.", "journal": "Virus research", "date": "2004", "authors": "Chua JJ, Ng MM, Chow VT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "15084397", "url": "https://glygen.org/publication/PubMed/15084397" } ] }, { "title": "Identification of GRP 78 (BiP) as a liver cell expressed receptor element for dengue virus serotype 2.", "journal": "Archives of virology", "date": "2004-05", "authors": "Jindadamrongwech S, Thepparit C, Smith D R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "15098107", "url": "https://glygen.org/publication/PubMed/15098107" } ] }, { "title": "pH-dependent entry of severe acute respiratory syndrome coronavirus is mediated by the spike glycoprotein and enhanced by dendritic cell transfer through DC-SIGN.", "journal": "Journal of virology", "date": "2004", "authors": "Yang ZY, Huang Y, Ganesh L, Leung K, Kong WP, Schwartz O, Subbarao K, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15140961", "url": "https://glygen.org/publication/PubMed/15140961" } ] }, { "title": "S protein of severe acute respiratory syndrome-associated coronavirus mediates entry into hepatoma cell lines and is targeted by neutralizing antibodies in infected patients.", "journal": "Journal of virology", "date": "2004", "authors": "Hofmann H, Hattermann K, Marzi A, Gramberg T, Geier M, Krumbiegel M, Kuate S, Uberla K, Niedrig M, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15163706", "url": "https://glygen.org/publication/PubMed/15163706" } ] }, { "title": "Dystroglycan in skin and cutaneous cells: beta-subunit is shed from the cell surface.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Herzog C, Has C, Franzke CW, Echtermeyer FG, Schlotzer-Schrehardt U, Kroger S, Gustafsson E, Fassler R, Bruckner-Tuderman L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "15175026", "url": "https://glygen.org/publication/PubMed/15175026" } ] }, { "title": "A novel missense mutation in the galactosyltransferase-I (B4GALT7) gene in a family exhibiting facioskeletal anomalies and Ehlers-Danlos syndrome resembling the progeroid type.", "journal": "American journal of medical genetics. Part A", "date": "2004", "authors": "Faiyaz-Ul-Haque M, Zaidi SH, Al-Ali M, Al-Mureikhi MS, Kennedy S, Al-Thani G, Tsui LC, Teebi AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "15211654", "url": "https://glygen.org/publication/PubMed/15211654" } ] }, { "title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15234972", "url": "https://glygen.org/publication/PubMed/15234972" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "Analysis of the DXD motifs in human xylosyltransferase I required for enzyme activity.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Gotting C, Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "15294915", "url": "https://glygen.org/publication/PubMed/15294915" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "Pannexin membrane channels are mechanosensitive conduits for ATP.", "journal": "FEBS letters", "date": "2004-08-13", "authors": "Bao Li, Locovei Silviu, Dahl Gerhard", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "15304325", "url": "https://glygen.org/publication/PubMed/15304325" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "Human xylosyltransferase I: functional and biochemical characterization of cysteine residues required for enzymic activity.", "journal": "The Biochemical journal", "date": "2005", "authors": "Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Gotting C, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "15461586", "url": "https://glygen.org/publication/PubMed/15461586" } ] }, { "title": "Efficient assembly and release of SARS coronavirus-like particles by a heterologous expression system.", "journal": "FEBS letters", "date": "2004", "authors": "Mortola E, Roy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15474033", "url": "https://glygen.org/publication/PubMed/15474033" } ] }, { "title": "Serotype-specific entry of dengue virus into liver cells: identification of the 37-kilodalton/67-kilodalton high-affinity laminin receptor as a dengue virus serotype 1 receptor.", "journal": "Journal of virology", "date": "2004-11", "authors": "Thepparit Chutima, Smith Duncan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "15507651", "url": "https://glygen.org/publication/PubMed/15507651" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] }, { "title": "Identification and characterization of human Golgi nucleotide sugar transporter SLC35D2, a novel member of the SLC35 nucleotide sugar transporter family.", "journal": "Genomics", "date": "2005", "authors": "Ishida N, Kuba T, Aoki K, Miyatake S, Kawakita M, Sanai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "15607426", "url": "https://glygen.org/publication/PubMed/15607426" } ] }, { "title": "Lysosomal metabolism of glycoproteins.", "journal": "Glycobiology", "date": "2005", "authors": "Winchester B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "15647514", "url": "https://glygen.org/publication/PubMed/15647514" } ] }, { "title": "Primary structure of the human heparan sulfate proteoglycan from basement membrane (HSPG2/perlecan). A chimeric molecule with multiple domains homologous to the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Murdoch AD, Dodge GR, Cohen I, Tuan RS, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "1569102", "url": "https://glygen.org/publication/PubMed/1569102" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "A variant in the CD209 promoter is associated with severity of dengue disease.", "journal": "Nature genetics", "date": "2005-05", "authors": "Sakuntabhai Anavaj, Turbpaiboon Chairat, Casad\u00e9mont Isabelle, Chuansumrit Ampaiwan, Lowhnoo Tassanee, Kajaste-Rudnitski Anna, Kalayanarooj Sita Mint, Tangnararatchakit Kanchana, Tangthawornchaikul Nattaya, Vasanawathana Sirijit, Chaiyaratana Wathanee, Yenchitsomanus Pa-Thai, Suriyaphol Prapat, Avirutnan Panisadee, Chokephaibulkit Kulkanya, Matsuda Fumihiko, Yoksan Sutee, Jacob Yves, Lathrop G Mark, Malasit Prida, Despr\u00e8s Philippe, Julier C\u00e9cile", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "15838506", "url": "https://glygen.org/publication/PubMed/15838506" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15958533", "url": "https://glygen.org/publication/PubMed/15958533" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.", "journal": "Acta neuropathologica", "date": "2005", "authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16133547", "url": "https://glygen.org/publication/PubMed/16133547" } ] }, { "title": "Molecular defects in Sanfilippo syndrome type B (mucopolysaccharidosis IIIB).", "journal": "Journal of inherited metabolic disease", "date": "2005", "authors": "Beesley CE, Jackson M, Young EP, Vellodi A, Winchester BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "16151907", "url": "https://glygen.org/publication/PubMed/16151907" } ] }, { "title": "Discovery of the novel antithrombotic agent 5-chloro-N-({(5S)-2-oxo-3- [4-(3-oxomorpholin-4-yl)phenyl]-1,3-oxazolidin-5-yl}methyl)thiophene- 2-carboxamide (BAY 59-7939): an oral, direct factor Xa inhibitor.", "journal": "Journal of medicinal chemistry", "date": "2005", "authors": "Roehrig S, Straub A, Pohlmann J, Lampe T, Pernerstorfer J, Schlemmer KH, Reinemer P, Perzborn E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "16161994", "url": "https://glygen.org/publication/PubMed/16161994" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "Characterization of the interaction between the A2 subunit and A1/A3-C1-C2 dimer in human factor VIIIa.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Fay PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "1618828", "url": "https://glygen.org/publication/PubMed/1618828" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Characterization of the N-deacetylase domain from the heparan sulfate N-deacetylase/N-sulfotransferase 2.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Duncan MB, Liu M, Fox C, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "16343444", "url": "https://glygen.org/publication/PubMed/16343444" } ] }, { "title": "Ligand-binding specificities of laminin-binding integrins: a comprehensive survey of laminin-integrin interactions using recombinant alpha3beta1, alpha6beta1, alpha7beta1 and alpha6beta4 integrins.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Nishiuchi R, Takagi J, Hayashi M, Ido H, Yagi Y, Sanzen N, Tsuji T, Yamada M, Sekiguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16413178", "url": "https://glygen.org/publication/PubMed/16413178" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).", "journal": "The Biochemical journal", "date": "1991", "authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1649600", "url": "https://glygen.org/publication/PubMed/1649600" } ] }, { "title": "Identification of functional domains in sarcoglycans essential for their interaction and plasma membrane targeting.", "journal": "Experimental cell research", "date": "2006", "authors": "Chen J, Shi W, Zhang Y, Sokol R, Cai H, Lun M, Moore BF, Farber MJ, Stepanchick JS, Bonnemann CG, Chan YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "16524571", "url": "https://glygen.org/publication/PubMed/16524571" } ] }, { "title": "Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Wilhelmsen K, Litjens SH, Sonnenberg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16581764", "url": "https://glygen.org/publication/PubMed/16581764" } ] }, { "title": "Antithrombin-S195A factor Xa-heparin structure reveals the allosteric mechanism of antithrombin activation.", "journal": "The EMBO journal", "date": "2006-05-03", "authors": "Johnson Daniel J D, Li Wei, Adams Ty E, Huntington James A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "16619025", "url": "https://glygen.org/publication/PubMed/16619025" } ] }, { "title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.", "journal": "Experimental cell research", "date": "2006", "authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16631740", "url": "https://glygen.org/publication/PubMed/16631740" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "Heparan sulfate proteoglycan of human colon: partial molecular cloning, cellular expression, and mapping of the gene (HSPG2) to the short arm of human chromosome 1.", "journal": "Genomics", "date": "1991", "authors": "Dodge GR, Kovalszky I, Chu ML, Hassell JR, McBride OW, Yi HF, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "1679749", "url": "https://glygen.org/publication/PubMed/1679749" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "The discoidin domain receptor DDR2 is a receptor for type X collagen.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Leitinger B, Kwan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "16806867", "url": "https://glygen.org/publication/PubMed/16806867" } ] }, { "title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.", "journal": "Endocrinology", "date": "2006", "authors": "Taleb S, Cancello R, Clement K, Lacasa D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16825321", "url": "https://glygen.org/publication/PubMed/16825321" } ] }, { "title": "Cloning of human heparan sulfate proteoglycan core protein, assignment of the gene (HSPG2) to 1p36.1-->p35 and identification of a BamHI restriction fragment length polymorphism.", "journal": "Genomics", "date": "1991", "authors": "Kallunki P, Eddy R L, Byers M G, Kestil\u00e4 M, Shows T B, Tryggvason K", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "1685141", "url": "https://glygen.org/publication/PubMed/1685141" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "Identification of the gene encoding the enzyme deficient in mucopolysaccharidosis IIIC (Sanfilippo disease type C).", "journal": "American journal of human genetics", "date": "2006", "authors": "Fan X, Zhang H, Zhang S, Bagshaw RD, Tropak MB, Callahan JW, Mahuran DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "16960811", "url": "https://glygen.org/publication/PubMed/16960811" } ] }, { "title": "A highly potent inhibitor of cathepsin K (relacatib) reduces biomarkers of bone resorption both in vitro and in an acute model of elevated bone turnover in vivo in monkeys.", "journal": "Bone", "date": "2007", "authors": "Kumar S, Dare L, Vasko-Moser JA, James IE, Blake SM, Rickard DJ, Hwang SM, Tomaszek T, Yamashita DS, Marquis RW, Oh H, Jeong JU, Veber DF, Gowen M, Lark MW, Stroup G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "16962401", "url": "https://glygen.org/publication/PubMed/16962401" } ] }, { "title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1698775", "url": "https://glygen.org/publication/PubMed/1698775" } ] }, { "title": "Mutations in TMEM76* cause mucopolysaccharidosis IIIC (Sanfilippo C syndrome).", "journal": "American journal of human genetics", "date": "2006", "authors": "Hrebicek M, Mrazova L, Seyrantepe V, Durand S, Roslin NM, Noskova L, Hartmannova H, Ivanek R, Cizkova A, Poupetova H, Sikora J, Urinovska J, Stranecky V, Zeman J, Lepage P, Roquis D, Verner A, Ausseil J, Beesley CE, Maire I, Poorthuis BJ, van de Kamp J, van Diggelen OP, Wevers RA, Hudson TJ, Fujiwara TM, Majewski J, Morgan K, Kmoch S, Pshezhetsky AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "17033958", "url": "https://glygen.org/publication/PubMed/17033958" } ] }, { "title": "Hyaluronan and its binding proteins, the hyaladherins.", "journal": "Current opinion in cell biology", "date": "1990", "authors": "Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1707285", "url": "https://glygen.org/publication/PubMed/1707285" } ] }, { "title": "Distorted relation between mRNA copy number and corresponding major histocompatibility complex ligand density on the cell surface.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007-01", "authors": "Weinzierl Andreas O, Lemmel Claudia, Schoor Oliver, M\u00fcller Margret, Kr\u00fcger Tobias, Wernet Dorothee, Hennenlotter J\u00f6rg, Stenzl Arnulf, Klingel Karin, Rammensee Hans-Georg, Stevanovic Stefan", "evidence": [ { "database": "IEDB", "id": "239382", "url": "https://www.iedb.org/epitope/239382" } ], "reference": [ { "type": "PubMed", "id": "17074750", "url": "https://glygen.org/publication/PubMed/17074750" } ] }, { "title": "Endorepellin in vivo: targeting the tumor vasculature and retarding cancer growth and metabolism.", "journal": "J. Natl. Cancer Inst.", "date": "2006", "authors": "Bix Gregory, Castello Remedios, Burrows Michelle, Zoeller Jason J, Weech Michelle, Iozzo Rex A, Cardi Christopher, Thakur Mathew L, Barker Christopher A, Camphausen Kevin, Iozzo Renato V", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "17105986", "url": "https://glygen.org/publication/PubMed/17105986" } ] }, { "title": "XT-II, the second isoform of human peptide-O-xylosyltransferase, displays enzymatic activity.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Voglmeir J, Voglauer R, Wilson IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "17194707", "url": "https://glygen.org/publication/PubMed/17194707" } ] }, { "title": "Reduced perlecan in mice results in chondrodysplasia resembling Schwartz-Jampel syndrome.", "journal": "Human molecular genetics", "date": "2007-03-01", "authors": "Rodgers Kathryn D, Sasaki Takako, Aszodi Attila, Jacenko Olena", "evidence": [ { "database": "dbSNP", "id": "rs137853248", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853248" } ], "reference": [ { "type": "PubMed", "id": "17213231", "url": "https://glygen.org/publication/PubMed/17213231" } ] }, { "title": "Human basement membrane heparan sulfate proteoglycan core protein: a 467-kD protein containing multiple domains resembling elements of the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.", "journal": "J. Cell Biol.", "date": "1992", "authors": "Kallunki P, Tryggvason K", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "1730768", "url": "https://glygen.org/publication/PubMed/1730768" } ] }, { "title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.", "journal": "Cancer research", "date": "2007", "authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17332331", "url": "https://glygen.org/publication/PubMed/17332331" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.", "journal": "Cancer", "date": "2007", "authors": "Johnson SK, Ramani VC, Hennings L, Haun RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17354228", "url": "https://glygen.org/publication/PubMed/17354228" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "Influence of extracellular monovalent cations on pore and gating properties of P2X7 receptor-operated single-channel currents.", "journal": "Biophysical journal", "date": "2007-08-01", "authors": "Riedel T, Schmalzing G, Markwardt F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "17483156", "url": "https://glygen.org/publication/PubMed/17483156" } ] }, { "title": "The pharmacokinetics, pharmacodynamics and tolerability of dabigatran etexilate, a new oral direct thrombin inhibitor, in healthy male subjects.", "journal": "British journal of clinical pharmacology", "date": "2007", "authors": "Stangier J, Rathgen K, Stahle H, Gansser D, Roth W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "17506785", "url": "https://glygen.org/publication/PubMed/17506785" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "In-vitro profile and ex-vivo anticoagulant activity of the direct thrombin inhibitor dabigatran and its orally active prodrug, dabigatran etexilate.", "journal": "Thrombosis and haemostasis", "date": "2007", "authors": "Wienen W, Stassen JM, Priepke H, Ries UJ, Hauel N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "17598008", "url": "https://glygen.org/publication/PubMed/17598008" } ] }, { "title": "The calpains: modular designs and functional diversity.", "journal": "Genome biology", "date": "2007", "authors": "Croall DE, Ersfeld K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17608959", "url": "https://glygen.org/publication/PubMed/17608959" } ] }, { "title": "Activated protein C.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2007", "authors": "Griffin JH, Fernandez JA, Gale AJ, Mosnier LO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "17635713", "url": "https://glygen.org/publication/PubMed/17635713" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "SEA domain proteolysis determines the functional composition of dystroglycan.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Akhavan A, Crivelli SN, Singh M, Lingappa VR, Muschler JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "17905726", "url": "https://glygen.org/publication/PubMed/17905726" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "Integrin alpha2beta1 is the required receptor for endorepellin angiostatic activity.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Woodall Benjamin P, Nystr\u00f6m Alexander, Iozzo Rex A, Eble Johannes A, Niland Stephan, Krieg Thomas, Eckes Beate, Pozzi Ambra, Iozzo Renato V", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "18024432", "url": "https://glygen.org/publication/PubMed/18024432" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "The mannose receptor mediates dengue virus infection of macrophages.", "journal": "PLoS pathogens", "date": "2008-02-08", "authors": "Miller Joanna L, de Wet Barend J M, deWet Barend J M, Martinez-Pomares Luisa, Radcliffe Catherine M, Dwek Raymond A, Rudd Pauline M, Gordon Siamon", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "18266465", "url": "https://glygen.org/publication/PubMed/18266465" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Structural basis of toll-like receptor 3 signaling with double-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Liu L, Botos I, Wang Y, Leonard JN, Shiloach J, Segal DM, Davies DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "18420935", "url": "https://glygen.org/publication/PubMed/18420935" } ] }, { "title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Najy AJ, Day KC, Day ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18434311", "url": "https://glygen.org/publication/PubMed/18434311" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Thyroglobulin peptides associate in vivo to HLA-DR in autoimmune thyroid glands.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008-07-01", "authors": "Muix\u00ed Laia, Carrascal Montserrat, Alvarez I\u00f1aki, Daura Xavier, Mart\u00ed Merc\u00e8, Armengol Maria Pilar, Pinilla Clemencia, Abian Joaqu\u00edn, Pujol-Borrell Ricardo, Jaraquemada Dolores", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "144321", "url": "https://www.iedb.org/epitope/144321" }, { "database": "IEDB", "id": "144359", "url": "https://www.iedb.org/epitope/144359" }, { "database": "IEDB", "id": "144548", "url": "https://www.iedb.org/epitope/144548" } ], "reference": [ { "type": "PubMed", "id": "18566446", "url": "https://glygen.org/publication/PubMed/18566446" } ] }, { "title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18658137", "url": "https://glygen.org/publication/PubMed/18658137" } ] }, { "title": "Structural basis for distinctive recognition of fibrinogen gammaC peptide by the platelet integrin alphaIIbbeta3.", "journal": "The Journal of cell biology", "date": "2008-08-25", "authors": "Springer Timothy A, Zhu Jianghai, Xiao Tsan", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "18710925", "url": "https://glygen.org/publication/PubMed/18710925" } ] }, { "title": "Characterization of factor VII association with tissue factor in solution. High and low affinity calcium binding sites in factor VII contribute to functionally distinct interactions.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ruf W, Kalnik MW, Lund-Hansen T, Edgington TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "1874730", "url": "https://glygen.org/publication/PubMed/1874730" } ] }, { "title": "Nuclear translocation of beta-dystroglycan reveals a distinctive trafficking pattern of autoproteolyzed mucins.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008", "authors": "Oppizzi ML, Akhavan A, Singh M, Fata JE, Muschler JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "18764929", "url": "https://glygen.org/publication/PubMed/18764929" } ] }, { "title": "Characterization of the anti-angiogenic properties of arresten, an alpha1beta1 integrin-dependent collagen-derived tumor suppressor.", "journal": "Experimental cell research", "date": "2008-11-01", "authors": "Nyberg Pia, Xie Liang, Sugimoto Hikaru, Colorado Pablo, Sund Malin, Holthaus Kathryn, Sudhakar Akulapalli, Salo Tuula, Kalluri Raghu", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "18775695", "url": "https://glygen.org/publication/PubMed/18775695" } ] }, { "title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19010778", "url": "https://glygen.org/publication/PubMed/19010778" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Human factor VIIIa subunit structure. Reconstruction of factor VIIIa from the isolated A1/A3-C1-C2 dimer and A2 subunit.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Fay PJ, Haidaris PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "1902833", "url": "https://glygen.org/publication/PubMed/1902833" } ] }, { "title": "Peptides presented in vivo by HLA-DR in thyroid autoimmunity.", "journal": "Advances in immunology", "date": "2008", "authors": "Muix\u00ed Laia, Alvarez I\u00f1aki, Jaraquemada Dolores", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "144321", "url": "https://www.iedb.org/epitope/144321" }, { "database": "IEDB", "id": "144359", "url": "https://www.iedb.org/epitope/144359" }, { "database": "IEDB", "id": "144548", "url": "https://www.iedb.org/epitope/144548" } ], "reference": [ { "type": "PubMed", "id": "19117535", "url": "https://glygen.org/publication/PubMed/19117535" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Discovery of betrixaban (PRT054021), N-(5-chloropyridin-2-yl)-2-(4-(N,N-dimethylcarbamimidoyl)benzamido)-5-methoxybenz amide, a highly potent, selective, and orally efficacious factor Xa inhibitor.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2009", "authors": "Zhang P, Huang W, Wang L, Bao L, Jia ZJ, Bauer SM, Goldman EA, Probst GD, Song Y, Su T, Fan J, Wu Y, Li W, Woolfrey J, Sinha U, Wong PW, Edwards ST, Arfsten AE, Clizbe LA, Kanter J, Pandey A, Park G, Hutchaleelaha A, Lambing JL, Hollenbach SJ, Scarborough RM, Zhu BY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "19297154", "url": "https://glygen.org/publication/PubMed/19297154" } ] }, { "title": "Inhibition of the thrombin-platelet reactions by DuP 714.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chiu AT, Mousa SA, Pease LJ, Roscoe WA, Bozarth JM, Reilly TM, Smith RD, Timmermans PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "1930190", "url": "https://glygen.org/publication/PubMed/1930190" } ] }, { "title": "New mutations of EXT1 and EXT2 genes in German patients with Multiple Osteochondromas.", "journal": "Annals of human genetics", "date": "2009", "authors": "Heinritz W, Huffmeier U, Strenge S, Miterski B, Zweier C, Leinung S, Bohring A, Mitulla B, Peters U, Froster UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656237", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237" } ], "reference": [ { "type": "PubMed", "id": "19344451", "url": "https://glygen.org/publication/PubMed/19344451" } ] }, { "title": "Targeted deletion of the genes encoding NTH1 and NEIL1 DNA N-glycosylases reveals the existence of novel carcinogenic oxidative damage to DNA.", "journal": "DNA repair", "date": "2009", "authors": "Chan MK, Ocampo-Hafalla MT, Vartanian V, Jaruga P, Kirkali G, Koenig KL, Brown S, Lloyd RS, Dizdaroglu M, Teebor GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "19346169", "url": "https://glygen.org/publication/PubMed/19346169" } ] }, { "title": "Human alpha-L-iduronidase: cDNA isolation and expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Scott HS, Anson DS, Orsborn AM, Nelson PV, Clements PR, Morris CP, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "1946389", "url": "https://glygen.org/publication/PubMed/1946389" } ] }, { "title": "FAM20B is a kinase that phosphorylates xylose in the glycosaminoglycan-protein linkage region.", "journal": "The Biochemical journal", "date": "2009", "authors": "Koike T, Izumikawa T, Tamura J, Kitagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "19473117", "url": "https://glygen.org/publication/PubMed/19473117" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.", "journal": "Journal of vascular research", "date": "2009", "authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19571574", "url": "https://glygen.org/publication/PubMed/19571574" } ] }, { "title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19657146", "url": "https://glygen.org/publication/PubMed/19657146" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).", "journal": "Arthritis and rheumatism", "date": "2009", "authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19714641", "url": "https://glygen.org/publication/PubMed/19714641" } ] }, { "title": "Role of tyrosine phosphatase SHP-1 in the mechanism of endorepellin angiostatic activity.", "journal": "Blood", "date": "2009-11-26", "authors": "Nystr\u00f6m Alexander, Shaik Zabeena P, Gullberg Donald, Krieg Thomas, Eckes Beate, Zent Roy, Pozzi Ambra, Iozzo Renato V", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "19789387", "url": "https://glygen.org/publication/PubMed/19789387" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Enzymatic processing of beta-dystroglycan recombinant ectodomain by MMP-9: identification of the main cleavage site.", "journal": "IUBMB life", "date": "2009", "authors": "Bozzi M, Inzitari R, Sbardell D, Monaco S, Pavoni E, Gioia M, Marini S, Morlacchi S, Sciandra F, Castagnola M, Giardina B, Brancaccio A, Coletta M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "19946898", "url": "https://glygen.org/publication/PubMed/19946898" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "O-mannosyl phosphorylation of alpha-dystroglycan is required for laminin binding.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Yoshida-Moriguchi T, Yu L, Stalnaker SH, Davis S, Kunz S, Madson M, Oldstone MB, Schachter H, Wells L, Campbell KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "20044576", "url": "https://glygen.org/publication/PubMed/20044576" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P98160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P98160" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.", "journal": "Journal of neuropathology and experimental neurology", "date": "2010", "authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "20142769", "url": "https://glygen.org/publication/PubMed/20142769" } ] }, { "title": "Cooperative activation of human factor IX by the human extrinsic pathway of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Lawson JH, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "2040636", "url": "https://glygen.org/publication/PubMed/2040636" } ] }, { "title": "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta.", "journal": "Journal of virology", "date": "2010", "authors": "Yoboua F, Martel A, Duval A, Mukawera E, Grandvaux N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "20410276", "url": "https://glygen.org/publication/PubMed/20410276" } ] }, { "title": "Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Huang X, Dementiev A, Olson ST, Gettins PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "20427285", "url": "https://glygen.org/publication/PubMed/20427285" } ] }, { "title": "Target selection of heparan sulfate hexuronic acid 2-O-sulfotransferase.", "journal": "Glycobiology", "date": "2010", "authors": "Smeds E, Feta A, Kusche-Gullberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "20554947", "url": "https://glygen.org/publication/PubMed/20554947" } ] }, { "title": "Loss-of-function mutations in HPSE2 cause the autosomal recessive urofacial syndrome.", "journal": "American journal of human genetics", "date": "2010", "authors": "Pang J, Zhang S, Yang P, Hawkins-Lee B, Zhong J, Zhang Y, Ochoa B, Agundez JA, Voelckel MA, Fisher RB, Gu W, Xiong WC, Mei L, She JX, Wang CY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "20560209", "url": "https://glygen.org/publication/PubMed/20560209" } ] }, { "title": "Mutations in HPSE2 cause urofacial syndrome.", "journal": "American journal of human genetics", "date": "2010", "authors": "Daly SB, Urquhart JE, Hilton E, McKenzie EA, Kammerer RA, Lewis M, Kerr B, Stuart H, Donnai D, Long DA, Burgu B, Aydogdu O, Derbent M, Garcia-Minaur S, Reardon W, Gener B, Shalev S, Smith R, Woolf AS, Black GC, Newman WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "20560210", "url": "https://glygen.org/publication/PubMed/20560210" } ] }, { "title": "Heparanase 2 interacts with heparan sulfate with high affinity and inhibits heparanase activity.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Levy-Adam F, Feld S, Cohen-Kaplan V, Shteingauz A, Gross M, Arvatz G, Naroditsky I, Ilan N, Doweck I, Vlodavsky I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "20576607", "url": "https://glygen.org/publication/PubMed/20576607" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Analysis of the biogenesis of heparan sulfate acetyl-CoA:alpha-glucosaminide N-acetyltransferase provides insights into the mechanism underlying its complete deficiency in mucopolysaccharidosis IIIC.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Durand S, Feldhammer M, Bonneil E, Thibault P, Pshezhetsky AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "20650889", "url": "https://glygen.org/publication/PubMed/20650889" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "Molecular characterization of beta1,4-galactosyltransferase 7 genetic mutations linked to the progeroid form of Ehlers-Danlos syndrome (EDS).", "journal": "FEBS letters", "date": "2010", "authors": "Bui C, Talhaoui I, Chabel M, Mulliert G, Coughtrie MW, Ouzzine M, Fournel-Gigleux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "20691685", "url": "https://glygen.org/publication/PubMed/20691685" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.", "journal": "Experimental animals", "date": "2010", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21030783", "url": "https://glygen.org/publication/PubMed/21030783" } ] }, { "title": "A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry.", "journal": "Journal of virology", "date": "2011", "authors": "Shulla A, Heald-Sargent T, Subramanya G, Zhao J, Perlman S, Gallagher T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "21068237", "url": "https://glygen.org/publication/PubMed/21068237" } ] }, { "title": "Peptides presented by HLA-DR molecules in synovia of patients with rheumatoid arthritis or antibiotic-refractory Lyme arthritis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011-03", "authors": "Seward Robert J, Drouin Elise E, Steere Allen C, Costello Catherine E", "evidence": [ { "database": "IEDB", "id": "152983", "url": "https://www.iedb.org/epitope/152983" } ], "reference": [ { "type": "PubMed", "id": "21081667", "url": "https://glygen.org/publication/PubMed/21081667" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "Hunter syndrome: isolation of an iduronate-2-sulfatase cDNA clone and analysis of patient DNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Wilson PJ, Morris CP, Anson DS, Occhiodoro T, Bielicki J, Clements PR, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "2122463", "url": "https://glygen.org/publication/PubMed/2122463" } ] }, { "title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21297635", "url": "https://glygen.org/publication/PubMed/21297635" } ] }, { "title": "Evidence that TMPRSS2 activates the severe acute respiratory syndrome coronavirus spike protein for membrane fusion and reduces viral control by the humoral immune response.", "journal": "Journal of virology", "date": "2011", "authors": "Glowacka I, Bertram S, Muller MA, Allen P, Soilleux E, Pfefferle S, Steffen I, Tsegaye TS, He Y, Gnirss K, Niemeyer D, Schneider H, Drosten C, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "21325420", "url": "https://glygen.org/publication/PubMed/21325420" } ] }, { "title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.", "journal": "Oncogene", "date": "2011", "authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21441952", "url": "https://glygen.org/publication/PubMed/21441952" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.", "journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences", "date": "2011", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21670566", "url": "https://glygen.org/publication/PubMed/21670566" } ] }, { "title": "Heparan sulfate 6-O-sulfotransferase 1, a gene involved in extracellular sugar modifications, is mutated in patients with idiopathic hypogonadotrophic hypogonadism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Tornberg J, Sykiotis GP, Keefe K, Plummer L, Hoang X, Hall JE, Quinton R, Seminara SB, Hughes V, Van Vliet G, Van Uum S, Crowley WF, Habuchi H, Kimata K, Pitteloud N, Bulow HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "21700882", "url": "https://glygen.org/publication/PubMed/21700882" } ] }, { "title": "Faulty initiation of proteoglycan synthesis causes cardiac and joint defects.", "journal": "American journal of human genetics", "date": "2011", "authors": "Baasanjav S, Al-Gazali L, Hashiguchi T, Mizumoto S, Fischer B, Horn D, Seelow D, Ali BR, Aziz SA, Langer R, Saleh AA, Becker C, Nurnberg G, Cantagrel V, Gleeson JG, Gomez D, Michel JB, Stricker S, Lindner TH, Nurnberg P, Sugahara K, Mundlos S, Hoffmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801" } ], "reference": [ { "type": "PubMed", "id": "21763480", "url": "https://glygen.org/publication/PubMed/21763480" } ] }, { "title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21784848", "url": "https://glygen.org/publication/PubMed/21784848" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "Calpains: an elaborate proteolytic system.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Ono Y, Sorimachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21864727", "url": "https://glygen.org/publication/PubMed/21864727" } ] }, { "title": "A physical interaction network of dengue virus and human proteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Khadka S, Vangeloff AD, Zhang C, Siddavatam P, Heaton NS, Wang L, Sengupta R, Sahasrabudhe S, Randall G, Gribskov M, Kuhn RJ, Perera R, LaCount DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "21911577", "url": "https://glygen.org/publication/PubMed/21911577" } ] }, { "title": "Desirudin: a review of the pharmacology and clinical application for the prevention of deep vein thrombosis.", "journal": "Expert review of cardiovascular therapy", "date": "2011", "authors": "Graetz TJ, Tellor BR, Smith JR, Avidan MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "21932952", "url": "https://glygen.org/publication/PubMed/21932952" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "Crystal structure of the LG3 domain of endorepellin, an angiogenesis inhibitor.", "journal": "J. Mol. Biol.", "date": "2011", "authors": "Le Binh V, Kim Hun, Choi Jongkeun, Kim Jin-Hahn, Hahn Myong-Joon, Lee Cheolju, Kim Kyeong Kyu, Hwang Hye-Yeon", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "21996443", "url": "https://glygen.org/publication/PubMed/21996443" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Respiratory syncytial virus glycoprotein G interacts with DC-SIGN and L-SIGN to activate ERK1 and ERK2.", "journal": "Journal of virology", "date": "2012-02", "authors": "Johnson Teresa R, McLellan Jason S, Graham Barney S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "22090124", "url": "https://glygen.org/publication/PubMed/22090124" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "TFPI\u03b2 is the GPI-anchored TFPI isoform on human endothelial cells and placental microsomes.", "journal": "Blood", "date": "2012-02-02", "authors": "Girard Thomas J, Tuley Elodee, Broze George J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "22144186", "url": "https://glygen.org/publication/PubMed/22144186" } ] }, { "title": "Laminin-alpha1 LG4-5 domain binding to dystroglycan mediates muscle cell survival, growth, and the AP-1 and NF-kappaB transcription factors but also has adverse effects.", "journal": "American journal of physiology. Cell physiology", "date": "2012", "authors": "Zhou YW, Munoz J, Jiang D, Jarrett HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "22159078", "url": "https://glygen.org/publication/PubMed/22159078" } ] }, { "title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.", "journal": "Journal of cell science", "date": "2011", "authors": "Shi F, Sottile J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "22159414", "url": "https://glygen.org/publication/PubMed/22159414" } ] }, { "title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "reference": [ { "type": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "title": "Dystroglycan function requires xylosyl- and glucuronyltransferase activities of LARGE.", "journal": "Science (New York, N.Y.)", "date": "2012", "authors": "Inamori K, Yoshida-Moriguchi T, Hara Y, Anderson ME, Yu L, Campbell KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "22223806", "url": "https://glygen.org/publication/PubMed/22223806" } ] }, { "title": "Proteolytic activation of human factors IX and X by recombinant human factor VIIa: effects of calcium, phospholipids, and tissue factor.", "journal": "Biochemistry", "date": "1990", "authors": "Komiyama Y, Pedersen AH, Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "2248955", "url": "https://glygen.org/publication/PubMed/2248955" } ] }, { "title": "The epidermal basement membrane is a composite of separate laminin- or collagen IV-containing networks connected by aggregated perlecan, but not by nidogens.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Behrens DT, Villone D, Koch M, Brunner G, Sorokin L, Robenek H, Bruckner-Tuderman L, Bruckner P, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "22493504", "url": "https://glygen.org/publication/PubMed/22493504" } ] }, { "title": "Simultaneous treatment of human bronchial epithelial cells with serine and cysteine protease inhibitors prevents severe acute respiratory syndrome coronavirus entry.", "journal": "Journal of virology", "date": "2012", "authors": "Kawase M, Shirato K, van der Hoek L, Taguchi F, Matsuyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "22496216", "url": "https://glygen.org/publication/PubMed/22496216" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "Crystal structures of protease nexin-1 in complex with heparin and thrombin suggest a 2-step recognition mechanism.", "journal": "Blood", "date": "2012", "authors": "Li W, Huntington JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "22618708", "url": "https://glygen.org/publication/PubMed/22618708" } ] }, { "title": "Structural biology of factor VIIa/tissue factor initiated coagulation.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2012", "authors": "Vadivel K, Bajaj SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "22652793", "url": "https://glygen.org/publication/PubMed/22652793" } ] }, { "title": "Regulation of coagulation by a multivalent Kunitz-type inhibitor.", "journal": "Biochemistry", "date": "1990", "authors": "Broze GJ Jr, Girard TJ, Novotny WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "2271516", "url": "https://glygen.org/publication/PubMed/2271516" } ] }, { "title": "Structural basis for catalytic activation of protein Z-dependent protease inhibitor (ZPI) by protein Z.", "journal": "Blood", "date": "2012", "authors": "Huang X, Yan Y, Tu Y, Gatti J, Broze GJ Jr, Zhou A, Olson ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "22786881", "url": "https://glygen.org/publication/PubMed/22786881" } ] }, { "title": "Structure and mechanism of human UDP-xylose synthase: evidence for a promoting role of sugar ring distortion in a three-step catalytic conversion of UDP-glucuronic acid.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eixelsberger T, Sykora S, Egger S, Brunsteiner M, Kavanagh KL, Oppermann U, Brecker L, Nidetzky B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "22810237", "url": "https://glygen.org/publication/PubMed/22810237" } ] }, { "title": "Mechanisms of coronavirus cell entry mediated by the viral spike protein.", "journal": "Viruses", "date": "2012", "authors": "Belouzard S, Millet JK, Licitra BN, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "22816037", "url": "https://glygen.org/publication/PubMed/22816037" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "Regulation of tissue factor coagulant activity on cell surfaces.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2012", "authors": "Rao LV, Pendurthi UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "23006890", "url": "https://glygen.org/publication/PubMed/23006890" } ] }, { "title": "Structure-function relationships in calpains.", "journal": "The Biochemical journal", "date": "2012", "authors": "Campbell RL, Davies PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23035980", "url": "https://glygen.org/publication/PubMed/23035980" } ] }, { "title": "The TIM and TAM families of phosphatidylserine receptors mediate dengue virus entry.", "journal": "Cell host & microbe", "date": "2012-10-18", "authors": "Meertens Laurent, Carnec Xavier, Lecoin Manuel Perera, Ramdasi Rasika, Guivel-Benhassine Florence, Lew Erin, Lemke Greg, Schwartz Olivier, Amara Ali", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "23084921", "url": "https://glygen.org/publication/PubMed/23084921" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Effects of some antituberculous and anti-leprotic drugs on cathepsins B, H and L.", "journal": "Indian journal of clinical biochemistry : IJCB", "date": "2003", "authors": "Kamboj RC, Raghav N, Mittal A, Khurana S, Sadana R, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "23105391", "url": "https://glygen.org/publication/PubMed/23105391" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "Multiple clinical forms of dehydrated hereditary stomatocytosis arise from mutations in PIEZO1.", "journal": "Blood", "date": "2013", "authors": "Andolfo I, Alper SL, De Franceschi L, Auriemma C, Russo R, De Falco L, Vallefuoco F, Esposito MR, Vandorpe DH, Shmukler BE, Narayan R, Montanaro D, D'Armiento M, Vetro A, Limongelli I, Zuffardi O, Glader BE, Schrier SL, Brugnara C, Stewart GW, Delaunay J, Iolascon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "23479567", "url": "https://glygen.org/publication/PubMed/23479567" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Analysis of tissue factor expression in various cell model systems: cryptic vs. active.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2013", "authors": "Kothari H, Pendurthi UR, Rao LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "23621622", "url": "https://glygen.org/publication/PubMed/23621622" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Human UDP-alpha-d-xylose synthase forms a catalytically important tetramer that has not been observed in crystal structures.", "journal": "Biochemistry", "date": "2013", "authors": "Polizzi SJ, Walsh RM Jr, Le Magueres P, Criswell AR, Wood ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "23656592", "url": "https://glygen.org/publication/PubMed/23656592" } ] }, { "title": "Integrins modulate the infection efficiency of West Nile virus into cells.", "journal": "The Journal of general virology", "date": "2013-08", "authors": "Schmidt Katja, Keller Markus, Bader Bernhard L, Koryt\u00e1\u0159 Tom\u00e1\u0161, Finke Stefan, Ziegler Ute, Groschup Martin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "23658209", "url": "https://glygen.org/publication/PubMed/23658209" } ] }, { "title": "Mutations in B3GALT6, which encodes a glycosaminoglycan linker region enzyme, cause a spectrum of skeletal and connective tissue disorders.", "journal": "American journal of human genetics", "date": "2013", "authors": "Nakajima M, Mizumoto S, Miyake N, Kogawa R, Iida A, Ito H, Kitoh H, Hirayama A, Mitsubuchi H, Miyazaki O, Kosaki R, Horikawa R, Lai A, Mendoza-Londono R, Dupuis L, Chitayat D, Howard A, Leal GF, Cavalcanti D, Tsurusaki Y, Saitsu H, Watanabe S, Lausch E, Unger S, Bonafe L, Ohashi H, Superti-Furga A, Matsumoto N, Sugahara K, Nishimura G, Ikegawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332" } ], "reference": [ { "type": "PubMed", "id": "23664117", "url": "https://glygen.org/publication/PubMed/23664117" } ] }, { "title": "Defective initiation of glycosaminoglycan synthesis due to B3GALT6 mutations causes a pleiotropic Ehlers-Danlos-syndrome-like connective tissue disorder.", "journal": "American journal of human genetics", "date": "2013", "authors": "Malfait F, Kariminejad A, Van Damme T, Gauche C, Syx D, Merhi-Soussi F, Gulberti S, Symoens S, Vanhauwaert S, Willaert A, Bozorgmehr B, Kariminejad MH, Ebrahimiadib N, Hausser I, Huysseune A, Fournel-Gigleux S, De Paepe A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332" } ], "reference": [ { "type": "PubMed", "id": "23664118", "url": "https://glygen.org/publication/PubMed/23664118" } ] }, { "title": "Efficacy and toxicity of factor Xa inhibitors.", "journal": "Journal of pharmacy & pharmaceutical sciences : a publication of the Canadian Society for Pharmaceutical Sciences, Societe canadienne des sciences pharmaceutiques", "date": "2013", "authors": "Bondarenko M, Curti C, Montana M, Rathelot P, Vanelle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "23683607", "url": "https://glygen.org/publication/PubMed/23683607" } ] }, { "title": "Dehydrated hereditary stomatocytosis linked to gain-of-function mutations in mechanically activated PIEZO1 ion channels.", "journal": "Nature communications", "date": "2013", "authors": "Albuisson J, Murthy SE, Bandell M, Coste B, Louis-Dit-Picard H, Mathur J, Feneant-Thibault M, Tertian G, de Jaureguiberry JP, Syfuss PY, Cahalan S, Garcon L, Toutain F, Simon Rohrlich P, Delaunay J, Picard V, Jeunemaitre X, Patapoutian A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "23695678", "url": "https://glygen.org/publication/PubMed/23695678" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.", "journal": "Joint, bone, spine : revue du rhumatisme", "date": "2014", "authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23845380", "url": "https://glygen.org/publication/PubMed/23845380" } ] }, { "title": "Clot-bound thrombin is protected from inhibition by heparin-antithrombin III but is susceptible to inactivation by antithrombin III-independent inhibitors.", "journal": "The Journal of clinical investigation", "date": "1990", "authors": "Weitz JI, Hudoba M, Massel D, Maraganore J, Hirsh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "2384594", "url": "https://glygen.org/publication/PubMed/2384594" } ] }, { "title": "The interaction between claudin-1 and dengue viral prM/M protein for its entry.", "journal": "Virology", "date": "2013-11", "authors": "Che Pulin, Tang Hengli, Li Qianjun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "24074594", "url": "https://glygen.org/publication/PubMed/24074594" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "TMPRSS2 and ADAM17 cleave ACE2 differentially and only proteolysis by TMPRSS2 augments entry driven by the severe acute respiratory syndrome coronavirus spike protein.", "journal": "Journal of virology", "date": "2014", "authors": "Heurich A, Hofmann-Winkler H, Gierer S, Liepold T, Jahn O, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "24227843", "url": "https://glygen.org/publication/PubMed/24227843" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "Identification of phosphatase that dephosphorylates xylose in the glycosaminoglycan-protein linkage region of proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Koike T, Izumikawa T, Sato B, Kitagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "24425863", "url": "https://glygen.org/publication/PubMed/24425863" } ] }, { "title": "Ehlers-Danlos syndrome associated with glycosaminoglycan abnormalities.", "journal": "Advances in experimental medicine and biology", "date": "2014", "authors": "Miyake N, Kosho T, Matsumoto N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "24443026", "url": "https://glygen.org/publication/PubMed/24443026" } ] }, { "title": "The new factor Xa inhibitor: Apixaban.", "journal": "Journal of pharmacology & pharmacotherapeutics", "date": "2014", "authors": "Bhanwra S, Ahluwalia K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "24554904", "url": "https://glygen.org/publication/PubMed/24554904" } ] }, { "title": "The nature and extent of contributions by defective ribosome products to the HLA peptidome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-04-22", "authors": "Bourdetsky Dmitry, Schmelzer Christian E H, Admon Arie", "evidence": [ { "database": "IEDB", "id": "504175", "url": "https://www.iedb.org/epitope/504175" } ], "reference": [ { "type": "PubMed", "id": "24715725", "url": "https://glygen.org/publication/PubMed/24715725" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "Identification of chondroitin sulfate linkage region glycopeptides reveals prohormones as a novel class of proteoglycans.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015-01", "authors": "Noborn Fredrik, Gomez Toledo Alejandro, Sihlbom Carina, Lengqvist Johan, Fries Erik, Kjell\u00e9n Lena, Nilsson Jonas, Larson G\u00f6ran", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "25326458", "url": "https://glygen.org/publication/PubMed/25326458" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Naturally processed non-canonical HLA-A*02:01 presented peptides.", "journal": "The Journal of biological chemistry", "date": "2015-01-30", "authors": "Hassan Chopie, Chabrol Eric, Jahn Lorenz, Kester Michel G D, de Ru Arnoud H, Drijfhout Jan W, Rossjohn Jamie, Falkenburg J H Frederik, Heemskerk Mirjam H M, Gras Stephanie, van Veelen Peter A", "evidence": [ { "database": "IEDB", "id": "239382", "url": "https://www.iedb.org/epitope/239382" } ], "reference": [ { "type": "PubMed", "id": "25505266", "url": "https://glygen.org/publication/PubMed/25505266" } ] }, { "title": "Man o' war mutation in UDP-alpha-D-xylose synthase favors the abortive catalytic cycle and uncovers a latent potential for hexamer formation.", "journal": "Biochemistry", "date": "2015", "authors": "Walsh RM Jr, Polizzi SJ, Kadirvelraj R, Howard WW, Wood ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "25521717", "url": "https://glygen.org/publication/PubMed/25521717" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015-03", "authors": "Bassani-Sternberg Michal, Pletscher-Frankild Sune, Jensen Lars Juhl, Mann Matthias", "evidence": [ { "database": "IEDB", "id": "485466", "url": "https://www.iedb.org/epitope/485466" }, { "database": "IEDB", "id": "487139", "url": "https://www.iedb.org/epitope/487139" } ], "reference": [ { "type": "PubMed", "id": "25576301", "url": "https://glygen.org/publication/PubMed/25576301" } ] }, { "title": "Exploration of peptides bound to MHC class I molecules in melanoma.", "journal": "Pigment cell & melanoma research", "date": "2015-05", "authors": "Pritchard Antonia L, Hastie Marcus L, Neller Michelle, Gorman Jeffrey J, Schmidt Chris W, Hayward Nicholas K", "evidence": [ { "database": "IEDB", "id": "239382", "url": "https://www.iedb.org/epitope/239382" }, { "database": "IEDB", "id": "471545", "url": "https://www.iedb.org/epitope/471545" }, { "database": "IEDB", "id": "487139", "url": "https://www.iedb.org/epitope/487139" }, { "database": "IEDB", "id": "540859", "url": "https://www.iedb.org/epitope/540859" }, { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "542966", "url": "https://www.iedb.org/epitope/542966" }, { "database": "IEDB", "id": "543869", "url": "https://www.iedb.org/epitope/543869" }, { "database": "IEDB", "id": "544009", "url": "https://www.iedb.org/epitope/544009" }, { "database": "IEDB", "id": "544494", "url": "https://www.iedb.org/epitope/544494" }, { "database": "IEDB", "id": "544870", "url": "https://www.iedb.org/epitope/544870" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "545656", "url": "https://www.iedb.org/epitope/545656" }, { "database": "IEDB", "id": "545816", "url": "https://www.iedb.org/epitope/545816" }, { "database": "IEDB", "id": "545817", "url": "https://www.iedb.org/epitope/545817" }, { "database": "IEDB", "id": "545859", "url": "https://www.iedb.org/epitope/545859" } ], "reference": [ { "type": "PubMed", "id": "25645385", "url": "https://glygen.org/publication/PubMed/25645385" } ] }, { "title": "Thermodynamic and kinetic characterization of the protein Z-dependent protease inhibitor (ZPI)-protein Z interaction reveals an unexpected role for ZPI Lys-239.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Huang X, Zhou J, Zhou A, Olson ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "25713144", "url": "https://glygen.org/publication/PubMed/25713144" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyGen", "id": "GLY_000268", "url": "https://data.glygen.org/GLY_000268" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.", "journal": "Virology", "date": "2015-08", "authors": "Li Yan, Jain Neeraj, Limpanawat Suweeraya, To Janet, Quistgaard Esben M, Nordlund Par, Thanabalu Thirumaran, Torres Jaume", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "25854864", "url": "https://glygen.org/publication/PubMed/25854864" } ] }, { "title": "Edoxaban, a Novel Oral Factor Xa Inhibitor.", "journal": "The Annals of pharmacotherapy", "date": "2015", "authors": "Minor C, Tellor KB, Armbruster AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "25855704", "url": "https://glygen.org/publication/PubMed/25855704" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "RNASEK is required for internalization of diverse acid-dependent viruses.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015-06-23", "authors": "Hackett Brent A, Yasunaga Ari, Panda Debasis, Tartell Michael A, Hopkins Kaycie C, Hensley Scott E, Cherry Sara", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "26056282", "url": "https://glygen.org/publication/PubMed/26056282" } ] }, { "title": "Dengue virus NS1 protein interacts with the ribosomal protein RPL18: this interaction is required for viral translation and replication in Huh-7 cells.", "journal": "Virology", "date": "2015", "authors": "Cervantes-Salazar M, Angel-Ambrocio AH, Soto-Acosta R, Bautista-Carbajal P, Hurtado-Monzon AM, Alcaraz-Estrada SL, Ludert JE, Del Angel RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "26092250", "url": "https://glygen.org/publication/PubMed/26092250" } ] }, { "title": "RNASEK Is a V-ATPase-Associated Factor Required for Endocytosis and the Replication of Rhinovirus, Influenza A Virus, and Dengue Virus.", "journal": "Cell reports", "date": "2015", "authors": "Perreira JM, Aker AM, Savidis G, Chin CR, McDougall WM, Portmann JM, Meraner P, Smith MC, Rahman M, Baker RE, Gauthier A, Franti M, Brass AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "26212330", "url": "https://glygen.org/publication/PubMed/26212330" } ] }, { "title": "Genome-Wide Screen Reveals Valosin-Containing Protein Requirement for Coronavirus Exit from Endosomes.", "journal": "Journal of virology", "date": "2015", "authors": "Wong HH, Kumar P, Tay FP, Moreau D, Liu DX, Bard F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "26311884", "url": "https://glygen.org/publication/PubMed/26311884" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "The Phosphatidylserine and Phosphatidylethanolamine Receptor CD300a Binds Dengue Virus and Enhances Infection.", "journal": "Journal of virology", "date": "2016", "authors": "Carnec X, Meertens L, Dejarnac O, Perera-Lecoin M, Hafirassou ML, Kitaura J, Ramdasi R, Schwartz O, Amara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "26468529", "url": "https://glygen.org/publication/PubMed/26468529" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Matrix-associated heparan sulfate proteoglycan: core protein-specific monoclonal antibodies decorate the pericellular matrix of connective tissue cells and the stromal side of basement membranes.", "journal": "J. Cell Biol.", "date": "1989", "authors": "Heremans A, van der Schueren B, de Cock B, Paulsson M, Cassiman JJ, van den Berghe H, David G", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "2687294", "url": "https://glygen.org/publication/PubMed/2687294" } ] }, { "title": "Glycopeptide Antibiotics Potently Inhibit Cathepsin L in the Late Endosome/Lysosome and Block the Entry of Ebola Virus, Middle East Respiratory Syndrome Coronavirus (MERS-CoV), and Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV).", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Zhou N, Pan T, Zhang J, Li Q, Zhang X, Bai C, Huang F, Peng T, Zhang J, Liu C, Tao L, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "26953343", "url": "https://glygen.org/publication/PubMed/26953343" } ] }, { "title": "High-sensitivity HLA class I peptidome analysis enables a precise definition of peptide motifs and the identification of peptides from cell lines and patients' sera.", "journal": "Proteomics", "date": "2016-05", "authors": "Ritz Danilo, Gloger Andreas, Weide Benjamin, Garbe Claus, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "603063", "url": "https://www.iedb.org/epitope/603063" }, { "database": "IEDB", "id": "616198", "url": "https://www.iedb.org/epitope/616198" }, { "database": "IEDB", "id": "618512", "url": "https://www.iedb.org/epitope/618512" }, { "database": "IEDB", "id": "624268", "url": "https://www.iedb.org/epitope/624268" }, { "database": "IEDB", "id": "625366", "url": "https://www.iedb.org/epitope/625366" }, { "database": "IEDB", "id": "627429", "url": "https://www.iedb.org/epitope/627429" } ], "reference": [ { "type": "PubMed", "id": "26992070", "url": "https://glygen.org/publication/PubMed/26992070" } ] }, { "title": "Localization of tissue factor in the normal vessel wall and in the atherosclerotic plaque.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Wilcox JN, Smith KM, Schwartz SM, Gordon D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "2704749", "url": "https://glygen.org/publication/PubMed/2704749" } ] }, { "title": "Mass spectrometric analysis of host cell proteins interacting with dengue virus nonstructural protein 1 in dengue virus-infected HepG2 cells.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Dechtawewat T, Paemanee A, Roytrakul S, Songprakhon P, Limjindaporn T, Yenchitsomanus PT, Saitornuang S, Puttikhunt C, Kasinrerk W, Malasit P, Noisakran S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "27108190", "url": "https://glygen.org/publication/PubMed/27108190" } ] }, { "title": "Activation of factor IX by the reaction product of tissue factor and factor VII: additional pathway for initiating blood coagulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1977-12", "authors": "Osterud B, Rapaport S I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "271951", "url": "https://glygen.org/publication/PubMed/271951" } ] }, { "title": "In vitro characterization of TMPRSS2 inhibition in IPEC-J2 cells.", "journal": "Journal of enzyme inhibition and medicinal chemistry", "date": "2016", "authors": "Paszti-Gere E, Czimmermann E, Ujhelyi G, Balla P, Maiwald A, Steinmetzer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "27277342", "url": "https://glygen.org/publication/PubMed/27277342" } ] }, { "title": "Identification of Nafamostat as a Potent Inhibitor of Middle East Respiratory Syndrome Coronavirus S Protein-Mediated Membrane Fusion Using the Split-Protein-Based Cell-Cell Fusion Assay.", "journal": "Antimicrobial agents and chemotherapy", "date": "2016", "authors": "Yamamoto M, Matsuyama S, Li X, Takeda M, Kawaguchi Y, Inoue JI, Matsuda Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "27550352", "url": "https://glygen.org/publication/PubMed/27550352" } ] }, { "title": "Mass spectrometric analysis of the HLA class I peptidome of melanoma cell lines as a promising tool for the identification of putative tumor-associated HLA epitopes.", "journal": "Cancer immunology, immunotherapy : CII", "date": "2016-11", "authors": "Gloger Andreas, Ritz Danilo, Fugmann Tim, Neri Dario", "evidence": [ { "database": "IEDB", "id": "562039", "url": "https://www.iedb.org/epitope/562039" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" } ], "reference": [ { "type": "PubMed", "id": "27600516", "url": "https://glygen.org/publication/PubMed/27600516" } ] }, { "title": "Immunogenic HLA-DR-Presented Self-Peptides Identified Directly from Clinical Samples of Synovial Tissue, Synovial Fluid, or Peripheral Blood in Patients with Rheumatoid Arthritis or Lyme Arthritis.", "journal": "Journal of proteome research", "date": "2017-01-06", "authors": "Wang Qi, Drouin Elise E, Yao Chunxiang, Zhang Jiyang, Huang Yu, Leon Deborah R, Steere Allen C, Costello Catherine E", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "144321", "url": "https://www.iedb.org/epitope/144321" }, { "database": "IEDB", "id": "545656", "url": "https://www.iedb.org/epitope/545656" }, { "database": "IEDB", "id": "591986", "url": "https://www.iedb.org/epitope/591986" }, { "database": "IEDB", "id": "591987", "url": "https://www.iedb.org/epitope/591987" }, { "database": "IEDB", "id": "592225", "url": "https://www.iedb.org/epitope/592225" }, { "database": "IEDB", "id": "592363", "url": "https://www.iedb.org/epitope/592363" }, { "database": "IEDB", "id": "592915", "url": "https://www.iedb.org/epitope/592915" }, { "database": "IEDB", "id": "593111", "url": "https://www.iedb.org/epitope/593111" } ], "reference": [ { "type": "PubMed", "id": "27726376", "url": "https://glygen.org/publication/PubMed/27726376" } ] }, { "title": "Endothelial cation channel PIEZO1 controls blood pressure by mediating flow-induced ATP release.", "journal": "The Journal of clinical investigation", "date": "2016", "authors": "Wang S, Chennupati R, Kaur H, Iring A, Wettschureck N, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "27797339", "url": "https://glygen.org/publication/PubMed/27797339" } ] }, { "title": "Dengue Virus Infection Is through a Cooperative Interaction between a Mannose Receptor and CLEC5A on Macrophage as a Multivalent Hetero-Complex.", "journal": "PloS one", "date": "2016", "authors": "Lo YL, Liou GG, Lyu JH, Hsiao M, Hsu TL, Wong CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "27832191", "url": "https://glygen.org/publication/PubMed/27832191" } ] }, { "title": "A large fraction of HLA class I ligands are proteasome-generated spliced peptides.", "journal": "Science (New York, N.Y.)", "date": "2016-10-21", "authors": "Liepe Juliane, Marino Fabio, Sidney John, Jeko Anita, Bunting Daniel E, Sette Alessandro, Kloetzel Peter M, Stumpf Michael P H, Heck Albert J R, Mishto Michele", "evidence": [ { "database": "IEDB", "id": "590300", "url": "https://www.iedb.org/epitope/590300" } ], "reference": [ { "type": "PubMed", "id": "27846572", "url": "https://glygen.org/publication/PubMed/27846572" } ] }, { "title": "Purification of soluble HLA class I complexes from human serum or plasma deliver high quality immuno peptidomes required for biomarker discovery.", "journal": "Proteomics", "date": "2017-01", "authors": "Ritz Danilo, Gloger Andreas, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" } ], "reference": [ { "type": "PubMed", "id": "27862975", "url": "https://glygen.org/publication/PubMed/27862975" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Mutations in EXTL3 Cause Neuro-immuno-skeletal Dysplasia Syndrome.", "journal": "American journal of human genetics", "date": "2017", "authors": "Oud MM, Tuijnenburg P, Hempel M, van Vlies N, Ren Z, Ferdinandusse S, Jansen MH, Santer R, Johannsen J, Bacchelli C, Alders M, Li R, Davies R, Dupuis L, Cale CM, Wanders RJA, Pals ST, Ocaka L, James C, Muller I, Lehmberg K, Strom T, Engels H, Williams HJ, Beales P, Roepman R, Dias P, Brunner HG, Cobben JM, Hall C, Hartley T, Le Quesne Stabej P, Mendoza-Londono R, Davies EG, de Sousa SB, Lessel D, Arts HH, Kuijpers TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "28132690", "url": "https://glygen.org/publication/PubMed/28132690" } ] }, { "title": "Antibodies Directed against a Peptide Epitope of a Klebsiella pneumoniae-Derived Protein Are Present in Ankylosing Spondylitis.", "journal": "PloS one", "date": "2017", "authors": "Puccetti Antonio, Dolcino Marzia, Tinazzi Elisa, Moretta Francesca, D'Angelo Salvatore, Olivieri Ignazio, Lunardi Claudio", "evidence": [ { "database": "IEDB", "id": "581422", "url": "https://www.iedb.org/epitope/581422" } ], "reference": [ { "type": "PubMed", "id": "28135336", "url": "https://glygen.org/publication/PubMed/28135336" } ] }, { "title": "EXTL3 mutations cause skeletal dysplasia, immune deficiency, and developmental delay.", "journal": "The Journal of experimental medicine", "date": "2017", "authors": "Volpi S, Yamazaki Y, Brauer PM, van Rooijen E, Hayashida A, Slavotinek A, Sun Kuehn H, Di Rocco M, Rivolta C, Bortolomai I, Du L, Felgentreff K, Ott de Bruin L, Hayashida K, Freedman G, Marcovecchio GE, Capuder K, Rath P, Luche N, Hagedorn EJ, Buoncompagni A, Royer-Bertrand B, Giliani S, Poliani PL, Imberti L, Dobbs K, Poulain FE, Martini A, Manis J, Linhardt RJ, Bosticardo M, Rosenzweig SD, Lee H, Puck JM, Zuniga-Pflucker JC, Zon L, Park PW, Superti-Furga A, Notarangelo LD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "28148688", "url": "https://glygen.org/publication/PubMed/28148688" } ] }, { "title": "MHC-I peptides get out of the groove and enable a novel mechanism of HIV-1 escape.", "journal": "Nature structural & molecular biology", "date": "2017-04", "authors": "Pymm Phillip, Illing Patricia T, Ramarathinam Sri H, O'Connor Geraldine M, Hughes Victoria A, Hitchen Corinne, Price David A, Ho Bosco K, McVicar Daniel W, Brooks Andrew G, Purcell Anthony W, Rossjohn Jamie, Vivian Julian P", "evidence": [ { "database": "IEDB", "id": "603063", "url": "https://www.iedb.org/epitope/603063" } ], "reference": [ { "type": "PubMed", "id": "28218747", "url": "https://glygen.org/publication/PubMed/28218747" } ] }, { "title": "The Intergenic Recombinant HLA-B *46:01 Has a Distinctive Peptidome that Includes KIR2DL3 Ligands.", "journal": "Cell reports", "date": "2017", "authors": "Hilton HG, McMurtrey CP, Han AS, Djaoud Z, Guethlein LA, Blokhuis JH, Pugh JL, Goyos A, Horowitz A, Buchli R, Jackson KW, Bardet W, Bushnell DA, Robinson PJ, Mendoza JL, Birnbaum ME, Nielsen M, Garcia KC, Hildebrand WH, Parham P", "evidence": [ { "database": "IEDB", "id": "642717", "url": "https://www.iedb.org/epitope/642717" } ], "reference": [ { "type": "PubMed", "id": "28514659", "url": "https://glygen.org/publication/PubMed/28514659" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P98160", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" }, { "database": "O-GlcNAc Atlas", "id": "P98160", "url": "https://oglcnac.org/atlas/detail/P98160" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Data-Independent Acquisition of HLA Class I Peptidomes on the Q Exactive Mass Spectrometer Platform.", "journal": "Proteomics", "date": "2017-10", "authors": "Ritz Danilo, Kinzi Jonny, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "616198", "url": "https://www.iedb.org/epitope/616198" }, { "database": "IEDB", "id": "618512", "url": "https://www.iedb.org/epitope/618512" }, { "database": "IEDB", "id": "625366", "url": "https://www.iedb.org/epitope/625366" }, { "database": "IEDB", "id": "735355", "url": "https://www.iedb.org/epitope/735355" } ], "reference": [ { "type": "PubMed", "id": "28834231", "url": "https://glygen.org/publication/PubMed/28834231" } ] }, { "title": "Unveiling the Peptide Motifs of HLA-C and HLA-G from Naturally Presented Peptides and Generation of Binding Prediction Matrices.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2017-10-15", "authors": "Di Marco Moreno, Schuster Heiko, Backert Linus, Ghosh Michael, Rammensee Hans-Georg, Stevanovi\u0107 Stefan", "evidence": [ { "database": "IEDB", "id": "545859", "url": "https://www.iedb.org/epitope/545859" } ], "reference": [ { "type": "PubMed", "id": "28904123", "url": "https://glygen.org/publication/PubMed/28904123" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "High-throughput and Sensitive Immunopeptidomics Platform Reveals Profound Interferon\u03b3-Mediated Remodeling of the Human Leukocyte Antigen (HLA) Ligandome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018-03", "authors": "Chong Chloe, Marino Fabio, Pak HuiSong, Racle Julien, Daniel Roy T, M\u00fcller Markus, Gfeller David, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "591987", "url": "https://www.iedb.org/epitope/591987" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "883876", "url": "https://www.iedb.org/epitope/883876" }, { "database": "IEDB", "id": "1226664", "url": "https://www.iedb.org/epitope/1226664" }, { "database": "IEDB", "id": "1927459", "url": "https://www.iedb.org/epitope/1927459" } ], "reference": [ { "type": "PubMed", "id": "29242379", "url": "https://glygen.org/publication/PubMed/29242379" } ] }, { "title": "The Peptide Repertoire of HLA-B27 may include Ligands with Lysine at P2 Anchor Position.", "journal": "Proteomics", "date": "2018-05", "authors": "Yair-Sabag Shira, Tedeschi Valentina, Vitulano Carolina, Barnea Eilon, Glaser Fabian, Melamed Kadosh Dganit, Taurog Joel D, Fiorillo Maria Teresa, Sorrentino Rosa, Admon Arie", "evidence": [ { "database": "IEDB", "id": "675882", "url": "https://www.iedb.org/epitope/675882" }, { "database": "IEDB", "id": "815331", "url": "https://www.iedb.org/epitope/815331" }, { "database": "IEDB", "id": "821745", "url": "https://www.iedb.org/epitope/821745" } ], "reference": [ { "type": "PubMed", "id": "29393594", "url": "https://glygen.org/publication/PubMed/29393594" } ] }, { "title": "Anticoagulant Protein S Targets the Factor IXa Heparin-Binding Exosite to Prevent Thrombosis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2018", "authors": "Plautz WE, Sekhar Pilli VS, Cooley BC, Chattopadhyay R, Westmark PR, Getz T, Paul D, Bergmeier W, Sheehan JP, Majumder R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "29419409", "url": "https://glygen.org/publication/PubMed/29419409" } ] }, { "title": "Respiratory syncytial virus prolifically infects N2a neuronal cells, leading to TLR4 and nucleolin protein modulations and RSV F protein co-localization with TLR4 and nucleolin.", "journal": "Journal of biomedical science", "date": "2018", "authors": "Yuan X, Hu T, He H, Qiu H, Wu X, Chen J, Wang M, Chen C, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960" } ], "reference": [ { "type": "PubMed", "id": "29427996", "url": "https://glygen.org/publication/PubMed/29427996" } ] }, { "title": "Identification of Native and Posttranslationally Modified HLA-B*57:01-Restricted HIV Envelope Derived Epitopes Using Immunoproteomics.", "journal": "Proteomics", "date": "2018-06", "authors": "Ramarathinam Sri H, Gras Stephanie, Alcantara Sheilajen, Yeung Amanda W S, Mifsud Nicole A, Sonza Secondo, Illing Patricia T, Glaros Elias N, Center Robert J, Thomas Shane R, Kent Stephen J, Ternette Nicola, Purcell Damian F J, Rossjohn Jamie, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "603063", "url": "https://www.iedb.org/epitope/603063" } ], "reference": [ { "type": "PubMed", "id": "29437277", "url": "https://glygen.org/publication/PubMed/29437277" } ] }, { "title": "Tissue Factor: An Essential Mediator of Hemostasis and Trigger of Thrombosis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2018", "authors": "Grover SP, Mackman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "29437578", "url": "https://glygen.org/publication/PubMed/29437578" } ] }, { "title": "The natural HLA ligandome of glioblastoma stem-like cells: antigen discovery for T cell-based immunotherapy.", "journal": "Acta neuropathologica", "date": "2018-06", "authors": "Neidert Marian Christoph, Kowalewski Daniel Johannes, Silginer Manuela, Kapolou Konstantina, Backert Linus, Freudenmann Lena Katharina, Peper Janet Kerstin, Marcu Ana, Wang Sophie Shih-Y\u00fcng, Walz Juliane Sarah, Wolpert Fabian, Rammensee Hans-Georg, Henschler Reinhard, Lamszus Katrin, Westphal Manfred, Roth Patrick, Regli Luca, Stevanovi\u0107 Stefan, Weller Michael, Eisele G\u00fcnter", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "144321", "url": "https://www.iedb.org/epitope/144321" }, { "database": "IEDB", "id": "485466", "url": "https://www.iedb.org/epitope/485466" }, { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "542387", "url": "https://www.iedb.org/epitope/542387" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "545656", "url": "https://www.iedb.org/epitope/545656" }, { "database": "IEDB", "id": "545816", "url": "https://www.iedb.org/epitope/545816" }, { "database": "IEDB", "id": "545817", "url": "https://www.iedb.org/epitope/545817" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "592225", "url": "https://www.iedb.org/epitope/592225" }, { "database": "IEDB", "id": "592915", "url": "https://www.iedb.org/epitope/592915" }, { "database": "IEDB", "id": "593022", "url": "https://www.iedb.org/epitope/593022" }, { "database": "IEDB", "id": "627429", "url": "https://www.iedb.org/epitope/627429" }, { "database": "IEDB", "id": "770774", "url": "https://www.iedb.org/epitope/770774" }, { "database": "IEDB", "id": "774600", "url": "https://www.iedb.org/epitope/774600" }, { "database": "IEDB", "id": "815331", "url": "https://www.iedb.org/epitope/815331" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "876938", "url": "https://www.iedb.org/epitope/876938" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "883876", "url": "https://www.iedb.org/epitope/883876" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" }, { "database": "IEDB", "id": "917183", "url": "https://www.iedb.org/epitope/917183" }, { "database": "IEDB", "id": "1080167", "url": "https://www.iedb.org/epitope/1080167" }, { "database": "IEDB", "id": "1086078", "url": "https://www.iedb.org/epitope/1086078" }, { "database": "IEDB", "id": "1088208", "url": "https://www.iedb.org/epitope/1088208" }, { "database": "IEDB", "id": "1088248", "url": "https://www.iedb.org/epitope/1088248" }, { "database": "IEDB", "id": "1088886", "url": "https://www.iedb.org/epitope/1088886" }, { "database": "IEDB", "id": "1088968", "url": "https://www.iedb.org/epitope/1088968" }, { "database": "IEDB", "id": "1089126", "url": "https://www.iedb.org/epitope/1089126" }, { "database": "IEDB", "id": "1089423", "url": "https://www.iedb.org/epitope/1089423" }, { "database": "IEDB", "id": "1089424", "url": "https://www.iedb.org/epitope/1089424" }, { "database": "IEDB", "id": "1089725", "url": "https://www.iedb.org/epitope/1089725" }, { "database": "IEDB", "id": "1089889", "url": "https://www.iedb.org/epitope/1089889" }, { "database": "IEDB", "id": "1090274", "url": "https://www.iedb.org/epitope/1090274" }, { "database": "IEDB", "id": "1090307", "url": "https://www.iedb.org/epitope/1090307" }, { "database": "IEDB", "id": "1090309", "url": "https://www.iedb.org/epitope/1090309" }, { "database": "IEDB", "id": "1090311", "url": "https://www.iedb.org/epitope/1090311" }, { "database": "IEDB", "id": "1091169", "url": "https://www.iedb.org/epitope/1091169" }, { "database": "IEDB", "id": "1092004", "url": "https://www.iedb.org/epitope/1092004" }, { "database": "IEDB", "id": "1092306", "url": "https://www.iedb.org/epitope/1092306" }, { "database": "IEDB", "id": "1092322", "url": "https://www.iedb.org/epitope/1092322" }, { "database": "IEDB", "id": "1093669", "url": "https://www.iedb.org/epitope/1093669" }, { "database": "IEDB", "id": "1093670", "url": "https://www.iedb.org/epitope/1093670" }, { "database": "IEDB", "id": "1094439", "url": "https://www.iedb.org/epitope/1094439" }, { "database": "IEDB", "id": "1096165", "url": "https://www.iedb.org/epitope/1096165" }, { "database": "IEDB", "id": "1097592", "url": "https://www.iedb.org/epitope/1097592" }, { "database": "IEDB", "id": "1097593", "url": "https://www.iedb.org/epitope/1097593" }, { "database": "IEDB", "id": "1097594", "url": "https://www.iedb.org/epitope/1097594" }, { "database": "IEDB", "id": "1097771", "url": "https://www.iedb.org/epitope/1097771" }, { "database": "IEDB", "id": "1097772", "url": "https://www.iedb.org/epitope/1097772" }, { "database": "IEDB", "id": "1098148", "url": "https://www.iedb.org/epitope/1098148" }, { "database": "IEDB", "id": "1098932", "url": "https://www.iedb.org/epitope/1098932" }, { "database": "IEDB", "id": "1098933", "url": "https://www.iedb.org/epitope/1098933" }, { "database": "IEDB", "id": "1099653", "url": "https://www.iedb.org/epitope/1099653" }, { "database": "IEDB", "id": "1100275", "url": "https://www.iedb.org/epitope/1100275" }, { "database": "IEDB", "id": "1100481", "url": "https://www.iedb.org/epitope/1100481" }, { "database": "IEDB", "id": "1100482", "url": "https://www.iedb.org/epitope/1100482" }, { "database": "IEDB", "id": "1100483", "url": "https://www.iedb.org/epitope/1100483" }, { "database": "IEDB", "id": "1100997", "url": "https://www.iedb.org/epitope/1100997" }, { "database": "IEDB", "id": "1101116", "url": "https://www.iedb.org/epitope/1101116" }, { "database": "IEDB", "id": "1102551", "url": "https://www.iedb.org/epitope/1102551" }, { "database": "IEDB", "id": "1102895", "url": "https://www.iedb.org/epitope/1102895" }, { "database": "IEDB", "id": "1106328", "url": "https://www.iedb.org/epitope/1106328" }, { "database": "IEDB", "id": "1106411", "url": "https://www.iedb.org/epitope/1106411" }, { "database": "IEDB", "id": "1106440", "url": "https://www.iedb.org/epitope/1106440" }, { "database": "IEDB", "id": "1106441", "url": "https://www.iedb.org/epitope/1106441" }, { "database": "IEDB", "id": "1107272", "url": "https://www.iedb.org/epitope/1107272" }, { "database": "IEDB", "id": "1107273", "url": "https://www.iedb.org/epitope/1107273" }, { "database": "IEDB", "id": "1107300", "url": "https://www.iedb.org/epitope/1107300" }, { "database": "IEDB", "id": "1108129", "url": "https://www.iedb.org/epitope/1108129" }, { "database": "IEDB", "id": "1108131", "url": "https://www.iedb.org/epitope/1108131" }, { "database": "IEDB", "id": "1108529", "url": "https://www.iedb.org/epitope/1108529" }, { "database": "IEDB", "id": "1108657", "url": "https://www.iedb.org/epitope/1108657" }, { "database": "IEDB", "id": "1108658", "url": "https://www.iedb.org/epitope/1108658" }, { "database": "IEDB", "id": "1108659", "url": "https://www.iedb.org/epitope/1108659" }, { "database": "IEDB", "id": "1108796", "url": "https://www.iedb.org/epitope/1108796" }, { "database": "IEDB", "id": "1108797", "url": "https://www.iedb.org/epitope/1108797" }, { "database": "IEDB", "id": "1108936", "url": "https://www.iedb.org/epitope/1108936" }, { "database": "IEDB", "id": "1109242", "url": "https://www.iedb.org/epitope/1109242" }, { "database": "IEDB", "id": "1109387", "url": "https://www.iedb.org/epitope/1109387" }, { "database": "IEDB", "id": "1109802", "url": "https://www.iedb.org/epitope/1109802" }, { "database": "IEDB", "id": "1111248", "url": "https://www.iedb.org/epitope/1111248" }, { "database": "IEDB", "id": "1111929", "url": "https://www.iedb.org/epitope/1111929" }, { "database": "IEDB", "id": "1112402", "url": "https://www.iedb.org/epitope/1112402" }, { "database": "IEDB", "id": "1112919", "url": "https://www.iedb.org/epitope/1112919" }, { "database": "IEDB", "id": "1113063", "url": "https://www.iedb.org/epitope/1113063" }, { "database": "IEDB", "id": "1113064", "url": "https://www.iedb.org/epitope/1113064" }, { "database": "IEDB", "id": "1113756", "url": "https://www.iedb.org/epitope/1113756" }, { "database": "IEDB", "id": "1113972", "url": "https://www.iedb.org/epitope/1113972" }, { "database": "IEDB", "id": "1114325", "url": "https://www.iedb.org/epitope/1114325" }, { "database": "IEDB", "id": "1115428", "url": "https://www.iedb.org/epitope/1115428" }, { "database": "IEDB", "id": "1117822", "url": "https://www.iedb.org/epitope/1117822" }, { "database": "IEDB", "id": "1118304", "url": "https://www.iedb.org/epitope/1118304" }, { "database": "IEDB", "id": "1119210", "url": "https://www.iedb.org/epitope/1119210" }, { "database": "IEDB", "id": "1119587", "url": "https://www.iedb.org/epitope/1119587" }, { "database": "IEDB", "id": "1119737", "url": "https://www.iedb.org/epitope/1119737" }, { "database": "IEDB", "id": "1120341", "url": "https://www.iedb.org/epitope/1120341" }, { "database": "IEDB", "id": "1120470", "url": "https://www.iedb.org/epitope/1120470" }, { "database": "IEDB", "id": "1120723", "url": "https://www.iedb.org/epitope/1120723" }, { "database": "IEDB", "id": "1120788", "url": "https://www.iedb.org/epitope/1120788" }, { "database": "IEDB", "id": "1120959", "url": "https://www.iedb.org/epitope/1120959" }, { "database": "IEDB", "id": "1121947", "url": "https://www.iedb.org/epitope/1121947" }, { "database": "IEDB", "id": "1122795", "url": "https://www.iedb.org/epitope/1122795" }, { "database": "IEDB", "id": "1123316", "url": "https://www.iedb.org/epitope/1123316" }, { "database": "IEDB", "id": "1123454", "url": "https://www.iedb.org/epitope/1123454" }, { "database": "IEDB", "id": "1123611", "url": "https://www.iedb.org/epitope/1123611" } ], "reference": [ { "type": "PubMed", "id": "29557506", "url": "https://glygen.org/publication/PubMed/29557506" } ] }, { "title": "Flavivirus internalization is regulated by a size-dependent endocytic pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018-04-17", "authors": "Hackett Brent A, Cherry Sara", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "29610346", "url": "https://glygen.org/publication/PubMed/29610346" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "TIM-1 Ubiquitination Mediates Dengue Virus Entry.", "journal": "Cell reports", "date": "2018", "authors": "Dejarnac O, Hafirassou ML, Chazal M, Versapuech M, Gaillard J, Perera-Lecoin M, Umana-Diaz C, Bonnet-Madin L, Carnec X, Tinevez JY, Delaugerre C, Schwartz O, Roingeard P, Jouvenet N, Berlioz-Torrent C, Meertens L, Amara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "29742433", "url": "https://glygen.org/publication/PubMed/29742433" } ] }, { "title": "Immunopeptidomic Profiling of HLA-A2-Positive Triple Negative Breast Cancer Identifies Potential Immunotherapy Target Antigens.", "journal": "Proteomics", "date": "2018-06", "authors": "Ternette Nicola, Olde Nordkamp Marloes J M, M\u00fcller Julius, Anderson Amanda P, Nicastri Annalisa, Hill Adrian V S, Kessler Benedikt M, Li Demin", "evidence": [ { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "544870", "url": "https://www.iedb.org/epitope/544870" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "675882", "url": "https://www.iedb.org/epitope/675882" }, { "database": "IEDB", "id": "770774", "url": "https://www.iedb.org/epitope/770774" }, { "database": "IEDB", "id": "772930", "url": "https://www.iedb.org/epitope/772930" }, { "database": "IEDB", "id": "777376", "url": "https://www.iedb.org/epitope/777376" }, { "database": "IEDB", "id": "777855", "url": "https://www.iedb.org/epitope/777855" }, { "database": "IEDB", "id": "778326", "url": "https://www.iedb.org/epitope/778326" }, { "database": "IEDB", "id": "779023", "url": "https://www.iedb.org/epitope/779023" } ], "reference": [ { "type": "PubMed", "id": "29786170", "url": "https://glygen.org/publication/PubMed/29786170" } ] }, { "title": "Mapping the HLA Ligandome of Colorectal Cancer Reveals an Imprint of Malignant Cell Transformation.", "journal": "Cancer research", "date": "2018-08-15", "authors": "L\u00f6ffler Markus W, Kowalewski Daniel J, Backert Linus, Bernhardt J\u00f6rg, Adam Patrick, Schuster Heiko, Dengler Florian, Backes Daniel, Kopp Hans-Georg, Beckert Stefan, Wagner Silvia, K\u00f6nigsrainer Ingmar, Kohlbacher Oliver, Kanz Lothar, K\u00f6nigsrainer Alfred, Rammensee Hans-Georg, Stevanovi\u0107 Stefan, Haen Sebastian P", "evidence": [ { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" } ], "reference": [ { "type": "PubMed", "id": "29789417", "url": "https://glygen.org/publication/PubMed/29789417" } ] }, { "title": "Flaviviruses Exploit the Lipid Droplet Protein AUP1 to Trigger Lipophagy and Drive Virus Production.", "journal": "Cell host & microbe", "date": "2018", "authors": "Zhang J, Lan Y, Li MY, Lamers MM, Fusade-Boyer M, Klemm E, Thiele C, Ashour J, Sanyal S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "29902443", "url": "https://glygen.org/publication/PubMed/29902443" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "HLA-B57 micropolymorphism defines the sequence and conformational breadth of the immunopeptidome.", "journal": "Nature communications", "date": "2018-11-08", "authors": "Illing Patricia T, Pymm Phillip, Croft Nathan P, Hilton Hugo G, Jojic Vladimir, Han Alex S, Mendoza Juan L, Mifsud Nicole A, Dudek Nadine L, McCluskey James, Parham Peter, Rossjohn Jamie, Vivian Julian P, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "627429", "url": "https://www.iedb.org/epitope/627429" } ], "reference": [ { "type": "PubMed", "id": "30410026", "url": "https://glygen.org/publication/PubMed/30410026" } ] }, { "title": "The Length Distribution and Multiple Specificity of Naturally Presented HLA-I Ligands.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2018-12-15", "authors": "Gfeller David, Guillaume Philippe, Michaux Justine, Pak Hui-Song, Daniel Roy T, Racle Julien, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "510154", "url": "https://www.iedb.org/epitope/510154" }, { "database": "IEDB", "id": "542387", "url": "https://www.iedb.org/epitope/542387" }, { "database": "IEDB", "id": "542966", "url": "https://www.iedb.org/epitope/542966" }, { "database": "IEDB", "id": "545816", "url": "https://www.iedb.org/epitope/545816" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "618512", "url": "https://www.iedb.org/epitope/618512" }, { "database": "IEDB", "id": "625366", "url": "https://www.iedb.org/epitope/625366" }, { "database": "IEDB", "id": "735355", "url": "https://www.iedb.org/epitope/735355" }, { "database": "IEDB", "id": "875294", "url": "https://www.iedb.org/epitope/875294" }, { "database": "IEDB", "id": "875319", "url": "https://www.iedb.org/epitope/875319" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "876673", "url": "https://www.iedb.org/epitope/876673" }, { "database": "IEDB", "id": "876938", "url": "https://www.iedb.org/epitope/876938" }, { "database": "IEDB", "id": "877760", "url": "https://www.iedb.org/epitope/877760" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "878544", "url": "https://www.iedb.org/epitope/878544" }, { "database": "IEDB", "id": "878666", "url": "https://www.iedb.org/epitope/878666" }, { "database": "IEDB", "id": "878800", "url": "https://www.iedb.org/epitope/878800" }, { "database": "IEDB", "id": "879062", "url": "https://www.iedb.org/epitope/879062" }, { "database": "IEDB", "id": "879718", "url": "https://www.iedb.org/epitope/879718" }, { "database": "IEDB", "id": "880982", "url": "https://www.iedb.org/epitope/880982" }, { "database": "IEDB", "id": "883496", "url": "https://www.iedb.org/epitope/883496" }, { "database": "IEDB", "id": "883750", "url": "https://www.iedb.org/epitope/883750" }, { "database": "IEDB", "id": "883859", "url": "https://www.iedb.org/epitope/883859" }, { "database": "IEDB", "id": "883876", "url": "https://www.iedb.org/epitope/883876" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" } ], "reference": [ { "type": "PubMed", "id": "30429286", "url": "https://glygen.org/publication/PubMed/30429286" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "A HS6ST2 gene variant associated with X-linked intellectual disability and severe myopia in two male twins.", "journal": "Clinical genetics", "date": "2019", "authors": "Paganini L, Hadi LA, Chetta M, Rovina D, Fontana L, Colapietro P, Bonaparte E, Pezzani L, Marchisio P, Tabano SM, Costanza J, Sirchia SM, Riboni L, Milani D, Miozzo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "30471091", "url": "https://glygen.org/publication/PubMed/30471091" } ] }, { "title": "Cofactor proteins in the assembly and expression of blood clotting enzyme complexes.", "journal": "Annual review of biochemistry", "date": "1988", "authors": "Mann KG, Jenny RJ, Krishnaswamy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "3052293", "url": "https://glygen.org/publication/PubMed/3052293" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Dengue virus requires apoptosis linked gene-2-interacting protein X (ALIX) for viral propagation.", "journal": "Virus research", "date": "2019", "authors": "Thepparit C, Khongwichit S, Ketsuwan K, Libsittikul S, Auewarakul P, Smith DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "30599162", "url": "https://glygen.org/publication/PubMed/30599162" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Protein Z-dependent protease inhibitor (ZPI) is a physiologically significant inhibitor of prothrombinase function.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Huang X, Swanson R, Kroh HK, Bock PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "30918026", "url": "https://glygen.org/publication/PubMed/30918026" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Allostery in Coagulation Factor VIIa Revealed by Ensemble Refinement of Crystallographic Structures.", "journal": "Biophysical journal", "date": "2019", "authors": "Sorensen AB, Madsen JJ, Frimurer TM, Overgaard MT, Gandhi PS, Persson E, Olsen OH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "31003762", "url": "https://glygen.org/publication/PubMed/31003762" } ] }, { "title": "Identification of Immunodominant HIV-1 Epitopes Presented by HLA-C*12:02, a Protective Allele, Using an Immunopeptidomics Approach.", "journal": "Journal of virology", "date": "2019-09-01", "authors": "Chikata Takayuki, Paes Wayne, Akahoshi Tomohiro, Partridge Thomas, Murakoshi Hayato, Gatanaga Hiroyuki, Ternette Nicola, Oka Shinichi, Borrow Persephone, Takiguchi Masafumi", "evidence": [ { "database": "IEDB", "id": "504175", "url": "https://www.iedb.org/epitope/504175" }, { "database": "IEDB", "id": "642717", "url": "https://www.iedb.org/epitope/642717" }, { "database": "IEDB", "id": "931317", "url": "https://www.iedb.org/epitope/931317" } ], "reference": [ { "type": "PubMed", "id": "31217245", "url": "https://glygen.org/publication/PubMed/31217245" } ] }, { "title": "Acid sphingomyelinase plays a critical role in LPS- and cytokine-induced tissue factor procoagulant activity.", "journal": "Blood", "date": "2019", "authors": "Wang J, Pendurthi UR, Rao LVM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "31262782", "url": "https://glygen.org/publication/PubMed/31262782" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "Crystal structure and substrate-induced activation of ADAMTS13.", "journal": "Nature communications", "date": "2019-08-22", "authors": "Petri Anastasis, Kim Hyo Jung, Xu Yaoxian, de Groot Rens, Li Chan, Vandenbulcke Aline, Vanhoorelbeke Karen, Emsley Jonas, Crawley James T B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "31439947", "url": "https://glygen.org/publication/PubMed/31439947" } ] }, { "title": "Predicting HLA class II antigen presentation through integrated deep learning.", "journal": "Nature biotechnology", "date": "2019-11", "authors": "Chen Binbin, Khodadoust Michael S, Olsson Niclas, Wagar Lisa E, Fast Ethan, Liu Chih Long, Muftuoglu Yagmur, Sworder Brian J, Diehn Maximilian, Levy Ronald, Davis Mark M, Elias Joshua E, Altman Russ B, Alizadeh Ash A", "evidence": [ { "database": "IEDB", "id": "994027", "url": "https://www.iedb.org/epitope/994027" }, { "database": "IEDB", "id": "994028", "url": "https://www.iedb.org/epitope/994028" }, { "database": "IEDB", "id": "994029", "url": "https://www.iedb.org/epitope/994029" }, { "database": "IEDB", "id": "994879", "url": "https://www.iedb.org/epitope/994879" }, { "database": "IEDB", "id": "996452", "url": "https://www.iedb.org/epitope/996452" } ], "reference": [ { "type": "PubMed", "id": "31611695", "url": "https://glygen.org/publication/PubMed/31611695" } ] }, { "title": "Suppression of micro1 subunit of the adaptor protein complex 2 reduces dengue virus release.", "journal": "Virus genes", "date": "2020", "authors": "Tongmuang N, Yasamut U, Noisakran S, Sreekanth GP, Yenchitsomanus PT, Limjindaporn T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "31720911", "url": "https://glygen.org/publication/PubMed/31720911" } ] }, { "title": "A large peptidome dataset improves HLA class I epitope prediction across most of the human population.", "journal": "Nature biotechnology", "date": "2020-02", "authors": "Sarkizova Siranush, Klaeger Susan, Le Phuong M, Li Letitia W, Oliveira Giacomo, Keshishian Hasmik, Hartigan Christina R, Zhang Wandi, Braun David A, Ligon Keith L, Bachireddy Pavan, Zervantonakis Ioannis K, Rosenbluth Jennifer M, Ouspenskaia Tamara, Law Travis, Justesen Sune, Stevens Jonathan, Lane William J, Eisenhaure Thomas, Lan Zhang Guang, Clauser Karl R, Hacohen Nir, Carr Steven A, Wu Catherine J, Keskin Derin B", "evidence": [ { "database": "IEDB", "id": "540859", "url": "https://www.iedb.org/epitope/540859" }, { "database": "IEDB", "id": "542387", "url": "https://www.iedb.org/epitope/542387" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "618512", "url": "https://www.iedb.org/epitope/618512" }, { "database": "IEDB", "id": "735355", "url": "https://www.iedb.org/epitope/735355" }, { "database": "IEDB", "id": "936854", "url": "https://www.iedb.org/epitope/936854" }, { "database": "IEDB", "id": "1017538", "url": "https://www.iedb.org/epitope/1017538" }, { "database": "IEDB", "id": "1050029", "url": "https://www.iedb.org/epitope/1050029" }, { "database": "IEDB", "id": "1056331", "url": "https://www.iedb.org/epitope/1056331" }, { "database": "IEDB", "id": "1058334", "url": "https://www.iedb.org/epitope/1058334" }, { "database": "IEDB", "id": "1059059", "url": "https://www.iedb.org/epitope/1059059" } ], "reference": [ { "type": "PubMed", "id": "31844290", "url": "https://glygen.org/publication/PubMed/31844290" } ] }, { "title": "Angiotensin-converting enzyme 2 (ACE2) as a SARS-CoV-2 receptor: molecular mechanisms and potential therapeutic target.", "journal": "Intensive care medicine", "date": "2020", "authors": "Zhang H, Penninger JM, Li Y, Zhong N, Slutsky AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32125455", "url": "https://glygen.org/publication/PubMed/32125455" } ] }, { "title": "SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor.", "journal": "Cell", "date": "2020", "authors": "Hoffmann M, Kleine-Weber H, Schroeder S, Kruger N, Herrler T, Erichsen S, Schiergens TS, Herrler G, Wu NH, Nitsche A, Muller MA, Drosten C, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32142651", "url": "https://glygen.org/publication/PubMed/32142651" } ] }, { "title": "Integrated proteogenomic deep sequencing and analytics accurately identify non-canonical peptides in tumor immunopeptidomes.", "journal": "Nature communications", "date": "2020-03-10", "authors": "Chong Chloe, M\u00fcller Markus, Pak HuiSong, Harnett Dermot, Huber Florian, Grun Delphine, Leleu Marion, Auger Aymeric, Arnaud Marion, Stevenson Brian J, Michaux Justine, Bilic Ilija, Hirsekorn Antje, Calviello Lorenzo, Sim\u00f3-Riudalbas Laia, Planet Evarist, Lubi\u0144ski Jan, Bry\u015bkiewicz Marta, Wiznerowicz Maciej, Xenarios Ioannis, Zhang Lin, Trono Didier, Harari Alexandre, Ohler Uwe, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "485466", "url": "https://www.iedb.org/epitope/485466" }, { "database": "IEDB", "id": "487139", "url": "https://www.iedb.org/epitope/487139" }, { "database": "IEDB", "id": "540859", "url": "https://www.iedb.org/epitope/540859" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "625366", "url": "https://www.iedb.org/epitope/625366" }, { "database": "IEDB", "id": "735355", "url": "https://www.iedb.org/epitope/735355" }, { "database": "IEDB", "id": "777855", "url": "https://www.iedb.org/epitope/777855" }, { "database": "IEDB", "id": "875294", "url": "https://www.iedb.org/epitope/875294" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "877760", "url": "https://www.iedb.org/epitope/877760" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "878800", "url": "https://www.iedb.org/epitope/878800" }, { "database": "IEDB", "id": "883496", "url": "https://www.iedb.org/epitope/883496" }, { "database": "IEDB", "id": "883876", "url": "https://www.iedb.org/epitope/883876" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" }, { "database": "IEDB", "id": "917183", "url": "https://www.iedb.org/epitope/917183" }, { "database": "IEDB", "id": "989171", "url": "https://www.iedb.org/epitope/989171" }, { "database": "IEDB", "id": "991658", "url": "https://www.iedb.org/epitope/991658" }, { "database": "IEDB", "id": "1086078", "url": "https://www.iedb.org/epitope/1086078" }, { "database": "IEDB", "id": "1092322", "url": "https://www.iedb.org/epitope/1092322" }, { "database": "IEDB", "id": "1100481", "url": "https://www.iedb.org/epitope/1100481" }, { "database": "IEDB", "id": "1100482", "url": "https://www.iedb.org/epitope/1100482" }, { "database": "IEDB", "id": "2065470", "url": "https://www.iedb.org/epitope/2065470" }, { "database": "IEDB", "id": "2066064", "url": "https://www.iedb.org/epitope/2066064" }, { "database": "IEDB", "id": "2069806", "url": "https://www.iedb.org/epitope/2069806" }, { "database": "IEDB", "id": "2071874", "url": "https://www.iedb.org/epitope/2071874" } ], "reference": [ { "type": "PubMed", "id": "32157095", "url": "https://glygen.org/publication/PubMed/32157095" } ] }, { "title": "Teicoplanin: an alternative drug for the treatment of COVID-19?", "journal": "International journal of antimicrobial agents", "date": "2020", "authors": "Baron SA, Devaux C, Colson P, Raoult D, Rolain JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32179150", "url": "https://glygen.org/publication/PubMed/32179150" } ] }, { "title": "An affinity chromatography and glycoproteomics workflow to profile the chondroitin sulfate proteoglycans that interact with malarial VAR2CSA in the placenta and in cancer.", "journal": "Glycobiology", "date": "2020-12-09", "authors": "Toledo Alejandro G\u00f3mez, Pihl Jessica, Spliid Charlotte B, Persson Andrea, Nilsson Jonas, Pereira Marina Ayres, Gustavsson Tobias, Choudhary Swati, Oo Htoo Zarni, Black Peter C, Daugaard Mads, Esko Jeffrey D, Larson G\u00f6ran, Salanti Ali, Clausen Thomas Mandel", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "32337544", "url": "https://glygen.org/publication/PubMed/32337544" } ] }, { "title": "Immunopeptidome Analysis of HLA-DPB1 Allelic Variants Reveals New Functional Hierarchies.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2020-06-15", "authors": "van Balen Peter, Kester Michel G D, de Klerk Wendy, Crivello Pietro, Arrieta-Bola\u00f1os Esteban, de Ru Arnoud H, Jedema Inge, Mohammed Yassene, Heemskerk Mirjam H M, Fleischhauer Katharina, van Veelen Peter A, Falkenburg J H Frederik", "evidence": [ { "database": "IEDB", "id": "1129073", "url": "https://www.iedb.org/epitope/1129073" }, { "database": "IEDB", "id": "1140903", "url": "https://www.iedb.org/epitope/1140903" }, { "database": "IEDB", "id": "1141962", "url": "https://www.iedb.org/epitope/1141962" }, { "database": "IEDB", "id": "1142036", "url": "https://www.iedb.org/epitope/1142036" }, { "database": "IEDB", "id": "1142037", "url": "https://www.iedb.org/epitope/1142037" }, { "database": "IEDB", "id": "1142879", "url": "https://www.iedb.org/epitope/1142879" }, { "database": "IEDB", "id": "1142889", "url": "https://www.iedb.org/epitope/1142889" }, { "database": "IEDB", "id": "1142988", "url": "https://www.iedb.org/epitope/1142988" }, { "database": "IEDB", "id": "1142989", "url": "https://www.iedb.org/epitope/1142989" }, { "database": "IEDB", "id": "1143645", "url": "https://www.iedb.org/epitope/1143645" }, { "database": "IEDB", "id": "1144668", "url": "https://www.iedb.org/epitope/1144668" }, { "database": "IEDB", "id": "1144821", "url": "https://www.iedb.org/epitope/1144821" }, { "database": "IEDB", "id": "1146074", "url": "https://www.iedb.org/epitope/1146074" }, { "database": "IEDB", "id": "1156450", "url": "https://www.iedb.org/epitope/1156450" }, { "database": "IEDB", "id": "1156512", "url": "https://www.iedb.org/epitope/1156512" }, { "database": "IEDB", "id": "1157756", "url": "https://www.iedb.org/epitope/1157756" }, { "database": "IEDB", "id": "1157792", "url": "https://www.iedb.org/epitope/1157792" }, { "database": "IEDB", "id": "1158467", "url": "https://www.iedb.org/epitope/1158467" }, { "database": "IEDB", "id": "1160518", "url": "https://www.iedb.org/epitope/1160518" }, { "database": "IEDB", "id": "1160519", "url": "https://www.iedb.org/epitope/1160519" }, { "database": "IEDB", "id": "1164001", "url": "https://www.iedb.org/epitope/1164001" }, { "database": "IEDB", "id": "1164277", "url": "https://www.iedb.org/epitope/1164277" }, { "database": "IEDB", "id": "1164326", "url": "https://www.iedb.org/epitope/1164326" }, { "database": "IEDB", "id": "1164327", "url": "https://www.iedb.org/epitope/1164327" }, { "database": "IEDB", "id": "1165449", "url": "https://www.iedb.org/epitope/1165449" }, { "database": "IEDB", "id": "1165450", "url": "https://www.iedb.org/epitope/1165450" }, { "database": "IEDB", "id": "1165451", "url": "https://www.iedb.org/epitope/1165451" }, { "database": "IEDB", "id": "1169801", "url": "https://www.iedb.org/epitope/1169801" }, { "database": "IEDB", "id": "1170831", "url": "https://www.iedb.org/epitope/1170831" }, { "database": "IEDB", "id": "1171088", "url": "https://www.iedb.org/epitope/1171088" }, { "database": "IEDB", "id": "1171196", "url": "https://www.iedb.org/epitope/1171196" }, { "database": "IEDB", "id": "1171197", "url": "https://www.iedb.org/epitope/1171197" }, { "database": "IEDB", "id": "1171392", "url": "https://www.iedb.org/epitope/1171392" }, { "database": "IEDB", "id": "1174270", "url": "https://www.iedb.org/epitope/1174270" }, { "database": "IEDB", "id": "1174844", "url": "https://www.iedb.org/epitope/1174844" }, { "database": "IEDB", "id": "1175576", "url": "https://www.iedb.org/epitope/1175576" }, { "database": "IEDB", "id": "1178120", "url": "https://www.iedb.org/epitope/1178120" }, { "database": "IEDB", "id": "1178966", "url": "https://www.iedb.org/epitope/1178966" }, { "database": "IEDB", "id": "1179833", "url": "https://www.iedb.org/epitope/1179833" }, { "database": "IEDB", "id": "1179835", "url": "https://www.iedb.org/epitope/1179835" }, { "database": "IEDB", "id": "1179836", "url": "https://www.iedb.org/epitope/1179836" }, { "database": "IEDB", "id": "1179837", "url": "https://www.iedb.org/epitope/1179837" }, { "database": "IEDB", "id": "1180003", "url": "https://www.iedb.org/epitope/1180003" }, { "database": "IEDB", "id": "1180005", "url": "https://www.iedb.org/epitope/1180005" }, { "database": "IEDB", "id": "1180006", "url": "https://www.iedb.org/epitope/1180006" }, { "database": "IEDB", "id": "1180605", "url": "https://www.iedb.org/epitope/1180605" }, { "database": "IEDB", "id": "1180606", "url": "https://www.iedb.org/epitope/1180606" }, { "database": "IEDB", "id": "1180607", "url": "https://www.iedb.org/epitope/1180607" }, { "database": "IEDB", "id": "1180921", "url": "https://www.iedb.org/epitope/1180921" } ], "reference": [ { "type": "PubMed", "id": "32350084", "url": "https://glygen.org/publication/PubMed/32350084" } ] }, { "title": "A Multibasic Cleavage Site in the Spike Protein of SARS-CoV-2 Is Essential for Infection of Human Lung Cells.", "journal": "Molecular cell", "date": "2020", "authors": "Hoffmann M, Kleine-Weber H, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32362314", "url": "https://glygen.org/publication/PubMed/32362314" } ] }, { "title": "In-depth mining of the immunopeptidome of an acute myeloid leukemia cell line using complementary ligand enrichment and data acquisition strategies.", "journal": "Molecular immunology", "date": "2020-07", "authors": "Pandey Kirti, Mifsud Nicole A, Lim Kam Sian Terry C C, Ayala Rochelle, Ternette Nicola, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "544870", "url": "https://www.iedb.org/epitope/544870" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "642717", "url": "https://www.iedb.org/epitope/642717" }, { "database": "IEDB", "id": "675882", "url": "https://www.iedb.org/epitope/675882" }, { "database": "IEDB", "id": "774600", "url": "https://www.iedb.org/epitope/774600" }, { "database": "IEDB", "id": "777376", "url": "https://www.iedb.org/epitope/777376" }, { "database": "IEDB", "id": "779023", "url": "https://www.iedb.org/epitope/779023" }, { "database": "IEDB", "id": "815331", "url": "https://www.iedb.org/epitope/815331" }, { "database": "IEDB", "id": "1085355", "url": "https://www.iedb.org/epitope/1085355" }, { "database": "IEDB", "id": "1350639", "url": "https://www.iedb.org/epitope/1350639" }, { "database": "IEDB", "id": "1364927", "url": "https://www.iedb.org/epitope/1364927" }, { "database": "IEDB", "id": "1365588", "url": "https://www.iedb.org/epitope/1365588" } ], "reference": [ { "type": "PubMed", "id": "32387766", "url": "https://glygen.org/publication/PubMed/32387766" } ] }, { "title": "Multiplexed relative and absolute quantitative immunopeptidomics reveals MHC I repertoire alterations induced by CDK4/6 inhibition.", "journal": "Nature communications", "date": "2020-06-02", "authors": "Stopfer Lauren E, Mesfin Joshua M, Joughin Brian A, Lauffenburger Douglas A, White Forest M", "evidence": [ { "database": "IEDB", "id": "485466", "url": "https://www.iedb.org/epitope/485466" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "1084532", "url": "https://www.iedb.org/epitope/1084532" }, { "database": "IEDB", "id": "1085355", "url": "https://www.iedb.org/epitope/1085355" }, { "database": "IEDB", "id": "1086078", "url": "https://www.iedb.org/epitope/1086078" } ], "reference": [ { "type": "PubMed", "id": "32488085", "url": "https://glygen.org/publication/PubMed/32488085" } ] }, { "title": "Proteolytic Cleavage of the SARS-CoV-2 Spike Protein and the Role of the Novel S1/S2 Site.", "journal": "iScience", "date": "2020", "authors": "Jaimes JA, Millet JK, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32512386", "url": "https://glygen.org/publication/PubMed/32512386" } ] }, { "title": "The role of furin cleavage site in SARS-CoV-2 spike protein-mediated membrane fusion in the presence or absence of trypsin.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Xia S, Lan Q, Su S, Wang X, Xu W, Liu Z, Zhu Y, Wang Q, Lu L, Jiang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32532959", "url": "https://glygen.org/publication/PubMed/32532959" } ] }, { "title": "Characterization of heparin and severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) spike glycoprotein binding interactions.", "journal": "Antiviral research", "date": "2020", "authors": "Kim SY, Jin W, Sood A, Montgomery DW, Grant OC, Fuster MM, Fu L, Dordick JS, Woods RJ, Zhang F, Linhardt RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32653452", "url": "https://glygen.org/publication/PubMed/32653452" } ] }, { "title": "TMPRSS2 and furin are both essential for proteolytic activation of SARS-CoV-2 in human airway cells.", "journal": "Life science alliance", "date": "2020", "authors": "Bestle D, Heindl MR, Limburg H, Van Lam van T, Pilgram O, Moulton H, Stein DA, Hardes K, Eickmann M, Dolnik O, Rohde C, Klenk HD, Garten W, Steinmetzer T, Bottcher-Friebertshauser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32703818", "url": "https://glygen.org/publication/PubMed/32703818" } ] }, { "title": "Tissue factor and hemostasis.", "journal": "Blood", "date": "1988", "authors": "Nemerson Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "3275472", "url": "https://glygen.org/publication/PubMed/3275472" } ] }, { "title": "The complete sequence of dystrophin predicts a rod-shaped cytoskeletal protein.", "journal": "Cell", "date": "1988", "authors": "Koenig M, Monaco AP, Kunkel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "3282674", "url": "https://glygen.org/publication/PubMed/3282674" } ] }, { "title": "Solving an MHC allele-specific bias in the reported immunopeptidome.", "journal": "JCI insight", "date": "2020-10-02", "authors": "Klatt Martin G, Mack Kyeara N, Bai Yang, Aretz Zita E H, Nathan Levy I, Mun Sung Soo, Dao Tao, Scheinberg David A", "evidence": [ { "database": "IEDB", "id": "510154", "url": "https://www.iedb.org/epitope/510154" } ], "reference": [ { "type": "PubMed", "id": "32897882", "url": "https://glygen.org/publication/PubMed/32897882" } ] }, { "title": "Spliced Peptides and Cytokine-Driven Changes in the Immunopeptidome of Melanoma.", "journal": "Cancer immunology research", "date": "2020-10", "authors": "Faridi Pouya, Woods Katherine, Ostrouska Simone, Deceneux Cyril, Aranha Ritchlynn, Duscharla Divya, Wong Stephen Q, Chen Weisan, Ramarathinam Sri H, Lim Kam Sian Terry C C, Croft Nathan P, Li Chen, Ayala Rochelle, Cebon Jonathan S, Purcell Anthony W, Schittenhelm Ralf B, Behren Andreas", "evidence": [ { "database": "IEDB", "id": "485466", "url": "https://www.iedb.org/epitope/485466" }, { "database": "IEDB", "id": "504175", "url": "https://www.iedb.org/epitope/504175" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" }, { "database": "IEDB", "id": "1050029", "url": "https://www.iedb.org/epitope/1050029" }, { "database": "IEDB", "id": "1085355", "url": "https://www.iedb.org/epitope/1085355" }, { "database": "IEDB", "id": "1086078", "url": "https://www.iedb.org/epitope/1086078" }, { "database": "IEDB", "id": "1114325", "url": "https://www.iedb.org/epitope/1114325" }, { "database": "IEDB", "id": "1973904", "url": "https://www.iedb.org/epitope/1973904" }, { "database": "IEDB", "id": "1974541", "url": "https://www.iedb.org/epitope/1974541" }, { "database": "IEDB", "id": "1974562", "url": "https://www.iedb.org/epitope/1974562" }, { "database": "IEDB", "id": "1975239", "url": "https://www.iedb.org/epitope/1975239" }, { "database": "IEDB", "id": "1975242", "url": "https://www.iedb.org/epitope/1975242" }, { "database": "IEDB", "id": "1980397", "url": "https://www.iedb.org/epitope/1980397" }, { "database": "IEDB", "id": "1980399", "url": "https://www.iedb.org/epitope/1980399" }, { "database": "IEDB", "id": "1981637", "url": "https://www.iedb.org/epitope/1981637" }, { "database": "IEDB", "id": "1985643", "url": "https://www.iedb.org/epitope/1985643" }, { "database": "IEDB", "id": "1987967", "url": "https://www.iedb.org/epitope/1987967" }, { "database": "IEDB", "id": "1989834", "url": "https://www.iedb.org/epitope/1989834" }, { "database": "IEDB", "id": "1996094", "url": "https://www.iedb.org/epitope/1996094" }, { "database": "IEDB", "id": "1997394", "url": "https://www.iedb.org/epitope/1997394" }, { "database": "IEDB", "id": "1997497", "url": "https://www.iedb.org/epitope/1997497" } ], "reference": [ { "type": "PubMed", "id": "32938616", "url": "https://glygen.org/publication/PubMed/32938616" } ] }, { "title": "SARS-CoV-2 Infection Depends on Cellular Heparan Sulfate and ACE2.", "journal": "Cell", "date": "2020", "authors": "Clausen TM, Sandoval DR, Spliid CB, Pihl J, Perrett HR, Painter CD, Narayanan A, Majowicz SA, Kwong EM, McVicar RN, Thacker BE, Glass CA, Yang Z, Torres JL, Golden GJ, Bartels PL, Porell RN, Garretson AF, Laubach L, Feldman J, Yin X, Pu Y, Hauser BM, Caradonna TM, Kellman BP, Martino C, Gordts PLSM, Chanda SK, Schmidt AG, Godula K, Leibel SL, Jose J, Corbett KD, Ward AB, Carlin AF, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32970989", "url": "https://glygen.org/publication/PubMed/32970989" } ] }, { "title": "Biogenesis of HLA Ligand Presentation in Immune Cells Upon Activation Reveals Changes in Peptide Length Preference.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Marino Fabio, Semilietof Aikaterini, Michaux Justine, Pak Hui-Song, Coukos George, M\u00fcller Markus, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "1123611", "url": "https://www.iedb.org/epitope/1123611" }, { "database": "IEDB", "id": "1301843", "url": "https://www.iedb.org/epitope/1301843" } ], "reference": [ { "type": "PubMed", "id": "32983136", "url": "https://glygen.org/publication/PubMed/32983136" } ] }, { "title": "KIM-1/TIM-1 is a Receptor for SARS-CoV-2 in Lung and Kidney.", "journal": "medRxiv : the preprint server for health sciences", "date": "2022", "authors": "Mori Y, Fink C, Ichimura T, Sako K, Mori M, Lee NN, Aschauer P, Padmanabha Das KM, Hong S, Song M, Padera RF, Weins A, Lee LP, Nasr ML, Dekaban GA, Dikeakos JD, Bonventre JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32995803", "url": "https://glygen.org/publication/PubMed/32995803" } ] }, { "title": "Borrelia burgdorferi-Induced Changes in the Class II Self-Immunopeptidome Displayed on HLA-DR Molecules Expressed by Dendritic Cells.", "journal": "Frontiers in medicine", "date": "2020", "authors": "Gutierrez-Hoffmann Maria G, O'Meally Robert N, Cole Robert N, Tiniakou Eleni, Darrah Erika, Soloski Mark J", "evidence": [ { "database": "IEDB", "id": "1094439", "url": "https://www.iedb.org/epitope/1094439" } ], "reference": [ { "type": "PubMed", "id": "33043033", "url": "https://glygen.org/publication/PubMed/33043033" } ] }, { "title": "Neuropilin-1 facilitates SARS-CoV-2 cell entry and infectivity.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Cantuti-Castelvetri L, Ojha R, Pedro LD, Djannatian M, Franz J, Kuivanen S, van der Meer F, Kallio K, Kaya T, Anastasina M, Smura T, Levanov L, Szirovicza L, Tobi A, Kallio-Kokko H, Osterlund P, Joensuu M, Meunier FA, Butcher SJ, Winkler MS, Mollenhauer B, Helenius A, Gokce O, Teesalu T, Hepojoki J, Vapalahti O, Stadelmann C, Balistreri G, Simons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33082293", "url": "https://glygen.org/publication/PubMed/33082293" } ] }, { "title": "Neuropilin-1 is a host factor for SARS-CoV-2 infection.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Daly JL, Simonetti B, Klein K, Chen KE, Williamson MK, Anton-Plagaro C, Shoemark DK, Simon-Gracia L, Bauer M, Hollandi R, Greber UF, Horvath P, Sessions RB, Helenius A, Hiscox JA, Teesalu T, Matthews DA, Davidson AD, Collins BM, Cullen PJ, Yamauchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33082294", "url": "https://glygen.org/publication/PubMed/33082294" } ] }, { "title": "Bi-allelic Pathogenic Variants in HS2ST1 Cause a Syndrome Characterized by Developmental Delay and Corpus Callosum, Skeletal, and Renal Abnormalities.", "journal": "American journal of human genetics", "date": "2020", "authors": "Schneeberger PE, von Elsner L, Barker EL, Meinecke P, Marquardt I, Alawi M, Steindl K, Joset P, Rauch A, Zwijnenburg PJG, Weiss MM, Merry CLR, Kutsche K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "33159882", "url": "https://glygen.org/publication/PubMed/33159882" } ] }, { "title": "Dengue virus infection impedes megakaryopoiesis in MEG-01 cells where the virus envelope protein interacts with the transcription factor TAL-1.", "journal": "Scientific reports", "date": "2020", "authors": "Banerjee A, Tripathi A, Duggal S, Banerjee A, Vrati S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "33177556", "url": "https://glygen.org/publication/PubMed/33177556" } ] }, { "title": "Heparan sulfate assists SARS-CoV-2 in cell entry and can be targeted by approved drugs in vitro.", "journal": "Cell discovery", "date": "2020", "authors": "Zhang Q, Chen CZ, Swaroop M, Xu M, Wang L, Lee J, Wang AQ, Pradhan M, Hagen N, Chen L, Shen M, Luo Z, Xu X, Xu Y, Huang W, Zheng W, Ye Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33298900", "url": "https://glygen.org/publication/PubMed/33298900" } ] }, { "title": "The Impact of Biomaterial Cell Contact on the Immunopeptidome.", "journal": "Frontiers in bioengineering and biotechnology", "date": "2020", "authors": "Ghosh Michael, Hartmann Hanna, Jakobi Meike, M\u00e4rz L\u00e9o, Bichmann Leon, Freudenmann Lena K, M\u00fchlenbruch Lena, Segan S\u00f6ren, Rammensee Hans-Georg, Schneiderhan-Marra Nicole, Shipp Christopher, Stevanovi\u0107 Stefan, Joos Thomas O", "evidence": [ { "database": "IEDB", "id": "1094439", "url": "https://www.iedb.org/epitope/1094439" } ], "reference": [ { "type": "PubMed", "id": "33392160", "url": "https://glygen.org/publication/PubMed/33392160" } ] }, { "title": "Furin cleavage of SARS-CoV-2 Spike promotes but is not essential for infection and cell-cell fusion.", "journal": "PLoS pathogens", "date": "2021", "authors": "Papa G, Mallery DL, Albecka A, Welch LG, Cattin-Ortola J, Luptak J, Paul D, McMahon HT, Goodfellow IG, Carter A, Munro S, James LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33493182", "url": "https://glygen.org/publication/PubMed/33493182" } ] }, { "title": "Kidney injury molecule-1 is a potential receptor for SARS-CoV-2.", "journal": "Journal of molecular cell biology", "date": "2021", "authors": "Yang C, Zhang Y, Zeng X, Chen H, Chen Y, Yang D, Shen Z, Wang X, Liu X, Xiong M, Chen H, Huang K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33493263", "url": "https://glygen.org/publication/PubMed/33493263" } ] }, { "title": "Loss of furin cleavage site attenuates SARS-CoV-2 pathogenesis.", "journal": "Nature", "date": "2021", "authors": "Johnson BA, Xie X, Bailey AL, Kalveram B, Lokugamage KG, Muruato A, Zou J, Zhang X, Juelich T, Smith JK, Zhang L, Bopp N, Schindewolf C, Vu M, Vanderheiden A, Winkler ES, Swetnam D, Plante JA, Aguilar P, Plante KS, Popov V, Lee B, Weaver SC, Suthar MS, Routh AL, Ren P, Ku Z, An Z, Debbink K, Diamond MS, Shi PY, Freiberg AN, Menachery VD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33494095", "url": "https://glygen.org/publication/PubMed/33494095" } ] }, { "title": "SARS-CoV-2 S protein:ACE2 interaction reveals novel allosteric targets.", "journal": "eLife", "date": "2021", "authors": "Raghuvamsi PV, Tulsian NK, Samsudin F, Qian X, Purushotorman K, Yue G, Kozma MM, Hwa WY, Lescar J, Bond PJ, MacAry PA, Anand GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33554856", "url": "https://glygen.org/publication/PubMed/33554856" } ] }, { "title": "CIITA-Transduced Glioblastoma Cells Uncover a Rich Repertoire of Clinically Relevant Tumor-Associated HLA-II Antigens.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Forlani Greta, Michaux Justine, Pak HuiSong, Huber Florian, Marie Joseph Elodie Lauret, Ramia Elise, Stevenson Brian J, Linnebacher Michael, Accolla Roberto S, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "144321", "url": "https://www.iedb.org/epitope/144321" }, { "database": "IEDB", "id": "545656", "url": "https://www.iedb.org/epitope/545656" }, { "database": "IEDB", "id": "545816", "url": "https://www.iedb.org/epitope/545816" }, { "database": "IEDB", "id": "545817", "url": "https://www.iedb.org/epitope/545817" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "591987", "url": "https://www.iedb.org/epitope/591987" }, { "database": "IEDB", "id": "592225", "url": "https://www.iedb.org/epitope/592225" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" }, { "database": "IEDB", "id": "941478", "url": "https://www.iedb.org/epitope/941478" }, { "database": "IEDB", "id": "1050029", "url": "https://www.iedb.org/epitope/1050029" }, { "database": "IEDB", "id": "1086078", "url": "https://www.iedb.org/epitope/1086078" }, { "database": "IEDB", "id": "1100483", "url": "https://www.iedb.org/epitope/1100483" }, { "database": "IEDB", "id": "1109387", "url": "https://www.iedb.org/epitope/1109387" }, { "database": "IEDB", "id": "1119210", "url": "https://www.iedb.org/epitope/1119210" }, { "database": "IEDB", "id": "1120470", "url": "https://www.iedb.org/epitope/1120470" }, { "database": "IEDB", "id": "1142036", "url": "https://www.iedb.org/epitope/1142036" }, { "database": "IEDB", "id": "1142037", "url": "https://www.iedb.org/epitope/1142037" }, { "database": "IEDB", "id": "1185180", "url": "https://www.iedb.org/epitope/1185180" }, { "database": "IEDB", "id": "1185181", "url": "https://www.iedb.org/epitope/1185181" }, { "database": "IEDB", "id": "1195129", "url": "https://www.iedb.org/epitope/1195129" }, { "database": "IEDB", "id": "1218535", "url": "https://www.iedb.org/epitope/1218535" }, { "database": "IEDB", "id": "1224884", "url": "https://www.iedb.org/epitope/1224884" }, { "database": "IEDB", "id": "1226664", "url": "https://www.iedb.org/epitope/1226664" }, { "database": "IEDB", "id": "1276062", "url": "https://www.iedb.org/epitope/1276062" }, { "database": "IEDB", "id": "1297974", "url": "https://www.iedb.org/epitope/1297974" }, { "database": "IEDB", "id": "1598474", "url": "https://www.iedb.org/epitope/1598474" }, { "database": "IEDB", "id": "1598497", "url": "https://www.iedb.org/epitope/1598497" }, { "database": "IEDB", "id": "1599225", "url": "https://www.iedb.org/epitope/1599225" }, { "database": "IEDB", "id": "1600004", "url": "https://www.iedb.org/epitope/1600004" }, { "database": "IEDB", "id": "1606434", "url": "https://www.iedb.org/epitope/1606434" }, { "database": "IEDB", "id": "1606722", "url": "https://www.iedb.org/epitope/1606722" }, { "database": "IEDB", "id": "1613669", "url": "https://www.iedb.org/epitope/1613669" }, { "database": "IEDB", "id": "1616097", "url": "https://www.iedb.org/epitope/1616097" }, { "database": "IEDB", "id": "1623493", "url": "https://www.iedb.org/epitope/1623493" } ], "reference": [ { "type": "PubMed", "id": "33592498", "url": "https://glygen.org/publication/PubMed/33592498" } ] }, { "title": "Cathepsin L plays a key role in SARS-CoV-2 infection in humans and humanized mice and is a promising target for new drug development.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao MM, Yang WL, Yang FY, Zhang L, Huang WJ, Hou W, Fan CF, Jin RH, Feng YM, Wang YC, Yang JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33774649", "url": "https://glygen.org/publication/PubMed/33774649" } ] }, { "title": "Carbamazepine Induces Focused T Cell Responses in Resolved Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis Cases But Does Not Perturb the Immunopeptidome for T Cell Recognition.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Mifsud Nicole A, Illing Patricia T, Lai Jeffrey W, Fettke Heidi, Hensen Luca, Huang Ziyi, Rossjohn Jamie, Vivian Julian P, Kwan Patrick, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "642717", "url": "https://www.iedb.org/epitope/642717" } ], "reference": [ { "type": "PubMed", "id": "33912179", "url": "https://glygen.org/publication/PubMed/33912179" } ] }, { "title": "IFN\u03b3 Modulates the Immunopeptidome of Triple Negative Breast Cancer Cells by Enhancing and Diversifying Antigen Processing and Presentation.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Goncalves Gabriel, Mullan Kerry A, Duscharla Divya, Ayala Rochelle, Croft Nathan P, Faridi Pouya, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "1017538", "url": "https://www.iedb.org/epitope/1017538" }, { "database": "IEDB", "id": "1050029", "url": "https://www.iedb.org/epitope/1050029" }, { "database": "IEDB", "id": "1100482", "url": "https://www.iedb.org/epitope/1100482" }, { "database": "IEDB", "id": "1114325", "url": "https://www.iedb.org/epitope/1114325" }, { "database": "IEDB", "id": "1892843", "url": "https://www.iedb.org/epitope/1892843" } ], "reference": [ { "type": "PubMed", "id": "33968037", "url": "https://glygen.org/publication/PubMed/33968037" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P98160", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Glycosylation is a key in SARS-CoV-2 infection.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2021", "authors": "Reis CA, Tauber R, Blanchard V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34023935", "url": "https://glygen.org/publication/PubMed/34023935" } ] }, { "title": "TMPRSS2 expression dictates the entry route used by SARS-CoV-2 to infect host cells.", "journal": "The EMBO journal", "date": "2021", "authors": "Koch J, Uckeley ZM, Doldan P, Stanifer M, Boulant S, Lozach PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34159616", "url": "https://glygen.org/publication/PubMed/34159616" } ] }, { "title": "Heparan Sulfate Facilitates Spike Protein-Mediated SARS-CoV-2 Host Cell Invasion and Contributes to Increased Infection of SARS-CoV-2 G614 Mutant and in Lung Cancer.", "journal": "Frontiers in molecular biosciences", "date": "2021", "authors": "Yue J, Jin W, Yang H, Faulkner J, Song X, Qiu H, Teng M, Azadi P, Zhang F, Linhardt RJ, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34179075", "url": "https://glygen.org/publication/PubMed/34179075" } ] }, { "title": "Heparan Sulfate Proteoglycans as Attachment Factor for SARS-CoV-2.", "journal": "ACS central science", "date": "2021", "authors": "Liu L, Chopra P, Li X, Bouwman KM, Tompkins SM, Wolfert MA, de Vries RP, Boons GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34235261", "url": "https://glygen.org/publication/PubMed/34235261" } ] }, { "title": "Glycosylation of SARS-CoV-2: structural and functional insights.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Shajahan A, Pepi LE, Rouhani DS, Heiss C, Azadi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34235568", "url": "https://glygen.org/publication/PubMed/34235568" } ] }, { "title": "SARS-CoV-2 pseudovirus infectivity and expression of viral entry-related factors ACE2, TMPRSS2, Kim-1, and NRP-1 in human cells from the respiratory, urinary, digestive, reproductive, and immune systems.", "journal": "Journal of medical virology", "date": "2021", "authors": "Zhang F, Li W, Feng J, Ramos da Silva S, Ju E, Zhang H, Chang Y, Moore PS, Guo H, Gao SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34324210", "url": "https://glygen.org/publication/PubMed/34324210" } ] }, { "title": "GRIK2 is a target for bladder cancer stem-like cell-targeting immunotherapy.", "journal": "Cancer immunology, immunotherapy : CII", "date": "2022-04", "authors": "Miyata Haruka, Hirohashi Yoshihiko, Yamada Shuhei, Yanagawa Junko, Murai Aiko, Hashimoto Shinichi, Tokita Serina, Hori Kanta, Abe Takashige, Kubo Terufumi, Tsukahara Tomohide, Kanaseki Takayuki, Shinohara Nobuo, Torigoe Toshihiko", "evidence": [ { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" } ], "reference": [ { "type": "PubMed", "id": "34405274", "url": "https://glygen.org/publication/PubMed/34405274" } ] }, { "title": "Genome-wide CRISPR activation screen identifies candidate receptors for SARS-CoV-2 entry.", "journal": "Science China. Life sciences", "date": "2022", "authors": "Zhu S, Liu Y, Zhou Z, Zhang Z, Xiao X, Liu Z, Chen A, Dong X, Tian F, Chen S, Xu Y, Wang C, Li Q, Niu X, Pan Q, Du S, Xiao J, Wang J, Wei W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34431042", "url": "https://glygen.org/publication/PubMed/34431042" } ] }, { "title": "Immunopeptidogenomics: Harnessing RNA-Seq to Illuminate the Dark Immunopeptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Scull Katherine E, Pandey Kirti, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "1350639", "url": "https://www.iedb.org/epitope/1350639" }, { "database": "IEDB", "id": "1854870", "url": "https://www.iedb.org/epitope/1854870" } ], "reference": [ { "type": "PubMed", "id": "34509645", "url": "https://glygen.org/publication/PubMed/34509645" } ] }, { "title": "Infection and transmission of SARS-CoV-2 depend on heparan sulfate proteoglycans.", "journal": "The EMBO journal", "date": "2021", "authors": "Bermejo-Jambrina M, Eder J, Kaptein TM, van Hamme JL, Helgers LC, Vlaming KE, Brouwer PJM, van Nuenen AC, Spaargaren M, de Bree GJ, Nijmeijer BM, Kootstra NA, van Gils MJ, Sanders RW, Geijtenbeek TBH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34510494", "url": "https://glygen.org/publication/PubMed/34510494" } ] }, { "title": "SARS-CoV-2 S glycoprotein binding to multiple host receptors enables cell entry and infection.", "journal": "Glycoconjugate journal", "date": "2021", "authors": "Trbojevic-Akmacic I, Petrovic T, Lauc G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34542788", "url": "https://glygen.org/publication/PubMed/34542788" } ] }, { "title": "Proteolytic activation of SARS-CoV-2 spike protein.", "journal": "Microbiology and immunology", "date": "2022", "authors": "Takeda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34561887", "url": "https://glygen.org/publication/PubMed/34561887" } ] }, { "title": "Characterization of HLA-A*33:03 epitopes via immunoprecipitation and LC-MS/MS.", "journal": "Proteomics", "date": "2022", "authors": "Khan A, Shin JY, So MK, Na JH, Justesen S, Ansari AA, Ko BJ, Ahn SM", "evidence": [ { "database": "IEDB", "id": "1715980", "url": "https://www.iedb.org/epitope/1715980" } ], "reference": [ { "type": "PubMed", "id": "34561969", "url": "https://glygen.org/publication/PubMed/34561969" } ] }, { "title": "Mechanisms of SARS-CoV-2 entry into cells.", "journal": "Nature reviews. Molecular cell biology", "date": "2022", "authors": "Jackson CB, Farzan M, Chen B, Choe H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34611326", "url": "https://glygen.org/publication/PubMed/34611326" } ] }, { "title": "Furin cleavage of the SARS-CoV-2 spike is modulated by O-glycosylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang L, Mann M, Syed ZA, Reynolds HM, Tian E, Samara NL, Zeldin DC, Tabak LA, Ten Hagen KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34732583", "url": "https://glygen.org/publication/PubMed/34732583" } ] }, { "title": "The glycosylation in SARS-CoV-2 and its receptor ACE2.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Gong Y, Qin S, Dai L, Tian Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34782609", "url": "https://glygen.org/publication/PubMed/34782609" } ] }, { "title": "The binding of heparin to spike glycoprotein inhibits SARS-CoV-2 infection by three mechanisms.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Paiardi G, Richter S, Oreste P, Urbinati C, Rusnati M, Wade RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34929169", "url": "https://glygen.org/publication/PubMed/34929169" } ] }, { "title": "Immunopeptidomic analysis of influenza A virus infected human tissues identifies internal proteins as a rich source of HLA ligands.", "journal": "PLoS pathogens", "date": "2022-01", "authors": "Nicholas Ben, Bailey Alistair, Staples Karl J, Wilkinson Tom, Elliott Tim, Skipp Paul", "evidence": [ { "database": "IEDB", "id": "144302", "url": "https://www.iedb.org/epitope/144302" }, { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "542387", "url": "https://www.iedb.org/epitope/542387" }, { "database": "IEDB", "id": "544913", "url": "https://www.iedb.org/epitope/544913" }, { "database": "IEDB", "id": "545656", "url": "https://www.iedb.org/epitope/545656" }, { "database": "IEDB", "id": "545816", "url": "https://www.iedb.org/epitope/545816" }, { "database": "IEDB", "id": "545817", "url": "https://www.iedb.org/epitope/545817" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "591986", "url": "https://www.iedb.org/epitope/591986" }, { "database": "IEDB", "id": "591987", "url": "https://www.iedb.org/epitope/591987" }, { "database": "IEDB", "id": "592225", "url": "https://www.iedb.org/epitope/592225" }, { "database": "IEDB", "id": "593022", "url": "https://www.iedb.org/epitope/593022" }, { "database": "IEDB", "id": "642717", "url": "https://www.iedb.org/epitope/642717" }, { "database": "IEDB", "id": "770774", "url": "https://www.iedb.org/epitope/770774" }, { "database": "IEDB", "id": "875294", "url": "https://www.iedb.org/epitope/875294" }, { "database": "IEDB", "id": "876184", "url": "https://www.iedb.org/epitope/876184" }, { "database": "IEDB", "id": "876938", "url": "https://www.iedb.org/epitope/876938" }, { "database": "IEDB", "id": "877760", "url": "https://www.iedb.org/epitope/877760" }, { "database": "IEDB", "id": "917183", "url": "https://www.iedb.org/epitope/917183" }, { "database": "IEDB", "id": "1085355", "url": "https://www.iedb.org/epitope/1085355" }, { "database": "IEDB", "id": "1092322", "url": "https://www.iedb.org/epitope/1092322" }, { "database": "IEDB", "id": "1099653", "url": "https://www.iedb.org/epitope/1099653" }, { "database": "IEDB", "id": "1100482", "url": "https://www.iedb.org/epitope/1100482" }, { "database": "IEDB", "id": "1100483", "url": "https://www.iedb.org/epitope/1100483" }, { "database": "IEDB", "id": "1109387", "url": "https://www.iedb.org/epitope/1109387" }, { "database": "IEDB", "id": "1118304", "url": "https://www.iedb.org/epitope/1118304" }, { "database": "IEDB", "id": "1185180", "url": "https://www.iedb.org/epitope/1185180" }, { "database": "IEDB", "id": "1187780", "url": "https://www.iedb.org/epitope/1187780" }, { "database": "IEDB", "id": "1192934", "url": "https://www.iedb.org/epitope/1192934" }, { "database": "IEDB", "id": "1192946", "url": "https://www.iedb.org/epitope/1192946" }, { "database": "IEDB", "id": "1218535", "url": "https://www.iedb.org/epitope/1218535" }, { "database": "IEDB", "id": "1218536", "url": "https://www.iedb.org/epitope/1218536" }, { "database": "IEDB", "id": "1226664", "url": "https://www.iedb.org/epitope/1226664" }, { "database": "IEDB", "id": "1267123", "url": "https://www.iedb.org/epitope/1267123" }, { "database": "IEDB", "id": "1273595", "url": "https://www.iedb.org/epitope/1273595" }, { "database": "IEDB", "id": "1289080", "url": "https://www.iedb.org/epitope/1289080" }, { "database": "IEDB", "id": "1854870", "url": "https://www.iedb.org/epitope/1854870" }, { "database": "IEDB", "id": "2004756", "url": "https://www.iedb.org/epitope/2004756" }, { "database": "IEDB", "id": "2004785", "url": "https://www.iedb.org/epitope/2004785" }, { "database": "IEDB", "id": "2005651", "url": "https://www.iedb.org/epitope/2005651" }, { "database": "IEDB", "id": "2006732", "url": "https://www.iedb.org/epitope/2006732" }, { "database": "IEDB", "id": "2007226", "url": "https://www.iedb.org/epitope/2007226" }, { "database": "IEDB", "id": "2008196", "url": "https://www.iedb.org/epitope/2008196" }, { "database": "IEDB", "id": "2008478", "url": "https://www.iedb.org/epitope/2008478" }, { "database": "IEDB", "id": "2009148", "url": "https://www.iedb.org/epitope/2009148" }, { "database": "IEDB", "id": "2010175", "url": "https://www.iedb.org/epitope/2010175" }, { "database": "IEDB", "id": "2015204", "url": "https://www.iedb.org/epitope/2015204" }, { "database": "IEDB", "id": "2016998", "url": "https://www.iedb.org/epitope/2016998" }, { "database": "IEDB", "id": "2017666", "url": "https://www.iedb.org/epitope/2017666" }, { "database": "IEDB", "id": "2018245", "url": "https://www.iedb.org/epitope/2018245" }, { "database": "IEDB", "id": "2018643", "url": "https://www.iedb.org/epitope/2018643" }, { "database": "IEDB", "id": "2018889", "url": "https://www.iedb.org/epitope/2018889" }, { "database": "IEDB", "id": "2018958", "url": "https://www.iedb.org/epitope/2018958" }, { "database": "IEDB", "id": "2020157", "url": "https://www.iedb.org/epitope/2020157" }, { "database": "IEDB", "id": "2020716", "url": "https://www.iedb.org/epitope/2020716" }, { "database": "IEDB", "id": "2020882", "url": "https://www.iedb.org/epitope/2020882" }, { "database": "IEDB", "id": "2021595", "url": "https://www.iedb.org/epitope/2021595" }, { "database": "IEDB", "id": "2021982", "url": "https://www.iedb.org/epitope/2021982" }, { "database": "IEDB", "id": "2021995", "url": "https://www.iedb.org/epitope/2021995" }, { "database": "IEDB", "id": "2022565", "url": "https://www.iedb.org/epitope/2022565" }, { "database": "IEDB", "id": "2023297", "url": "https://www.iedb.org/epitope/2023297" }, { "database": "IEDB", "id": "2028353", "url": "https://www.iedb.org/epitope/2028353" }, { "database": "IEDB", "id": "2031260", "url": "https://www.iedb.org/epitope/2031260" }, { "database": "IEDB", "id": "2034665", "url": "https://www.iedb.org/epitope/2034665" }, { "database": "IEDB", "id": "2034987", "url": "https://www.iedb.org/epitope/2034987" }, { "database": "IEDB", "id": "2035128", "url": "https://www.iedb.org/epitope/2035128" }, { "database": "IEDB", "id": "2035281", "url": "https://www.iedb.org/epitope/2035281" }, { "database": "IEDB", "id": "2037983", "url": "https://www.iedb.org/epitope/2037983" }, { "database": "IEDB", "id": "2037984", "url": "https://www.iedb.org/epitope/2037984" }, { "database": "IEDB", "id": "2038937", "url": "https://www.iedb.org/epitope/2038937" }, { "database": "IEDB", "id": "2039679", "url": "https://www.iedb.org/epitope/2039679" }, { "database": "IEDB", "id": "2039706", "url": "https://www.iedb.org/epitope/2039706" }, { "database": "IEDB", "id": "2039965", "url": "https://www.iedb.org/epitope/2039965" }, { "database": "IEDB", "id": "2040077", "url": "https://www.iedb.org/epitope/2040077" }, { "database": "IEDB", "id": "2040651", "url": "https://www.iedb.org/epitope/2040651" }, { "database": "IEDB", "id": "2041476", "url": "https://www.iedb.org/epitope/2041476" }, { "database": "IEDB", "id": "2041573", "url": "https://www.iedb.org/epitope/2041573" }, { "database": "IEDB", "id": "2041574", "url": "https://www.iedb.org/epitope/2041574" }, { "database": "IEDB", "id": "2042406", "url": "https://www.iedb.org/epitope/2042406" }, { "database": "IEDB", "id": "2042441", "url": "https://www.iedb.org/epitope/2042441" }, { "database": "IEDB", "id": "2042541", "url": "https://www.iedb.org/epitope/2042541" }, { "database": "IEDB", "id": "2043281", "url": "https://www.iedb.org/epitope/2043281" }, { "database": "IEDB", "id": "2043632", "url": "https://www.iedb.org/epitope/2043632" }, { "database": "IEDB", "id": "2044705", "url": "https://www.iedb.org/epitope/2044705" }, { "database": "IEDB", "id": "2045778", "url": "https://www.iedb.org/epitope/2045778" }, { "database": "IEDB", "id": "2046310", "url": "https://www.iedb.org/epitope/2046310" }, { "database": "IEDB", "id": "2046631", "url": "https://www.iedb.org/epitope/2046631" }, { "database": "IEDB", "id": "2046864", "url": "https://www.iedb.org/epitope/2046864" }, { "database": "IEDB", "id": "2047786", "url": "https://www.iedb.org/epitope/2047786" }, { "database": "IEDB", "id": "2049149", "url": "https://www.iedb.org/epitope/2049149" }, { "database": "IEDB", "id": "2049255", "url": "https://www.iedb.org/epitope/2049255" }, { "database": "IEDB", "id": "2050286", "url": "https://www.iedb.org/epitope/2050286" }, { "database": "IEDB", "id": "2053922", "url": "https://www.iedb.org/epitope/2053922" }, { "database": "IEDB", "id": "2054204", "url": "https://www.iedb.org/epitope/2054204" }, { "database": "IEDB", "id": "2054275", "url": "https://www.iedb.org/epitope/2054275" }, { "database": "IEDB", "id": "2055448", "url": "https://www.iedb.org/epitope/2055448" }, { "database": "IEDB", "id": "2055632", "url": "https://www.iedb.org/epitope/2055632" }, { "database": "IEDB", "id": "2055637", "url": "https://www.iedb.org/epitope/2055637" }, { "database": "IEDB", "id": "2056446", "url": "https://www.iedb.org/epitope/2056446" }, { "database": "IEDB", "id": "2057432", "url": "https://www.iedb.org/epitope/2057432" }, { "database": "IEDB", "id": "2057838", "url": "https://www.iedb.org/epitope/2057838" }, { "database": "IEDB", "id": "2057936", "url": "https://www.iedb.org/epitope/2057936" }, { "database": "IEDB", "id": "2058113", "url": "https://www.iedb.org/epitope/2058113" }, { "database": "IEDB", "id": "2058709", "url": "https://www.iedb.org/epitope/2058709" }, { "database": "IEDB", "id": "2058767", "url": "https://www.iedb.org/epitope/2058767" }, { "database": "IEDB", "id": "2059179", "url": "https://www.iedb.org/epitope/2059179" }, { "database": "IEDB", "id": "2060307", "url": "https://www.iedb.org/epitope/2060307" }, { "database": "IEDB", "id": "2060527", "url": "https://www.iedb.org/epitope/2060527" } ], "reference": [ { "type": "PubMed", "id": "35051231", "url": "https://glygen.org/publication/PubMed/35051231" } ] }, { "title": "Dengue and Zika Virus Capsid Proteins Contain a Common PEX19-Binding Motif.", "journal": "Viruses", "date": "2022", "authors": "Farelo MA, Korrou-Karava D, Brooks KF, Russell TA, Maringer K, Mayerhofer PU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "35215846", "url": "https://glygen.org/publication/PubMed/35215846" } ] }, { "title": "Promiscuity of Peptides Presented in HLA-DP Molecules from Different Immunogenicity Groups Is Associated With T-Cell Cross-Reactivity.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Laghmouchi Aicha, Kester Michel G D, Hoogstraten Conny, Hageman Lois, de Klerk Wendy, Huisman Wesley, Koster Eva A S, de Ru Arnoud H, van Balen Peter, Klobuch Sebastian, van Veelen Peter A, Falkenburg J H Frederik, Jedema Inge", "evidence": [ { "database": "IEDB", "id": "592363", "url": "https://www.iedb.org/epitope/592363" }, { "database": "IEDB", "id": "1129073", "url": "https://www.iedb.org/epitope/1129073" }, { "database": "IEDB", "id": "1140903", "url": "https://www.iedb.org/epitope/1140903" }, { "database": "IEDB", "id": "1141962", "url": "https://www.iedb.org/epitope/1141962" }, { "database": "IEDB", "id": "1142036", "url": "https://www.iedb.org/epitope/1142036" }, { "database": "IEDB", "id": "1142037", "url": "https://www.iedb.org/epitope/1142037" }, { "database": "IEDB", "id": "1142879", "url": "https://www.iedb.org/epitope/1142879" }, { "database": "IEDB", "id": "1142988", "url": "https://www.iedb.org/epitope/1142988" }, { "database": "IEDB", "id": "1143645", "url": "https://www.iedb.org/epitope/1143645" }, { "database": "IEDB", "id": "1144668", "url": "https://www.iedb.org/epitope/1144668" }, { "database": "IEDB", "id": "1144821", "url": "https://www.iedb.org/epitope/1144821" }, { "database": "IEDB", "id": "1156450", "url": "https://www.iedb.org/epitope/1156450" }, { "database": "IEDB", "id": "1156512", "url": "https://www.iedb.org/epitope/1156512" }, { "database": "IEDB", "id": "1157756", "url": "https://www.iedb.org/epitope/1157756" }, { "database": "IEDB", "id": "1157792", "url": "https://www.iedb.org/epitope/1157792" }, { "database": "IEDB", "id": "1158467", "url": "https://www.iedb.org/epitope/1158467" }, { "database": "IEDB", "id": "1160518", "url": "https://www.iedb.org/epitope/1160518" }, { "database": "IEDB", "id": "1164001", "url": "https://www.iedb.org/epitope/1164001" }, { "database": "IEDB", "id": "1164277", "url": "https://www.iedb.org/epitope/1164277" }, { "database": "IEDB", "id": "1164326", "url": "https://www.iedb.org/epitope/1164326" }, { "database": "IEDB", "id": "1164327", "url": "https://www.iedb.org/epitope/1164327" }, { "database": "IEDB", "id": "1165449", "url": "https://www.iedb.org/epitope/1165449" }, { "database": "IEDB", "id": "1165450", "url": "https://www.iedb.org/epitope/1165450" }, { "database": "IEDB", "id": "1169801", "url": "https://www.iedb.org/epitope/1169801" }, { "database": "IEDB", "id": "1170831", "url": "https://www.iedb.org/epitope/1170831" }, { "database": "IEDB", "id": "1171088", "url": "https://www.iedb.org/epitope/1171088" }, { "database": "IEDB", "id": "1171196", "url": "https://www.iedb.org/epitope/1171196" }, { "database": "IEDB", "id": "1171197", "url": "https://www.iedb.org/epitope/1171197" }, { "database": "IEDB", "id": "1174270", "url": "https://www.iedb.org/epitope/1174270" }, { "database": "IEDB", "id": "1174844", "url": "https://www.iedb.org/epitope/1174844" }, { "database": "IEDB", "id": "1175576", "url": "https://www.iedb.org/epitope/1175576" }, { "database": "IEDB", "id": "1178966", "url": "https://www.iedb.org/epitope/1178966" }, { "database": "IEDB", "id": "1179833", "url": "https://www.iedb.org/epitope/1179833" }, { "database": "IEDB", "id": "1179835", "url": "https://www.iedb.org/epitope/1179835" }, { "database": "IEDB", "id": "1179836", "url": "https://www.iedb.org/epitope/1179836" }, { "database": "IEDB", "id": "1179837", "url": "https://www.iedb.org/epitope/1179837" }, { "database": "IEDB", "id": "1180005", "url": "https://www.iedb.org/epitope/1180005" }, { "database": "IEDB", "id": "1180006", "url": "https://www.iedb.org/epitope/1180006" }, { "database": "IEDB", "id": "1180921", "url": "https://www.iedb.org/epitope/1180921" }, { "database": "IEDB", "id": "2046310", "url": "https://www.iedb.org/epitope/2046310" }, { "database": "IEDB", "id": "2121117", "url": "https://www.iedb.org/epitope/2121117" }, { "database": "IEDB", "id": "2121463", "url": "https://www.iedb.org/epitope/2121463" }, { "database": "IEDB", "id": "2122598", "url": "https://www.iedb.org/epitope/2122598" }, { "database": "IEDB", "id": "2123924", "url": "https://www.iedb.org/epitope/2123924" }, { "database": "IEDB", "id": "2123979", "url": "https://www.iedb.org/epitope/2123979" }, { "database": "IEDB", "id": "2125055", "url": "https://www.iedb.org/epitope/2125055" }, { "database": "IEDB", "id": "2125859", "url": "https://www.iedb.org/epitope/2125859" }, { "database": "IEDB", "id": "2127226", "url": "https://www.iedb.org/epitope/2127226" }, { "database": "IEDB", "id": "2128101", "url": "https://www.iedb.org/epitope/2128101" }, { "database": "IEDB", "id": "2128452", "url": "https://www.iedb.org/epitope/2128452" }, { "database": "IEDB", "id": "2129060", "url": "https://www.iedb.org/epitope/2129060" }, { "database": "IEDB", "id": "2129061", "url": "https://www.iedb.org/epitope/2129061" }, { "database": "IEDB", "id": "2130432", "url": "https://www.iedb.org/epitope/2130432" }, { "database": "IEDB", "id": "2130605", "url": "https://www.iedb.org/epitope/2130605" }, { "database": "IEDB", "id": "2130639", "url": "https://www.iedb.org/epitope/2130639" } ], "reference": [ { "type": "PubMed", "id": "35251023", "url": "https://glygen.org/publication/PubMed/35251023" } ] }, { "title": "Factor VII binding to tissue factor in reconstituted phospholipid vesicles: induction of cooperativity by phosphatidylserine.", "journal": "Biochemistry", "date": "1986", "authors": "Bach R, Gentry R, Nemerson Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "3527261", "url": "https://glygen.org/publication/PubMed/3527261" } ] }, { "title": "Tumour-associated antigenic peptides are present in the HLA class I ligandome of cancer cell line derived extracellular vesicles.", "journal": "Immunology", "date": "2022-06", "authors": "Kumar Pankaj, Boyne Caitlin, Brown Sydney, Qureshi Ayesha, Thorpe Peter, Synowsky Silvia A, Shirran Sally, Powis Simon J", "evidence": [ { "database": "IEDB", "id": "627429", "url": "https://www.iedb.org/epitope/627429" } ], "reference": [ { "type": "PubMed", "id": "35318648", "url": "https://glygen.org/publication/PubMed/35318648" } ] }, { "title": "Distinctive Roles of Furin and TMPRSS2 in SARS-CoV-2 Infectivity.", "journal": "Journal of virology", "date": "2022", "authors": "Essalmani R, Jain J, Susan-Resiga D, Andreo U, Evagelidis A, Derbali RM, Huynh DN, Dallaire F, Laporte M, Delpal A, Sutto-Ortiz P, Coutard B, Mapa C, Wilcoxen K, Decroly E, Nq Pham T, Cohen EA, Seidah NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "35343766", "url": "https://glygen.org/publication/PubMed/35343766" } ] }, { "title": "Soluble HLA peptidome of pleural effusions is a valuable source for tumor antigens.", "journal": "Journal for immunotherapy of cancer", "date": "2022-05", "authors": "Khazan-Kost Sofia, Cafri Gal, Melamed Kadosh Dganit, Mooshayef Navit, Chatterji Sumit, Dominissini Dan, Manor Sigal, Zisser Bracha, Broday Limor, Talalai Efrosiniia, Shemer Anat, Zadok Oranit, Ofek Efrat, Onn Amir, Admon Arie, Peled Michael", "evidence": [ { "database": "IEDB", "id": "487139", "url": "https://www.iedb.org/epitope/487139" }, { "database": "IEDB", "id": "542387", "url": "https://www.iedb.org/epitope/542387" }, { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "616198", "url": "https://www.iedb.org/epitope/616198" }, { "database": "IEDB", "id": "625366", "url": "https://www.iedb.org/epitope/625366" }, { "database": "IEDB", "id": "735355", "url": "https://www.iedb.org/epitope/735355" }, { "database": "IEDB", "id": "876938", "url": "https://www.iedb.org/epitope/876938" }, { "database": "IEDB", "id": "877760", "url": "https://www.iedb.org/epitope/877760" }, { "database": "IEDB", "id": "877818", "url": "https://www.iedb.org/epitope/877818" }, { "database": "IEDB", "id": "883496", "url": "https://www.iedb.org/epitope/883496" }, { "database": "IEDB", "id": "883876", "url": "https://www.iedb.org/epitope/883876" }, { "database": "IEDB", "id": "885127", "url": "https://www.iedb.org/epitope/885127" }, { "database": "IEDB", "id": "933906", "url": "https://www.iedb.org/epitope/933906" }, { "database": "IEDB", "id": "943417", "url": "https://www.iedb.org/epitope/943417" }, { "database": "IEDB", "id": "1120723", "url": "https://www.iedb.org/epitope/1120723" }, { "database": "IEDB", "id": "2254681", "url": "https://www.iedb.org/epitope/2254681" }, { "database": "IEDB", "id": "2264267", "url": "https://www.iedb.org/epitope/2264267" } ], "reference": [ { "type": "PubMed", "id": "35580925", "url": "https://glygen.org/publication/PubMed/35580925" } ] }, { "title": "The structure of EXTL3 helps to explain the different roles of bi-domain exostosins in heparan sulfate synthesis.", "journal": "Nature communications", "date": "2022", "authors": "Wilson LFL, Dendooven T, Hardwick SW, Echevarria-Poza A, Tryfona T, Krogh KBRM, Chirgadze DY, Luisi BF, Logan DT, Mani K, Dupree P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "35676258", "url": "https://glygen.org/publication/PubMed/35676258" } ] }, { "title": "Multi-Omic Analysis of Two Common P53 Mutations: Proteins Regulated by Mutated P53 as Potential Targets for Immunotherapy.", "journal": "Cancers", "date": "2022-08-17", "authors": "Vadakekolathu Jayakumar, Boocock David J, Pandey Kirti, Guinn Barbara-Ann, Legrand Antoine, Miles Amanda K, Coveney Clare, Ayala Rochelle, Purcell Anthony W, McArdle Stephanie E", "evidence": [ { "database": "IEDB", "id": "471545", "url": "https://www.iedb.org/epitope/471545" }, { "database": "IEDB", "id": "487139", "url": "https://www.iedb.org/epitope/487139" }, { "database": "IEDB", "id": "562115", "url": "https://www.iedb.org/epitope/562115" }, { "database": "IEDB", "id": "2139924", "url": "https://www.iedb.org/epitope/2139924" }, { "database": "IEDB", "id": "2143800", "url": "https://www.iedb.org/epitope/2143800" } ], "reference": [ { "type": "PubMed", "id": "36010968", "url": "https://glygen.org/publication/PubMed/36010968" } ] }, { "title": "An Unexpected Encounter: Respiratory Syncytial Virus Nonstructural Protein 1 Interacts with Mediator Subunit MED25.", "journal": "Journal of virology", "date": "2022-10-12", "authors": "Van Royen Tessa, Sedeyn Koen, Moschonas George D, Toussaint Wendy, Vuylsteke Marnik, Van Haver Delphi, Impens Francis, Eyckerman Sven, Lemmens Irma, Tavernier Jan, Schepens Bert, Saelens Xavier", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "36102648", "url": "https://glygen.org/publication/PubMed/36102648" } ] }, { "title": "Mass spectrometric analysis of chondroitin sulfate-linked peptides.", "journal": "Journal of proteins and proteomics", "date": "2022", "authors": "Ramarajan Madan Gopal, Saraswat Mayank, Budhraja Rohit, Garapati Kishore, Raymond Kimiyo, Pandey Akhilesh", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160#ptm_processing" }, { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "36213313", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "title": "Immunopeptidomics-based design of mRNA vaccine formulations against Listeria monocytogenes.", "journal": "Nature communications", "date": "2022-10-14", "authors": "Mayer Rupert L, Verbeke Rein, Asselman Caroline, Aernout Ilke, Gul Adillah, Eggermont Denzel, Boucher Katie, Thery Fabien, Maia Teresa M, Demol Hans, Gabriels Ralf, Martens Lennart, B\u00e9cavin Christophe, De Smedt Stefaan C, Vandekerckhove Bart, Lentacker Ine, Impens Francis", "evidence": [ { "database": "IEDB", "id": "1050029", "url": "https://www.iedb.org/epitope/1050029" }, { "database": "IEDB", "id": "2069806", "url": "https://www.iedb.org/epitope/2069806" } ], "reference": [ { "type": "PubMed", "id": "36241641", "url": "https://glygen.org/publication/PubMed/36241641" } ] }, { "title": "Direct identification of HLA class I and class II-restricted T cell epitopes in pancreatic cancer tissues by mass spectrometry.", "journal": "Journal of hematology & oncology", "date": "2022-10-25", "authors": "Fujiwara Kenji, Shao Yingkuan, Niu Nan, Zhang Tengyi, Herbst Brian, Henderson Mackenzie, Muth Stephen, Zhang Pingbo, Zheng Lei", "evidence": [ { "database": "IEDB", "id": "562492", "url": "https://www.iedb.org/epitope/562492" }, { "database": "IEDB", "id": "616198", "url": "https://www.iedb.org/epitope/616198" }, { "database": "IEDB", "id": "618512", "url": "https://www.iedb.org/epitope/618512" }, { "database": "IEDB", "id": "877760", "url": "https://www.iedb.org/epitope/877760" }, { "database": "IEDB", "id": "878800", "url": "https://www.iedb.org/epitope/878800" }, { "database": "IEDB", "id": "883496", "url": "https://www.iedb.org/epitope/883496" }, { "database": "IEDB", "id": "883750", "url": "https://www.iedb.org/epitope/883750" } ], "reference": [ { "type": "PubMed", "id": "36284347", "url": "https://glygen.org/publication/PubMed/36284347" } ] }, { "title": "Perlecan: Roles in osteoarthritis and potential treating target.", "journal": "Life sciences", "date": "2023-01-01", "authors": "Zhao Xiao-Xuan, Xie Wen-Qing, Xiao Wen-Feng, Li Heng-Zhen, Naranmandakh Shinen, Bruyere Olivier, Reginster Jean-Yves, Li Yu-Sheng", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ], "reference": [ { "type": "PubMed", "id": "36379311", "url": "https://glygen.org/publication/PubMed/36379311" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "TMEM16E regulates endothelial cell procoagulant activity and thrombosis.", "journal": "The Journal of clinical investigation", "date": "2023-03-23", "authors": "Schmaier Alec A, Anderson Papa F, Chen Siyu M, El-Darzi Emale, Aivasovsky Ivan, Kaushik Milan P, Sack Kelsey D, Hartzell H Criss, Parikh Samir M, Flaumenhaft Robert, Schulman Sol", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "36951953", "url": "https://glygen.org/publication/PubMed/36951953" } ] }, { "title": "Integrated glycoproteomic characterization of clear cell renal cell carcinoma.", "journal": "Cell reports", "date": "2023-05-30", "authors": "Lih T Mamie, Cho Kyung-Cho, Schnaubelt Michael, Hu Yingwei, Zhang Hui", "evidence": [ { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "reference": [ { "type": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P98160", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "Heparin and its low molecular weight derivatives: anticoagulant and antithrombotic properties.", "journal": "Haemostasis", "date": "1986", "authors": "Holmer E, Soderberg K, Bergqvist D, Lindahl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "3744129", "url": "https://glygen.org/publication/PubMed/3744129" } ] }, { "title": "Identification of B-cell-related HSPG2 and CDSN as susceptibility loci for Kawasaki disease.", "journal": "Human immunology", "date": "2023-10", "authors": "Kim Jae-Jung, Hong Young Mi, Yun Sin Weon, Lee Kyung-Yil, Yoon Kyung Lim, Han Myung-Ki, Kim Gi Beom, Kil Hong-Ryang, Song Min Seob, Lee Hyoung Doo, Ha Kee Soo, Jun Hyun Ok, Yu Jeong Jin, Jang Gi Young, Lee Jong-Keuk,", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ], "reference": [ { "type": "PubMed", "id": "37453912", "url": "https://glygen.org/publication/PubMed/37453912" } ] }, { "title": "Coagulation factor VIII regulates von Willebrand factor homeostasis invivo.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2023-12", "authors": "Cao Wenjing, Trask Aria R, Bignotti Antonia I, George Lindsey A, Doshi Bhavya S, Sabatino Denise E, Yada Noritaka, Zheng Liang, Camire Rodney M, Zheng X Long", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "37726033", "url": "https://glygen.org/publication/PubMed/37726033" } ] }, { "title": "The role of proteolytic cleavage at Arg336 and Arg372 of the A1 domain in factor VIIa/tissue factor-catalyzed reactions of B domain-deleted factor VIII.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2024-01", "authors": "Nakajima Yuto, Nogami Keiji", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "37925034", "url": "https://glygen.org/publication/PubMed/37925034" } ] }, { "title": "Targeting of intracellular oncoproteins with peptide-centric CARs.", "journal": "Nature", "date": "2023-11", "authors": "Yarmarkovich Mark, Marshall Quinlen F, Warrington John M, Premaratne Rasika, Farrel Alvin, Groff David, Li Wei, di Marco Moreno, Runbeck Erin, Truong Hau, Toor Jugmohit S, Tripathi Sarvind, Nguyen Son, Shen Helena, Noel Tiffany, Church Nicole L, Weiner Amber, Kendsersky Nathan, Martinez Dan, Weisberg Rebecca, Christie Molly, Eisenlohr Laurence, Bosse Kristopher R, Dimitrov Dimiter S, Stevanovic Stefan, Sgourakis Nikolaos G, Kiefel Ben R, Maris John M", "evidence": [ { "database": "IEDB", "id": "541393", "url": "https://www.iedb.org/epitope/541393" }, { "database": "IEDB", "id": "562250", "url": "https://www.iedb.org/epitope/562250" }, { "database": "IEDB", "id": "627429", "url": "https://www.iedb.org/epitope/627429" }, { "database": "IEDB", "id": "876938", "url": "https://www.iedb.org/epitope/876938" }, { "database": "IEDB", "id": "917183", "url": "https://www.iedb.org/epitope/917183" }, { "database": "IEDB", "id": "1089889", "url": "https://www.iedb.org/epitope/1089889" }, { "database": "IEDB", "id": "1092004", "url": "https://www.iedb.org/epitope/1092004" }, { "database": "IEDB", "id": "2005651", "url": "https://www.iedb.org/epitope/2005651" }, { "database": "IEDB", "id": "2254681", "url": "https://www.iedb.org/epitope/2254681" }, { "database": "IEDB", "id": "2255324", "url": "https://www.iedb.org/epitope/2255324" } ], "reference": [ { "type": "PubMed", "id": "37938771", "url": "https://glygen.org/publication/PubMed/37938771" } ] }, { "title": "Perlecan (HSPG2) promotes structural, contractile, and metabolic development of human cardiomyocytes.", "journal": "Cell reports", "date": "2024-01-23", "authors": "Johnson Benjamin B, Cosson Marie-Victoire, Tsansizi Lorenza I, Holmes Terri L, Gilmore Tegan, Hampton Katherine, Song Ok-Ryul, Vo Nguyen T N, Nasir Aishah, Chabronova Alzbeta, Denning Chris, Peffers Mandy J, Merry Catherine L R, Whitelock John, Troeberg Linda, Rushworth Stuart A, Bernardo Andreia S, Smith James G W", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ], "reference": [ { "type": "PubMed", "id": "38198277", "url": "https://glygen.org/publication/PubMed/38198277" } ] }, { "title": "Dyssegmental dysplasia Rolland-Desbuquois type is caused by pathogenic variants in HSPG2 - a founder haplotype shared in five patients.", "journal": "Journal of human genetics", "date": "2024-06", "authors": "Farshadyeganeh Paniz, Yamada Takahiro, Ohashi Hirofumi, Nishimura Gen, Fujita Hiroki, Oishi Yuriko, Nunode Misa, Ishikawa Shuku, Murotsuki Jun, Yamashita Yuri, Ikegawa Shiro, Ogi Tomoo, Arikawa-Hirasawa Eri, Ohno Kinji", "evidence": [ { "database": "RefSeq", "id": "NP_001278789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278789" } ], "reference": [ { "type": "PubMed", "id": "38424183", "url": "https://glygen.org/publication/PubMed/38424183" } ] }, { "title": "Inhibition of chymotrypsin by heparin cofactor II.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Church FC, Noyes CM, Griffith MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "3863104", "url": "https://glygen.org/publication/PubMed/3863104" } ] }, { "title": "O-GlcNAc transferase regulates collagen deposition and fibrosis resolution in idiopathic pulmonary fibrosis.", "journal": "Frontiers in immunology", "date": "2024", "authors": "Vang Shia, Helton Eric Scott, Guo Yiming, Burpee Bailey, Rose Elex, Easter Molly, Bollenbecker Seth, Hirsch Meghan June, Matthews Emma Lea, Jones Luke Isaac, Howze Patrick Henry, Rajasekaran Vasanthi, Denson Rebecca, Cochran Phillip, Attah Isaac Kwame, Olson Heather, Clair Geremy, Melkani Girish, Krick Stefanie, Barnes Jarrod Wesley", "evidence": [ { "database": "O-GlcNAc Database", "id": "P98160", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" } ], "reference": [ { "type": "PubMed", "id": "38665916", "url": "https://glygen.org/publication/PubMed/38665916" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "Ultradeep O-GlcNAc proteomics reveals widespread O-GlcNAcylation on tyrosine residues of proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-11-19", "authors": "Hou Chunyan, Deng Jingtao, Wu Ci, Zhang Jing, Byers Stephen, Moremen Kelley W, Pei Huadong, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P98160", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P98160" }, { "database": "O-GlcNAc Atlas", "id": "P98160", "url": "https://oglcnac.org/atlas/detail/P98160" } ], "reference": [ { "type": "PubMed", "id": "39531497", "url": "https://glygen.org/publication/PubMed/39531497" } ] }, { "title": "Binding of laminin to type IV collagen: a morphological study.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Charonis AS, Tsilibary EC, Yurchenco PD, Furthmayr H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "3997977", "url": "https://glygen.org/publication/PubMed/3997977" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Mechanism of inhibition of activated protein C by protein C inhibitor.", "journal": "Journal of biochemistry", "date": "1984", "authors": "Suzuki K, Nishioka J, Kusumoto H, Hashimoto S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "6323392", "url": "https://glygen.org/publication/PubMed/6323392" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "The tricho-rhino-phalangeal syndrome with exostoses (or Langer-Giedion syndrome): four additional patients without mental retardation and review of the literature.", "journal": "American journal of medical genetics", "date": "1984", "authors": "Langer LO Jr, Krassikoff N, Laxova R, Scheer-Williams M, Lutter LD, Gorlin RJ, Jennings CG, Day DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "6496574", "url": "https://glygen.org/publication/PubMed/6496574" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Binding of human factor VII and VIIa to monocytes.", "journal": "The Journal of clinical investigation", "date": "1982", "authors": "Broze GJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "6980899", "url": "https://glygen.org/publication/PubMed/6980899" } ] }, { "title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Vartio T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7075587", "url": "https://glygen.org/publication/PubMed/7075587" } ] }, { "title": "Cloning of the sulphamidase gene and identification of mutations in Sanfilippo A syndrome.", "journal": "Nature genetics", "date": "1995", "authors": "Scott HS, Blanch L, Guo XH, Freeman C, Orsborn A, Baker E, Sutherland GR, Morris CP, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "7493035", "url": "https://glygen.org/publication/PubMed/7493035" } ] }, { "title": "Effects of protein S and factor Xa on peptide bond cleavages during inactivation of factor Va and factor VaR506Q by activated protein C.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Rosing J, Hoekema L, Nicolaes GA, Thomassen MC, Hemker HC, Varadi K, Schwarz HP, Tans G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "7499257", "url": "https://glygen.org/publication/PubMed/7499257" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "Nitric oxide in skeletal muscle.", "journal": "Nature", "date": "1994", "authors": "Kobzik L, Reid MB, Bredt DS, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "7527495", "url": "https://glygen.org/publication/PubMed/7527495" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.", "journal": "Biochemistry", "date": "1995", "authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7547873", "url": "https://glygen.org/publication/PubMed/7547873" } ] }, { "title": "Interactions between dystrophin glycoprotein complex proteins.", "journal": "Biochemistry", "date": "1995", "authors": "Madhavan R, Jarrett HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "7547961", "url": "https://glygen.org/publication/PubMed/7547961" } ] }, { "title": "Cloning of the putative tumour suppressor gene for hereditary multiple exostoses (EXT1).", "journal": "Nature genetics", "date": "1995", "authors": "Ahn J, Ludecke HJ, Lindow S, Horton WA, Lee B, Wagner MJ, Horsthemke B, Wells DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "7550340", "url": "https://glygen.org/publication/PubMed/7550340" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Identification and characterization of the dystrophin anchoring site on beta-dystroglycan.", "journal": "The Journal of biological chemistry", "date": "1995-11-10", "authors": "Jung D, Yang B, Meyer J, Chamberlain J S, Campbell K P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "7592992", "url": "https://glygen.org/publication/PubMed/7592992" } ] }, { "title": "Cloning of the human heparan sulfate-N-deacetylase/N-sulfotransferase gene from the Treacher Collins syndrome candidate region at 5q32-q33.1.", "journal": "Genomics", "date": "1995", "authors": "Dixon J, Loftus SK, Gladwin AJ, Scambler PJ, Wasmuth JJ, Dixon MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "7601448", "url": "https://glygen.org/publication/PubMed/7601448" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Molecular dissection of a contiguous gene syndrome: localization of the genes involved in the Langer-Giedion syndrome.", "journal": "Human molecular genetics", "date": "1995", "authors": "Ludecke HJ, Wagner MJ, Nardmann J, La Pillo B, Parrish JE, Willems PJ, Haan EA, Frydman M, Hamers GJ, Wells DE, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "7711731", "url": "https://glygen.org/publication/PubMed/7711731" } ] }, { "title": "Syntrophin binds to an alternatively spliced exon of dystrophin.", "journal": "The Journal of cell biology", "date": "1995-02", "authors": "Ahn A H, Kunkel L M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "7844150", "url": "https://glygen.org/publication/PubMed/7844150" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "Dystroglycan is a binding protein of laminin and merosin in peripheral nerve.", "journal": "FEBS letters", "date": "1994", "authors": "Yamada H, Shimizu T, Tanaka T, Campbell KP, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "7925941", "url": "https://glygen.org/publication/PubMed/7925941" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "Dystroglycan binds nerve and muscle agrin.", "journal": "Neuron", "date": "1994", "authors": "Sugiyama J, Bowen DC, Hall ZW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8043271", "url": "https://glygen.org/publication/PubMed/8043271" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "Factor IXa protects factor VIIIa from activated protein C. Factor IXa inhibits activated protein C-catalyzed cleavage of factor VIIIa at Arg562.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Regan LM, Lamphear BJ, Huggins CF, Walker FJ, Fay PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "8144529", "url": "https://glygen.org/publication/PubMed/8144529" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Shapiro SD, Kobayashi DK, Ley TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8226919", "url": "https://glygen.org/publication/PubMed/8226919" } ] }, { "title": "Structural characterization of the complete human perlecan gene and its promoter.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Cohen I R, Gr\u00e4ssel S, Murdoch A D, Iozzo R V", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "reference": [ { "type": "PubMed", "id": "8234307", "url": "https://glygen.org/publication/PubMed/8234307" } ] }, { "title": "Human dystroglycan: skeletal muscle cDNA, genomic structure, origin of tissue specific isoforms and chromosomal localization.", "journal": "Human molecular genetics", "date": "1993-10", "authors": "Ibraghimov-Beskrovnaya O, Milatovich A, Ozcelik T, Yang B, Koepnick K, Francke U, Campbell K P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8268918", "url": "https://glygen.org/publication/PubMed/8268918" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "A role for the dystrophin-glycoprotein complex as a transmembrane linker between laminin and actin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Ervasti JM, Campbell KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8349731", "url": "https://glygen.org/publication/PubMed/8349731" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "The three human syntrophin genes are expressed in diverse tissues, have distinct chromosomal locations, and each bind to dystrophin and its relatives.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ahn AH, Freener CA, Gussoni E, Yoshida M, Ozawa E, Kunkel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8576247", "url": "https://glygen.org/publication/PubMed/8576247" } ] }, { "title": "The tissue factor pathway: how it has become a `prima ballerina`.", "journal": "Thrombosis and haemostasis", "date": "1995", "authors": "Rapaport SI, Rao LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "8578528", "url": "https://glygen.org/publication/PubMed/8578528" } ] }, { "title": "The crystal structure of the complex of blood coagulation factor VIIa with soluble tissue factor.", "journal": "Nature", "date": "1996", "authors": "Banner DW, D'Arcy A, Chene C, Winkler FK, Guha A, Konigsberg WH, Nemerson Y, Kirchhofer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "8598903", "url": "https://glygen.org/publication/PubMed/8598903" } ] }, { "title": "Alternative splicing of agrin alters its binding to heparin, dystroglycan, and the putative agrin receptor.", "journal": "Neuron", "date": "1996-04", "authors": "Gesemann M, Cavalli V, Denzer A J, Brancaccio A, Schumacher B, Ruegg M A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8607994", "url": "https://glygen.org/publication/PubMed/8607994" } ] }, { "title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8626565", "url": "https://glygen.org/publication/PubMed/8626565" } ] }, { "title": "Characterization of dp6troglycan-laminin interaction in peripheral nerve.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Yamada H, Chiba A, Endo T, Kobata A, Anderson LV, Hori H, Fukuta-Ohi H, Kanazawa I, Campbell KP, Shimizu T, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8627307", "url": "https://glygen.org/publication/PubMed/8627307" } ] }, { "title": "Kinetics of human factor VII activation.", "journal": "Biochemistry", "date": "1996", "authors": "Butenas S, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769735", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735" } ], "reference": [ { "type": "PubMed", "id": "8639673", "url": "https://glygen.org/publication/PubMed/8639673" } ] }, { "title": "Partial purification and characterization of a protease from human plasma cleaving von Willebrand factor to fragments produced by in vivo proteolysis.", "journal": "Blood", "date": "1996", "authors": "Furlan M, Robles R, Lammle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "8639781", "url": "https://glygen.org/publication/PubMed/8639781" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "Cloning and expression of the gene involved in Sanfilippo B syndrome (mucopolysaccharidosis III B).", "journal": "Human molecular genetics", "date": "1996", "authors": "Weber B, Blanch L, Clements PR, Scott HS, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "8776591", "url": "https://glygen.org/publication/PubMed/8776591" } ] }, { "title": "The EXT2 multiple exostoses gene defines a family of putative tumour suppressor genes.", "journal": "Nature genetics", "date": "1996", "authors": "Stickens D, Clines G, Burbee D, Ramos P, Thomas S, Hogue D, Hecht JT, Lovett M, Evans GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656237", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237" } ], "reference": [ { "type": "PubMed", "id": "8782816", "url": "https://glygen.org/publication/PubMed/8782816" } ] }, { "title": "Dystroglycan is a dual receptor for agrin and laminin-2 in Schwann cell membrane.", "journal": "The Journal of biological chemistry", "date": "1996-09-20", "authors": "Yamada H, Denzer A J, Hori H, Tanaka T, Anderson L V, Fujita S, Fukuta-Ohi H, Shimizu T, Ruegg M A, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8798547", "url": "https://glygen.org/publication/PubMed/8798547" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "Cloning and characterization of the human homologue of a dystrophin related phosphoprotein found at the Torpedo electric organ post-synaptic membrane.", "journal": "Human molecular genetics", "date": "1996-04", "authors": "Sadoulet-Puccio H M, Khurana T S, Cohen J B, Kunkel L M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "8845841", "url": "https://glygen.org/publication/PubMed/8845841" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "Positional cloning of a gene involved in hereditary multiple exostoses.", "journal": "Human molecular genetics", "date": "1996", "authors": "Wuyts W, Van Hul W, Wauters J, Nemtsova M, Reyniers E, Van Hul EV, De Boulle K, de Vries BB, Hendrickx J, Herrygers I, Bossuyt P, Balemans W, Fransen E, Vits L, Coucke P, Nowak NJ, Shows TB, Mallet L, van den Ouweland AM, McGaughran J, Halley DJ, Willems PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656237", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237" } ], "reference": [ { "type": "PubMed", "id": "8894688", "url": "https://glygen.org/publication/PubMed/8894688" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Hereditary multiple exostoses (EXT): mutational studies of familial EXT1 cases and EXT-associated malignancies.", "journal": "American journal of human genetics", "date": "1997", "authors": "Hecht JT, Hogue D, Wang Y, Blanton SH, Wagner M, Strong LC, Raskind W, Hansen MF, Wells D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "8981950", "url": "https://glygen.org/publication/PubMed/8981950" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "The permeabilizing ATP receptor, P2X7. Cloning and expression of a human cDNA.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rassendren F, Buell GN, Virginio C, Collo G, North RA, Surprenant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9856532", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532" } ], "reference": [ { "type": "PubMed", "id": "9038151", "url": "https://glygen.org/publication/PubMed/9038151" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9065415", "url": "https://glygen.org/publication/PubMed/9065415" } ] }, { "title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9115292", "url": "https://glygen.org/publication/PubMed/9115292" } ] }, { "title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.", "journal": "The Biochemical journal", "date": "1997", "authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9148753", "url": "https://glygen.org/publication/PubMed/9148753" } ] }, { "title": "Differential association of syntrophin pairs with the dystrophin complex.", "journal": "The Journal of cell biology", "date": "1997-07-14", "authors": "Peters M F, Adams M E, Froehner S C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "9214383", "url": "https://glygen.org/publication/PubMed/9214383" } ] }, { "title": "Identification of functional endothelial protein C receptor in human plasma.", "journal": "The Journal of clinical investigation", "date": "1997", "authors": "Kurosawa S, Stearns-Kurosawa DJ, Hidari N, Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "9218519", "url": "https://glygen.org/publication/PubMed/9218519" } ] }, { "title": "Laminin 5 binds the NC-1 domain of type VII collagen.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Rousselle P, Keene DR, Ruggiero F, Champliaud MF, Rest M, Burgeson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9245798", "url": "https://glygen.org/publication/PubMed/9245798" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "Novel mutations in Sanfilippo A syndrome: implications for enzyme function.", "journal": "Human molecular genetics", "date": "1997", "authors": "Weber B, Guo XH, Wraith JE, Cooper A, Kleijer WJ, Bunge S, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024096", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096" } ], "reference": [ { "type": "PubMed", "id": "9285796", "url": "https://glygen.org/publication/PubMed/9285796" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Mutation screening of the EXT1 and EXT2 genes in patients with hereditary multiple exostoses.", "journal": "American journal of human genetics", "date": "1997", "authors": "Philippe C, Porter DE, Emerton ME, Wells DE, Simpson AH, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656237", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237" } ], "reference": [ { "type": "PubMed", "id": "9326317", "url": "https://glygen.org/publication/PubMed/9326317" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Molecular cloning and expression of mouse and human cDNAs encoding heparan sulfate D-glucosaminyl 3-O-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Shworak NW, Liu J, Fritze LM, Schwartz JJ, Zhang L, Logeart D, Rosenberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "9346953", "url": "https://glygen.org/publication/PubMed/9346953" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "epsilon-Sarcoglycan, a broadly expressed homologue of the gene mutated in limb-girdle muscular dystrophy 2D.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ettinger AJ, Feng G, Sanes JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "9405466", "url": "https://glygen.org/publication/PubMed/9405466" } ] }, { "title": "Interaction of muscle and brain sodium channels with multiple members of the syntrophin family of dystrophin-associated proteins.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998-01-01", "authors": "Gee S H, Madhavan R, Levinson S R, Caldwell J H, Sealock R, Froehner S C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "9412493", "url": "https://glygen.org/publication/PubMed/9412493" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "Effects of melagatran, a new low-molecular-weight thrombin inhibitor, on thrombin and fibrinolytic enzymes.", "journal": "Thrombosis and haemostasis", "date": "1998", "authors": "Gustafsson D, Antonsson T, Bylund R, Eriksson U, Gyzander E, Nilsson I, Elg M, Mattsson C, Deinum J, Pehrsson S, Karlsson O, Nilsson A, Sorensen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "9459334", "url": "https://glygen.org/publication/PubMed/9459334" } ] }, { "title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.", "journal": "European journal of biochemistry", "date": "1997", "authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9461298", "url": "https://glygen.org/publication/PubMed/9461298" } ] }, { "title": "Mutations in the EXT1 and EXT2 genes in hereditary multiple exostoses.", "journal": "American journal of human genetics", "date": "1998", "authors": "Wuyts W, Van Hul W, De Boulle K, Hendrickx J, Bakker E, Vanhoenacker F, Mollica F, Ludecke HJ, Sayli BS, Pazzaglia UE, Mortier G, Hamel B, Conrad EU, Matsushita M, Raskind WH, Willems PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "9463333", "url": "https://glygen.org/publication/PubMed/9463333" } ] }, { "title": "Novastan (brand of argatroban): a small-molecule, direct thrombin inhibitor.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Hursting MJ, Alford KL, Becker JC, Brooks RL, Joffrion JL, Knappenberger GD, Kogan PW, Kogan TP, McKinney AA, Schwarz RP Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9769739", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739" } ], "reference": [ { "type": "PubMed", "id": "9469622", "url": "https://glygen.org/publication/PubMed/9469622" } ] }, { "title": "Molecular cloning and expression of glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kitagawa H, Tone Y, Tamura J, Neumann KW, Ogawa T, Oka S, Kawasaki T, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "9506957", "url": "https://glygen.org/publication/PubMed/9506957" } ] }, { "title": "Molecular characterization and expression of heparan-sulfate 6-sulfotransferase. Complete cDNA cloning in human and partial cloning in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Habuchi H, Kobayashi M, Kimata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "9535912", "url": "https://glygen.org/publication/PubMed/9535912" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "The putative tumour suppressor EXT1 alters the expression of cell-surface heparan sulfate.", "journal": "Nature genetics", "date": "1998", "authors": "McCormick C, Leduc Y, Martindale D, Mattison K, Esford LE, Dyer AP, Tufaro F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3656253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253" } ], "reference": [ { "type": "PubMed", "id": "9620772", "url": "https://glygen.org/publication/PubMed/9620772" } ] }, { "title": "Human colonic cancer cells synthesize and adhere to laminin-5. Their adhesion to laminin-5 involves multiple receptors among which is integrin alpha2beta1.", "journal": "Journal of cell science", "date": "1998", "authors": "Orian-Rousseau V, Aberdam D, Rousselle P, Messent A, Gavrilovic J, Meneguzzi G, Kedinger M, Simon-Assmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9645947", "url": "https://glygen.org/publication/PubMed/9645947" } ] }, { "title": "Primary structure and high expression of human agrin in basement membranes of adult lung and kidney.", "journal": "European journal of biochemistry", "date": "1998-05-15", "authors": "Groffen A J, Buskens C A, van Kuppevelt T H, Veerkamp J H, Monnens L A, van den Heuvel L P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "9652404", "url": "https://glygen.org/publication/PubMed/9652404" } ] }, { "title": "The discoidin domain receptor tyrosine kinases are activated by collagen.", "journal": "Molecular cell", "date": "1997", "authors": "Vogel W, Gish GD, Alves F, Pawson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "9659899", "url": "https://glygen.org/publication/PubMed/9659899" } ] }, { "title": "An orphan receptor tyrosine kinase family whose members serve as nonintegrin collagen receptors.", "journal": "Molecular cell", "date": "1997", "authors": "Shrivastava A, Radziejewski C, Campbell E, Kovac L, McGlynn M, Ryan TE, Davis S, Goldfarb MP, Glass DJ, Lemke G, Yancopoulos GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "9659900", "url": "https://glygen.org/publication/PubMed/9659900" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9852107", "url": "https://glygen.org/publication/PubMed/9852107" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Molecular organization of sarcoglycan complex in mouse myotubes in culture.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Chan YM, Bonnemann CG, Lidov HG, Kunkel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9913351", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351" } ], "reference": [ { "type": "PubMed", "id": "9864373", "url": "https://glygen.org/publication/PubMed/9864373" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "A beta-1,3-N-acetylglucosaminyltransferase with poly-N-acetyllactosamine synthase activity is structurally related to beta-1,3-galactosyltransferases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Zhou D, Dinter A, Gutierrez Gallego R, Kamerling JP, Vliegenthart JF, Berger EG, Hennet T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "9892646", "url": "https://glygen.org/publication/PubMed/9892646" } ] }, { "title": "Molecular cloning and expression of a third member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Aikawa J, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "9915799", "url": "https://glygen.org/publication/PubMed/9915799" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] }, { "title": "SEMP1, a senescence-associated cDNA isolated from human mammary epithelial cells, is a member of an epithelial membrane protein superfamily.", "journal": "Gene", "date": "1999", "authors": "Swisshelm K, Machl A, Planitzer S, Robertson R, Kubbies M, Hosier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485" } ], "reference": [ { "type": "PubMed", "id": "9931503", "url": "https://glygen.org/publication/PubMed/9931503" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] }, { "title": "Multiple isoforms of heparan sulfate D-glucosaminyl 3-O-sulfotransferase. Isolation, characterization, and expression of human cdnas and identification of distinct genomic loci.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Shworak NW, Liu J, Petros LM, Zhang L, Kobayashi M, Copeland NG, Jenkins NA, Rosenberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928" } ], "reference": [ { "type": "PubMed", "id": "9988767", "url": "https://glygen.org/publication/PubMed/9988767" } ] } ], "pathway": [ { "id": "hsa:3339", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:3339", "resource": "KEGG Pathway" }, { "id": "R-HSA-1474228", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "resource": "Reactome", "description": "Degradation of the extracellular matrix" }, { "id": "R-HSA-1971475", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475", "resource": "Reactome", "description": "Glycosaminoglycan-protein linkage region biosynthesis" }, { "id": "R-HSA-2022928", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022928", "resource": "Reactome", "description": "HS-GAG biosynthesis" }, { "id": "R-HSA-2024096", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024096", "resource": "Reactome", "description": "HS-GAG degradation" }, { "id": "R-HSA-216083", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-3000157", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "resource": "Reactome", "description": "Laminin interactions" }, { "id": "R-HSA-3000171", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171", "resource": "Reactome", "description": "Non-integrin membrane-ECM interactions" }, { "id": "R-HSA-3000178", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-3560783", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783", "resource": "Reactome", "description": "Defective B4GALT7 causes EDS, progeroid type" }, { "id": "R-HSA-3560801", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801", "resource": "Reactome", "description": "Defective B3GAT3 causes JDSSDHD" }, { "id": "R-HSA-3656237", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656237", "resource": "Reactome", "description": "Defective EXT2 causes exostoses 2" }, { "id": "R-HSA-3656253", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3656253", "resource": "Reactome", "description": "Defective EXT1 causes exostoses 1, TRPS2 and CHDS" }, { "id": "R-HSA-4420332", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332", "resource": "Reactome", "description": "Defective B3GALT6 causes EDSP2 and SEMDJL1" }, { "id": "R-HSA-9694614", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614", "resource": "Reactome", "description": "Attachment and Entry" }, { "id": "R-HSA-975634", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" }, { "id": "R-HSA-9769735", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769735", "resource": "Reactome", "description": "Initiation of coagulation cascade" }, { "id": "R-HSA-9769739", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9769739", "resource": "Reactome", "description": "Regulation of clotting cascade" }, { "id": "R-HSA-977225", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" }, { "id": "R-HSA-9820960", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960", "resource": "Reactome", "description": "Respiratory syncytial virus (RSV) attachment and entry" }, { "id": "R-HSA-9833110", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "resource": "Reactome", "description": "RSV-host interactions" }, { "id": "R-HSA-9856532", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9856532", "resource": "Reactome", "description": "Mechanical load activates signaling by PIEZO1 and integrins in osteocytes" }, { "id": "R-HSA-9913351", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9913351", "resource": "Reactome", "description": "Formation of the dystrophin-glycoprotein complex (DGC)" }, { "id": "R-HSA-9918481", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481", "resource": "Reactome", "description": "Dengue Virus-Host Interactions" }, { "id": "R-HSA-9918485", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918485", "resource": "Reactome", "description": "Dengue Virus Attachment and Entry" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6ASH2-1", "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "Hspg2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGQRAVGSLLLGLLLHARLLAVTQGLRAYDGLSLPEDTETVTASRYGWTYSYLSDDEDLLADDASGDGLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDANAKEFREVSEAVVEKLETEYVKIPGDQIVSVVFIKELDGWVFVELDVGSEGNADGSQIQEVLHTVVSSGSIGPYVTSPWGFKFRRLGTVPQFPRVCTETEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEAVSEISSLPSAVVKVSPLPLWPEAATLPPPVMHGPQFLLPNVPGPTACGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCGPPPPCEPNEFSCENGHCALKLWRCDGDFDCEDHTDEANCPVKHPGEVCGPTQFQCVSTNRCIPASFHCDEETDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPVNPRVTMTSEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSASCLPCFCFGVTNLCQSSRRFRDQIRLNFDQPSDFKGVNVTMPSQPGVPPLSSTQLQIDPTLQEFQLVDLSRRFLVHDAFWALPKQFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAGYRLHSRGHTPTHPGALNQRQVQLSEEHWVHESGRPVQRAEMLQALASLEAVLLQTVYNTKMTSVGLSDIVMDTTVTYTTIHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASQRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPSNQELVRCDERGSLSATGEACRCKNNVVGRSCNECSEGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSRAQVLGASVQPSQFTLTNAAGTHTTSEGVSSPAPGELLFSSFHNLLSEPYFWSLPASFRGDKVTSYGGELRFTVTQRPRPGSAPLHRQPLVVLQGNNIVLEHHASREPSPGQPSNFIVPFQEQVWQRPDGQPATREHLLMALAGIDALLIQASHTQQPAESRLSGISMDVAVPENTGQDPAREVEHCTCPPGYRGPSCQDCDTGYTRVASGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDPQRGTPQDCQPCPCYGTPAAGQASHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYHGNPSQGQPCHRDGQVPEVPGCDCDPHGSISSQCDATGQCQCKAQVEGRTCSHCRPHHFHLSASNPEGCLPCFCMGVTQQCTSSSYSRQLISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVPDGARLSFSNFAHLGQESFYWQLPETYQGDKVAAYGGKLRYTLSYTSGPQGSPLSDPDIQITGNNIMLVASQPALQGPERRSYEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSGGPQALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQCELCECNGHSEVCHPETGACTGCQHNTVGEFCETCATGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGNPNVQGGRCQPLTKESLEVQIHPSRSVVPQGGPHSLRCQVNGSPPHYFYWSREDGRPLPSGAQQRHQGSELHFPSVQPSDAGVYICTCRNLIHTSNSRAELLVAEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQVSGTSTAPVASIHPPQLTVQPGQLAEFRCSATGNPTPTLEWIGGPSGQLPTKAQIHNGILRLPAIEPSDQGQYLCRALSSAGQHVVRAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPSASITWRKEGGSLPPQARSENTDIPTLLIPAIRVADSGFYLCVATSPTGTAQARIQVVVLSASGASSVPVRIESSSPSVTEGQTLDLNCAVMGLTYTQVTWYKRGGSLPPHAQVHGSRLRLPQVSPADSGEYVCRVESDLGPKEASIVVSVLHSPHSGPSYTPATSSTPPIRIESSSSHVAEGQTLDLNCVVPGQAQVTWRKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCHVLLGSEHIETSVLVAIEPAVSIPAPGPVPPVRIESSSPTVAEGQTLDLNCVVAGQAHAQVTWYKRGSSLPARHQVRGSRLYIFQASPADAGEYVCRAGNGQEATITVKVTGNQGANIAYPPGSTPTIRIESSSSHVAEGQTLDLNCVVQGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVSPVDSGEYVCRVEGGPVPLESSVLVAIEPAGSVPALGVTPPVRIESSSSHVSEGQSLDLNCLVAGQTHPQISWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVSGSGTHEASVLVTIQQHLSPSHPQSVVHPVRIESSSPSLANGHTLDLNCLVASLTPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGVGSQETSLIVTIESRGPSHVPSVSPPMRIETSSPTVTEGQTLDLNCVVVGRPQATITWYKRGGSLPFRHQAHGSRLRLHQMSVADSGEYVCRANNNIDAQETSIMISVSPNTNAPSASASPVPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPAHHQAHGSRLRLYQVSPADSGEYVCRVLSSSGPLEASVLVSITASASNVHVPGENPFPPIRIETSSSQVAEGQTLDLTCVVPGQAHAQVTWHKRGGSLPAGHQVHGHILRLNRVSPADSGEYSCQVTGSSGTLEASVLVTIEASQPSPIPAPGLAQPIYIESSSSHLAEGQTVDLNCVVPGQAHAQVTWHKRGSSLPARHQTHGSLLRLYHISPADSGEYVCQVAGSSHPEHEASFKITVPASEGSSYRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPISLEWKTRNQELEDNVHISPNGSIMTIVGARPSNHGAYRCVASNVYGVAQSVVNLIVHGPPTVSVLPEGPVHVKMGKDITLECVSSGEPRSSPRWTRLGIPVKLEPRMFGLMNSHAMLKIASVKPSDAGTYVCQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEEAELTLEAGHTATLHCSATGNPPPTIHWSKLRAPLPWQHRIEGNTLVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESHPYATIIPEHTSVQPGKLVQLQCLAHGTPPLTYQWSRVGGILPEKAVARNQLLRLEPAGRADSGRYRCQVSNKVGSAEAFAQVLVQGSSGDVPDTSTPVGSTPTVQVTPQQETKSIGASVEFHCAVPNEHGTHLRWLKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQATAQLIVQALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGRLRSGIVQSGSVIRIAHVELADAGQYRCAATNAAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAVFPCMASGYPTPAITWSKVDGDLPPDSRLENNMLMLPSVRPEDAGTYVCTATNRQGKVKAFAYLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKHTPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSMIVGNLAPVNGTSQGKFQGLDLNEELYLGGYPDYRAIPKAGLSSGFVGCVRELRIQGEEIVFHDVNLTTHGISHCPTCQDRPCQNGGQCHDSESSSYTCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYNCRCHLGRSGMRCEEGVTVTTPSMSGAGSYLVLPALTNTHHELRLDVEFKPLEPDGILLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSLEPLALGRWHRVSAERLNKDGSLQVDGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVQLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSRGVGQCYDSSPCERQPCRNGATCMPAGEYEFQCLCQDGFKGDLCEHEENPCQLQEPCLNGGTCRGTRCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAYFHDNGFLALPGNSFSRSLPEVPETIEFEVRTSTANGLLLWQGVVKESSRSKDFISLGLQDGHLVFNYQLGSGEARLVSEDPINDGEWHRVTALREGQRGSIQVDGEELVIGRSPGPNVAVNTKDIIYIGGAPDVATLTRGKFSSGITGCLKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS", "length": 4387 }, "evidence": [ { "id": "HGNC:5273", "url": "https://alliancegenome.org/gene/HGNC:5273#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080807-4", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080807-4#orthology", "database": "AGR" }, { "id": "MGI:96257", "url": "https://alliancegenome.org/gene/MGI:96257#orthology", "database": "AGR" }, { "id": "RGD:621770", "url": "https://alliancegenome.org/gene/RGD:621770#orthology", "database": "AGR" }, { "id": "FB:FBgn0284408", "url": "https://alliancegenome.org/gene/FB:FBgn0284408#orthology", "database": "AGR" }, { "id": "P98160", "url": "https://omabrowser.org/oma/group/P98160/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8M9PWV8-1", "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein isoform X1", "gene_name": "hspg2", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MGARIRAHKFTLFILPLVFTSHLFNVALSSKVWDEVPFPEDLEEENEQLGDYVDDEGYDPSGDISGEEDGSTPEPSSTDPGPTVTIYYRALVNFTNSFQYVPELDDIYSNAFNEISSAVVDTLESDYNRIPGQQTVNVVLIKKIGKDVFVELDVGSDNNSNETQIREVLFSVVKEGTIASYDTSVVGFQFRRLGEADTLPPVESIFISVKPSPRECTSNEFSCQDGLACIPREYVCDKRPDCNDLSDEIDCGVGVAPLRPTQPTPPRPRPPPGPGPCRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQNGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQSTGRYRNQITLRFTEEEDFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFPDTFNSREIRFTEENWEHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCESCSPGFERVPGPYLGICAGCNCNGHASACDPVSGHCLSCQHKTEGAQCEKCKPGFFGDPSRGQYDDCKPCPCPYTETSRRFSDTCFLDHDNQATCDACREGYTGRRCEKCAPGYVGNPLQPNGKCIPAASPISKCDNRGTINPISKPCYCKSNVAGALCDECKTGAFHLTADNPEGCLQCFCMGVTKQCASSTWSRDQVRGGVNGQLFTLSNAANTRTISEGITQRGSTEVVYRSFTNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQGSGIFLEHYSQIKPLPRVPATITVTFRESAWRRADGQPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMDIAVPHSTGNERAMEVEECACPQGYSGPSCQDCDVGYTRTPGLYLGTCEKCECHGHASSCDSETGDCLNCLHNTIGRRCENCISGYYGNPKTGDPQACRPCPCLGQTSNQPSSCYLGSDGQPVCECPAGYTGRRCERCAPGYIGNPQLGQRCTPGSNNGDCYRCDQSGSEGCSGTGVCRCKMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQGDKKASSARTRRANQYPADEARKLDDEIWEIITNFSNGQSSFPFSSSSQSSHSSSFEAQNSLSLSSVRDPSFHSGLTSPLKASESHSSDPAHSSHPDSTQQVEQEKNIIGVVRGPRPVPSNKYVLVYNGFSLHPDDVLFWQLPEPFKGEKVGAYGGKLKYTISYVPGPRGSPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHWQRPDGMPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQALEVEQCQCPPGYSGLSCQDCASGYTRTGGGLYLGHCEPCECNGHSDTCHPETGICTNCQHNTKGELCEQCVDGFFGDPTAGTPEDCQPCACPGTDPENQFSRTCESLGNGGYQCTACQPGYLGQYCERCAPGYVGNPQARVPCRSDAAFLVVKVYPERVQVAQGLPVTLRCQVSGSPPHYFQWSREDGRPISSSAERRRQGEELHFPGIQSNDAGVYICTCRDQRSSNRSKAEIVVATLPSKPIEVFIEEPKAQSVRVGSTVSFICTAKSKLPAYTLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNMLGMDEGSAVLYVPEASQSQMFYTAYEMFEGHRKPAEGVQPVATLSPPVQTVKEGDVAQFRCTVTGNPTPAVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKALNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCRAIGSPTPSLKWNKRGGSLPPQAIPSHGFHQFKSNSLDVLQRRIEELQARMDRTDIGTLVVPNIRLSDAGTYLCVGTNAAGSSEAHIDVSVTKGENILSGVIIQPPSASVIEGEALDLNCLVPGTSTGSVKWSRAGGLLSSNHQVLETRLRILRASADDTGDYICTVENGPSPQKATVSVSVTSSASLGLQTPIISIEPHSAVVKQGESASFRCKVHNGAQPVRLEWKLTNNLPLPDNVKVGPDSSIMTVTNAQAKNQGTYRCVASNLYGMTHSIVSLIVRESPKAVVTPAGPVRVRVGDPINLECQAAGEPRPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHGFPKPTITWFKERSSLPWRHKIVDNSLILPNVGRQDSGQYVCNATNHLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQCLAHGTPPLRYEWTKINGSLPSTAQLQGGDLQINLAKENDAGTYRCVASNKVGKSEALAKVSVRSSLSVKVSPQVEVKALGSAVEFTCAAKGGLQIEWLKEGGVLPPNHHIKDGILRIENLEQSNEGIYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQTVMVGNSVEFECHAIGDPEPTVRWSKVGAPLPDHVEIRGNILRIDQVFESDSGQYRCTATNDVGSEHSHVVLNIQSLPQIAALPESKEVTIGSDAVLPCIASGYPVPTITWSKVENDLPPKCRQDGHALTVPVVTESDAGTYVCTAANKQGKVEAFTRLNVHERVMPYFTQEPLSYLTLPTIKNSYKAFSIKITFRPDNVDGLILYAGMIIYNGQKKTTGADFISFGLLGGRPEFRFDVGSGMATIRYPTPIKLGEFHTVHLYRNQTQGSLVVDGQAPVNGTSQGKFKGLDLNEELFVGGYPNYSMLAKTAGLKTGFVGCIKQLIIQGDEVIFKDLDKSSTGVSNCPTCKDRPCQNDGTCEDSVASLYKCTCKRGFTGSNCQHHSSLHCHTEACGPDATCINRPSGLGYDCRCHLGKSGNKCMDGTLITTPLFDGEDSYIAYPPLTNIHNDLRIEMEFKPMDPDGLMFFSGGKKMKVEDFVAVSMVNGHVEFRYELGTGQAVLRSQEPVSLDQWHRVVAERLNKDGSLTVDHAKEITRSSPGKAQGLNIHTPMYLGGVPSMDILPKPANVSMLFDGCIGEVFINGKKVDLSYSFTESRAISQCNDDSPCDRRPCLHAGTCMATAEYEYQCFCAEGYEGDRCEIVKESCRHSSQCQNGGSCVNNHCVCPAGYSGRHCEKGQESSFSEAMWSLEGSGGNDSPIEYSAYFHDNGYLALPKPMFPRSAPDSPETIELEINTASKDGLILWQGVESAGALNLHKKHANIKELGDQGKGKDFISLGLQNGHLVFSYQLGSGEAQIVSGEPVNDRQWHKITAVRTGKHGYLQIDGGSVQRGQSQGKSIMVNTKGNIYLGGAPDMQALTGGKYSSGMTGCVKNLSLMNARPGEQPARPIDLQVHAEEGINVERCLT", "length": 3701 }, "evidence": [ { "id": "HGNC:5273", "url": "https://alliancegenome.org/gene/HGNC:5273#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080807-4", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080807-4#orthology", "database": "AGR" }, { "id": "MGI:96257", "url": "https://alliancegenome.org/gene/MGI:96257#orthology", "database": "AGR" }, { "id": "RGD:621770", "url": "https://alliancegenome.org/gene/RGD:621770#orthology", "database": "AGR" }, { "id": "FB:FBgn0284408", "url": "https://alliancegenome.org/gene/FB:FBgn0284408#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0ACD4DAU3-1", "protein_name": "Terribly reduced optic lobes, isoform BD", "gene_name": "trol", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MMGSPGSQASAIATSVGIRSGRRGQAGGSLLLRLLAVTFVLAACHAPLLTNAKQISNLGDDQDFMLADDESLQGINDSEWQLMGDDIDDGLLDDVDETLKPMETKSEEEDLPTGNWFSQSVHRVRRSINRLFGSDDNQERGRRQQRERSQRNRDAINRQKELRRRQKEDHNRWKQMRMERQLEKQRLVKRTNHVVFNRATDPRKRASDLYDENEASGYHEEDTTLYRTYFVVNEPYDNEYRDRESVQFQNLQKLLDDDLRNFFHSNYEGNDDEEQEIRSTLERVEPTNDNFKIRVQLRIELPTSVNDFGSKLQQQLNVYNRIENLSAATDGVFSFTESSVTEESVRHLDVGFVEPHITLFHEQNTGYDDFDRKPTTETQDIEEEAIDVTLPQEEVEGSGSDDSSCRGDATFTCPRSGKTICDEMRCDREIQCPDGEDEEYCNYPNVCTEDQFKCDDKCLELKKRCDGSIDCLDQTDEAGCINAPEPEPEPEPEPEPEPESEPEAEPEPEPEPEPESEPEQEPEPQVPEANECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNCVEGEEEDRVGIPIGHQPWRPASKHDDWLHEMDTSEYQVYQPSNVYEKANSQNPCASNQFRCTTSNVCIPLHLRCDGFYHCNDMSDEKSCEQYQRHTTTRRPLTLATPTSRITTQGPGLLERRNTTTATEASRWPWATKTTTIATTTSNPITTVGVANSPPQTCLENIEFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCGDGSCISGYKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLNECDILEFECDYSQCLPLEKKCDGYADCEDMSDELECQSYTDHCLESEFECDSYCLPRDQLCNGIPNCQDGSDERNCTFCREDAYLCNTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACNGTCVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANCCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRGSGRPVNGPDVIITGNRFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSCPSGTYGDPRRGVPCKECPCPLTGSNNFASGCQQSPDGDVVCRCNEGYTGRRCEQCAAGYQGNPLAAGGICRRIPDTSCNVDGTYSVHSNGTCQCKDSVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPCECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYVGDATRGTIYDCQPDEGYPIPSPPAPGNQTLECTAYCQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLITDESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQIIVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYKENSRLPENVEVQGGNLYLYDLQVSDSGVYICQAVNNETASVFKDTVSITITRYAQEMLARYEKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAPRVTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNCQFTSVASLRYDWSHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIKWAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSSTSIDIEPRERPSVKIVSAPLQTFSVGAPASLYCTVEGIPDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKELVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDVHWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQVLRAPQYPYNRFKGGVSLKDTPCMVLYICAAATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAPLSNNVRQVGNRLVISNVSPSDAGNYVCKCKTDEGDLYTTSYKLEVEDQPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETADFPNILVVTGAIPQFRQEPRSYMSFPTLPNSSFKFNFELTFRPENGDGLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPMLVRAEEPLALNEWHTVRVSRFKRDGYIQVDEQHPVAFPTLQQIPQLDLIEDLYIGGVPNWELLPADAVSQQVGFVGCISRLTLQGRTVELIREAKYKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCICQPGWTGRDCAIEGTQCTPGVCGAGRCENTENDMECLCPLNRSGDRCQYNEILNEHSLNFKGNSFAAYGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILRVGDGPERKAKAPGSDRILSLKTHLYVGGYDRSTVKVNRDVNITKGFDGCISRLYNFQKPVNLLADIKDAANIQSCGETNMIGGDEDSDNEPPVPPPTPDVHENELQPYAMAPCASDPCENGGSCSEQEDVAVCSCPFGFSGKHCQEHLQLGFNASFRGDGYVELNRSHFQPALEQSYTSMGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAILEVDRMLHSGETRPTSKKSMKLPGNVFVGGAPDLEVFTGFRYKHNLNGCIVVVEGETVGQINLSSAAVNGVNANVCPANDDPLGGTEPPVV", "length": 4489 }, "evidence": [ { "id": "HGNC:5273", "url": "https://alliancegenome.org/gene/HGNC:5273#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080807-4", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080807-4#orthology", "database": "AGR" }, { "id": "MGI:96257", "url": "https://alliancegenome.org/gene/MGI:96257#orthology", "database": "AGR" }, { "id": "RGD:621770", "url": "https://alliancegenome.org/gene/RGD:621770#orthology", "database": "AGR" }, { "id": "FB:FBgn0284408", "url": "https://alliancegenome.org/gene/FB:FBgn0284408#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q05793-1", "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "Hspg2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGQRAVGSLLLGLLLHARLLAVTHGLRAYDGLSLPEDTETVTASRYGWTYSYLSDDEDLLADDASGDGLGSGDVGSGDFQMVYFRALVNFTRSIEYSPQLEDASAKEFREVSEAVVEKLEPEYRKIPGDQIVSVVFIKELDGWVFVELDVGSEGNADGSQIQEVLHTVVSSGSIGPYVTSPWGFKFRRLGTVPQFPRVCTETEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVPELSSSTPAVGKVSPLPLWPEAATTPPPPVTHGPQFLLPSVPGPSACGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVHDAFWALPKQFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAGYRLHSRGHTPTHPGTLNQRQVQLSEEHWVHESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTTQEIVRCDERGSLGTSGETCRCKNNVVGRLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAGTHTTSEGVSSPAPGELSFSSFHNLLSEPYFWSLPASFRGDKVTSYGGELRFTVMQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSNFIVPFQEQAWQRPDGQPATREHLLMALAGIDALLIQASYTQQPAESRLSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQDCDTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQRGTPQDCQPCPCYGAPAAGQAAHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYYGNPSQGQPCHRDGQVPEVLGCGCDPHGSISSQCDAAGQCQCKAQVEGRSCSHCRPHHFHLSASNPEGCLPCFCMGVTQQCASSSYSRQLISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGARLSFSNFAHLGQESFYWQLPEIYQGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGNNIMLVASQPALQGPERRSYEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEGAQPGPSSGPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQCELCECNGHSDLCHPETGACSRCQHNTAGEFCELCATGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGDPNVQGGRCQPLTKESLEVQIHPSRSVVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSAQQRHQGSELHFPSVQPSDAGVYICTCRNLIHTSNSRAELLVAEAPSKPIMVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQVSGTSTAPVASIHPPQLTVQPGQQAEFRCSATGNPTPMLEWIGGPSGQLPAKAQIHNGILRLPAIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPSASITWRKEGGSLPFRHQAHGSRLRLHHMSVADSGEYVCRANNNIDAQETSIMISVSPSTNSPPAPASPAPIRIESSSSRVAEGQTLDLNCVVPGHAHAQVTWHKRGGSLPTHHQTHGSRLRLYQVSSADSGEYVCSVLSSSGPLEASVLVSITPAAANVHIPGVVPPIRIETSSSRVAEGQTLDLSCVVPGQAHAQVTWHKRGGSLPAGHQVHGHMLRLNRVSPADSGEYSCQVTGSSGTLEASVLVTIEASEPSPIPAPGLAQPVYIESSSSHLTEGQTVDLKCVVPGQAHAQVTWHKRGSSLPARHQTHGSLLRLYQLSPADSGEYVCQVAGSSHPEHEASFKLTVPSSQNSSFRLRSPVISIEPPSSTVQQGQDASFKCLIHEGAMPIKVEWKIRDQELEDNVHISPNGSIITIVAPGPATMEPTACVASNVYGMAQSVVNLSVHGPPTVSVLPEGPVHVKMGKDITLECISSGEPRSSPRWTRLGIPVKLEPRMFGLMNSHAMLKIASVKPSDAGTYVCQAQNALGTAQKQVELIVDTGTVAPGTPQVQVEESELTLEAGHTATLHCSATGNPPPTIHWSKLRAPLPWQHRIEGNTLVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESPPYATIIPEHTSAQPGNLVQLQCLAHGTPPLTYQWSLVGGVLPEKAVVRNQLLRLEPTVPEDSGRYRCQVSNRVGSAEAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETRNIGASVEFHCAVPNERGTHLRWLKEGGQLPPGHSVQDGVLRIQNLDQNCQGTYVCQAHGPWGQAQATAQLIVQALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGTIIRIAHVELADAGQYRCAATNAAGTTQSHVLLLVQALPQISTPPEIRVPAGSAAVFPCMASGYPTPAITWSKVDGDLPPDSRLENNMLMLPSVRPEDAGTYVCTATNRQGKVKAFAYLQVPERVIPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFVGCVRELRIQGEEIVFHDVNLTTHGISHCPTCQDRPCQNGGQCQDSESSSYTCVCPAGFTAAAVNIRKPCTATPSLWADATCVNRPDGRGYTCRCHLGRSGVRCEEGVTVTTPSMSGAGSYLALPALTNTHHELRLDVEFKPLEPNGILLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSHEPLALGRWHRVSAERLNKDGSLRVDGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVQLSPATNMSAHFHGCVGEVSVNGKRLDLTYSFLGSQGVGQCYDSSPCERQPCRNGATCMPAGEYEFQCLCQDGFKGDLCEHEENPCQLHEPCLNGGTCRGARCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAYFYDNGFLGLPGNSFSRSLPEVPETIEFEVRTSTADGLLLWQGVVREASRSKDFISLGLQDGHLVFSYQLGSGEARLVSGDPINDGEWHRITALREGQRGSIQVDGEDLVTGRSPGPNVAVNTKDIIYIGGAPDVATLTRGKFSSGITGCIKNLVLHTARPGAPPPQPLDLQHRAQAGANTRPCPS", "length": 3707 }, "evidence": [ { "id": "HGNC:5273", "url": "https://alliancegenome.org/gene/HGNC:5273#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080807-4", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080807-4#orthology", "database": "AGR" }, { "id": "MGI:96257", "url": "https://alliancegenome.org/gene/MGI:96257#orthology", "database": "AGR" }, { "id": "RGD:621770", "url": "https://alliancegenome.org/gene/RGD:621770#orthology", "database": "AGR" }, { "id": "FB:FBgn0284408", "url": "https://alliancegenome.org/gene/FB:FBgn0284408#orthology", "database": "AGR" }, { "id": "P98160", "url": "https://omabrowser.org/oma/group/P98160/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "circulatory system development", "id": "GO:0072359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072359", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "negative regulation of synaptic transmission, cholinergic", "id": "GO:0032223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032223", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "receptor-mediated endocytosis", "id": "GO:0006898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006898", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "protein localization to synapse", "id": "GO:0035418", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035418", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "low-density lipoprotein particle receptor binding", "id": "GO:0050750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050750", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "amyloid-beta binding", "id": "GO:0001540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001540", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent conferring compression resistance", "id": "GO:0030021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030021", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 19, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "neuromuscular junction", "id": "GO:0031594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031594", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "microfibril", "id": "GO:0001527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001527", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "elastic fiber", "id": "GO:0071953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071953", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "plasma membrane protein complex", "id": "GO:0098797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098797", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "gel phase of basement membrane", "id": "GO:0140148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140148", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "cell periphery", "id": "GO:0071944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "basement membrane-specific heparan sulfate proteoglycan core protein N-glycosylated 1 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been N-glycosylated at the residue equivalent to Asn-3780 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G09197ZW. Example: UniProtKB:P98160-1, Asn-3780, MOD:00160~GNO:G09197ZW. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000056734", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056734" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 1 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1869 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-1869, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056735", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056735" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 2 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2140 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2140, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056736", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056736" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 3 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2429 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Ser-2429, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056737", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056737" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 4 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2429 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2429, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056738", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056738" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 5 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2429 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P98160-1, Ser-2429, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056739", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056739" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 6 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2559 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2559, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056740", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056740" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 7 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2637 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2637, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056741", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056741" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 8 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2638 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2638, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056742", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056742" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 9 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2716 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2716, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056743", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056743" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 10 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2719 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Ser-2719, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056744", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056744" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 11 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2719 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2719, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056745", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056745" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 12 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2721 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2721, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056746", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056746" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 13 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-279 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Ser-279, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056747", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056747" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 14 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-279 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-279, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056748", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056748" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 15 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2815 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2815, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056749", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056749" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 16 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2816 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-2816, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056750", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056750" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 17 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3393 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-3393, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056751", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056751" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 18 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3398 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-3398, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056752", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056752" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 19 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3398 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P98160-1, Ser-3398, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056753", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056753" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 20 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3398 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P98160-1, Ser-3398, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056754", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056754" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 21 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3398 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P98160-1, Ser-3398, MOD:00002~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056755", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056755" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 22 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3630 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Ser-3630, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056756", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056756" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 23 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1145 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-1145, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056757", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056757" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 24 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1147 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-1147, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056758", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056758" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 25 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1862 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Thr-1862, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056759", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056759" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 26 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1862 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-1862, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056760", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056760" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 27 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1862 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P98160-1, Thr-1862, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056761", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056761" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 28 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1876 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Thr-1876, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056762", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056762" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 29 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1876 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-1876, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056763", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056763" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 30 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1926 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-1926, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056764", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056764" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 31 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2145 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Thr-2145, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056765", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056765" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 32 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2145 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-2145, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056766", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056766" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 33 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-251 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P98160-1, Thr-251, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056767", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056767" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 34 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-260 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G40740AD. Example: UniProtKB:P98160-1, Thr-260, MOD:00005~GNO:G40740AD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056768", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056768" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 35 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-260 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P98160-1, Thr-260, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056769", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056769" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 36 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2646 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-2646, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056770", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056770" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 37 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-269 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Thr-269, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056771", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056771" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 38 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-269 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-269, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056772", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056772" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 39 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-269 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P98160-1, Thr-269, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056773", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056773" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 40 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-269 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P98160-1, Thr-269, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056774", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056774" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 41 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3032 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-3032, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056775", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056775" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 42 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3392 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-3392, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056776", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056776" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 43 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3399 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-3399, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056777", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056777" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 44 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3401 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-3401, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056778", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056778" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 45 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3405 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-3405, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056779", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056779" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 46 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-361 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-361, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056780", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056780" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 47 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-42 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-42, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:22171320]", "evidence": [ { "id": "PR:000056781", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056781" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 48 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-563 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-563, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056782", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056782" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 49 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-915 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P98160-1, Thr-915, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056783", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056783" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 50 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-915 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-915, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056784", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056784" } ] }, { "name": "basement membrane-specific heparan sulfate proteoglycan core protein O-glycosylated 51 (human)", "definition": "A basement membrane-specific heparan sulfate proteoglycan core protein (human) that has been O-glycosylated at the residue equivalent to Thr-972 of the amino acid sequence represented by UniProtKB:P98160-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P98160-1, Thr-972, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000056785", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000056785" } ] } ], "site_annotation": [ { "start_pos": 1755, "end_pos": 1757, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2121, "end_pos": 2123, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3072, "end_pos": 3074, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3105, "end_pos": 3107, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3279, "end_pos": 3281, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3780, "end_pos": 3782, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3836, "end_pos": 3838, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4068, "end_pos": 4070, "annotation": "n_glycosylation_sequon" }, { "start_pos": 554, "end_pos": 556, "annotation": "n_glycosylation_sequon" }, { "start_pos": 89, "end_pos": 91, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "O-glycosylated with core 1 or possibly core 8 glycans. Contains three heparan sulfate chains. Also contains chondroitin sulfate.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "PubMed", "id": "25326458", "url": "https://glygen.org/publication/PubMed/25326458" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" }, { "database": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "annotation": "Proteolytic processing produces the C-terminal angiogenic peptide, endorepellin. This peptide can be further processed to produce the LG3 peptide.", "evidence": [ { "database": "UniProtKB", "id": "P98160", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "database": "PubMed", "id": "12435733", "url": "https://glygen.org/publication/PubMed/12435733" }, { "database": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "3sh4", "pdb_chain": "a", "start_pos": 4197, "end_pos": 4391, "overlap": "1.0", "method": "X-Ray_Crystallography", "type": "experimental", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/3sh4.pdb", "url_external": "https://www.rcsb.org/structure/3sh4" } ], "lectin_list": [ { "lectin_class": "Laminin G-like", "evidence": [ { "id": "21996443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21996443" }, { "id": "10.1016/j.jmb.2011.09.048", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.jmb.2011.09.048" } ] } ], "domain_list": [ { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00076", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00076" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EGF-like 1", "eco_id": "ECO_0000255", "start_pos": 3844, "end_pos": 3881, "start_aa": "His", "end_aa": "Glu", "glycosite_overlap": [ { "position": 3847, "amino_acid": "Thr" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00076", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00076" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EGF-like 2", "eco_id": "ECO_0000255", "start_pos": 3884, "end_pos": 3922, "start_aa": "Gln", "end_aa": "Glu", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00076", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00076" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EGF-like 3", "eco_id": "ECO_0000255", "start_pos": 4104, "end_pos": 4141, "start_aa": "Asp", "end_aa": "Glu", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00076", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00076" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EGF-like 4", "eco_id": "ECO_0000255", "start_pos": 4143, "end_pos": 4176, "start_aa": "Glu", "end_aa": "Gln", "glycosite_overlap": [ { "position": 4171, "amino_acid": "Ser" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00124", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00124" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "LDL-receptor class A 1", "eco_id": "ECO_0000255", "start_pos": 198, "end_pos": 235, "start_aa": "Ala", "end_aa": "Glu", "glycosite_overlap": [ { "position": 210, "amino_acid": "Asn" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00124", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00124" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "LDL-receptor class A 2", "eco_id": "ECO_0000255", "start_pos": 284, "end_pos": 320, "start_aa": "Pro", "end_aa": "Gly", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00124", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00124" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "LDL-receptor class A 3", "eco_id": "ECO_0000255", "start_pos": 324, "end_pos": 360, "start_aa": "Pro", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00124", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00124" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "LDL-receptor class A 4", "eco_id": "ECO_0000255", "start_pos": 367, "end_pos": 404, "start_aa": "Val", "end_aa": "Met", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 10", "eco_id": "ECO_0000255", "start_pos": 1563, "end_pos": 1612, "start_aa": "Cys", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 11", "eco_id": "ECO_0000255", "start_pos": 1613, "end_pos": 1670, "start_aa": "Cys", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 1; first part", "eco_id": "ECO_0000255", "start_pos": 521, "end_pos": 530, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 1; second part", "eco_id": "ECO_0000255", "start_pos": 731, "end_pos": 763, "start_aa": "Cys", "end_aa": "Gly", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 2", "eco_id": "ECO_0000255", "start_pos": 764, "end_pos": 813, "start_aa": "Cys", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 3", "eco_id": "ECO_0000255", "start_pos": 814, "end_pos": 871, "start_aa": "Cys", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 4; truncated", "eco_id": "ECO_0000255", "start_pos": 879, "end_pos": 923, "start_aa": "Cys", "end_aa": "Lys", "glycosite_overlap": [ { "position": 915, "amino_acid": "Thr" }, { "position": 914, "amino_acid": "Ser" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 5; first part", "eco_id": "ECO_0000255", "start_pos": 924, "end_pos": 933, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 5; second part", "eco_id": "ECO_0000255", "start_pos": 1126, "end_pos": 1158, "start_aa": "Cys", "end_aa": "Arg", "glycosite_overlap": [ { "position": 1147, "amino_acid": "thr" }, { "position": 1145, "amino_acid": "thr" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 6", "eco_id": "ECO_0000255", "start_pos": 1159, "end_pos": 1208, "start_aa": "Cys", "end_aa": "Leu", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 7", "eco_id": "ECO_0000255", "start_pos": 1209, "end_pos": 1265, "start_aa": "Cys", "end_aa": "Arg", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 8", "eco_id": "ECO_0000255", "start_pos": 1275, "end_pos": 1324, "start_aa": "Cys", "end_aa": "Pro", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 9; first part", "eco_id": "ECO_0000255", "start_pos": 1325, "end_pos": 1334, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00460", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00460" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin EGF-like 9; second part", "eco_id": "ECO_0000255", "start_pos": 1530, "end_pos": 1562, "start_aa": "Cys", "end_aa": "Leu", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00122", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00122" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin G-like 1", "eco_id": "ECO_0000255", "start_pos": 3663, "end_pos": 3843, "start_aa": "Val", "end_aa": "Ser", "glycosite_overlap": [ { "position": 3780, "amino_acid": "Asn" }, { "position": 3836, "amino_acid": "Asn" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00122", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00122" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin G-like 2", "eco_id": "ECO_0000255", "start_pos": 3928, "end_pos": 4103, "start_aa": "Thr", "end_aa": "Tyr", "glycosite_overlap": [ { "position": 4068, "amino_acid": "Asn" }, { "position": 3933, "amino_acid": "Ser" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00122", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00122" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin G-like 3", "eco_id": "ECO_0000255", "start_pos": 4201, "end_pos": 4389, "start_aa": "Gln", "end_aa": "Cys", "glycosite_overlap": [ { "position": 4386, "amino_acid": "Thr" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00458", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00458" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin IV type A 1", "eco_id": "ECO_0000255", "start_pos": 538, "end_pos": 730, "start_aa": "Asp", "end_aa": "Glu", "glycosite_overlap": [ { "position": 563, "amino_acid": "thr" }, { "position": 554, "amino_acid": "Asn" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00458", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00458" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin IV type A 2", "eco_id": "ECO_0000255", "start_pos": 941, "end_pos": 1125, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": [ { "position": 972, "amino_acid": "thr" } ] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00458", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00458" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Laminin IV type A 3", "eco_id": "ECO_0000255", "start_pos": 1344, "end_pos": 1529, "start_aa": "Ile", "end_aa": "Glu", "glycosite_overlap": [] }, { "evidence": [ { "id": "P98160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P98160" }, { "id": "PRU00188", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00188" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "SEA", "eco_id": "ECO_0000255", "start_pos": 80, "end_pos": 191, "start_aa": "Gln", "end_aa": "Thr", "glycosite_overlap": [ { "position": 89, "amino_acid": "Asn" } ] } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 89, 210, 554, 1755, 2121, 3072, 3105, 3279, 3780, 3836, 4068 ], "o_linked_sites": [ 28, 40, 42, 49, 52, 65, 71, 76, 251, 260, 261, 265, 269, 279, 361, 563, 902, 914, 915, 972, 1145, 1147, 1862, 1869, 1876, 1896, 1920, 1926, 2127, 2136, 2138, 2140, 2143, 2145, 2150, 2151, 2160, 2161, 2223, 2429, 2524, 2525, 2529, 2541, 2559, 2591, 2627, 2637, 2638, 2646, 2716, 2719, 2721, 2815, 2816, 2995, 3032, 3149, 3152, 3392, 3393, 3398, 3399, 3401, 3405, 3412, 3521, 3630, 3847, 3933, 4171, 4179, 4193, 4386 ], "snv_sites": [ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 16, 17, 18, 21, 22, 24, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 52, 55, 56, 57, 59, 60, 61, 63, 64, 66, 67, 68, 69, 71, 72, 73, 74, 75, 76, 77, 78, 80, 81, 82, 84, 85, 86, 88, 89, 90, 91, 92, 93, 94, 95, 96, 98, 100, 101, 102, 103, 108, 109, 110, 111, 113, 115, 118, 120, 121, 122, 123, 124, 125, 127, 128, 129, 130, 131, 133, 135, 137, 138, 139, 142, 143, 144, 145, 146, 147, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 166, 168, 169, 172, 174, 175, 176, 178, 179, 180, 181, 182, 185, 187, 188, 191, 192, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 208, 210, 211, 212, 213, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 233, 234, 237, 238, 239, 240, 242, 243, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 261, 262, 263, 264, 265, 266, 268, 269, 270, 271, 272, 274, 276, 277, 278, 279, 280, 281, 283, 284, 285, 286, 287, 288, 289, 290, 291, 293, 294, 295, 296, 297, 298, 299, 302, 303, 304, 305, 306, 307, 309, 311, 312, 313, 314, 315, 318, 319, 320, 321, 322, 323, 324, 327, 328, 329, 330, 331, 333, 334, 335, 336, 337, 338, 339, 343, 344, 345, 346, 347, 348, 349, 350, 352, 353, 354, 356, 357, 358, 360, 361, 362, 363, 364, 365, 366, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 386, 387, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 411, 412, 413, 414, 418, 419, 420, 421, 422, 423, 424, 425, 427, 429, 430, 431, 432, 433, 434, 435, 436, 437, 439, 440, 441, 442, 443, 444, 445, 448, 450, 451, 453, 454, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 471, 473, 474, 476, 477, 478, 479, 482, 483, 484, 485, 486, 487, 488, 490, 491, 492, 493, 494, 496, 497, 498, 499, 502, 503, 504, 506, 507, 508, 509, 510, 511, 512, 513, 515, 516, 517, 519, 520, 522, 523, 524, 525, 526, 527, 528, 529, 530, 532, 533, 534, 535, 537, 538, 539, 541, 543, 545, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 561, 562, 563, 564, 565, 567, 569, 571, 573, 574, 575, 577, 578, 579, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 595, 596, 597, 602, 604, 605, 606, 607, 608, 609, 610, 612, 613, 615, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 632, 633, 634, 635, 636, 637, 638, 640, 641, 642, 643, 644, 645, 646, 647, 648, 650, 651, 652, 653, 654, 655, 656, 657, 659, 660, 662, 663, 666, 667, 668, 669, 670, 671, 672, 673, 675, 676, 677, 678, 679, 680, 682, 683, 684, 685, 687, 688, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 704, 705, 706, 708, 709, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 730, 731, 733, 734, 735, 737, 740, 741, 743, 744, 745, 746, 747, 748, 749, 751, 752, 753, 754, 755, 756, 757, 759, 760, 763, 764, 765, 767, 768, 769, 770, 771, 772, 774, 775, 776, 777, 778, 779, 780, 784, 785, 786, 787, 788, 789, 790, 792, 793, 794, 795, 798, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 815, 817, 819, 820, 821, 823, 824, 826, 827, 828, 829, 830, 831, 833, 834, 837, 838, 840, 841, 843, 844, 845, 846, 847, 848, 849, 850, 852, 853, 855, 856, 857, 859, 861, 862, 864, 865, 866, 867, 869, 871, 872, 875, 876, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 914, 915, 916, 917, 918, 919, 920, 922, 923, 924, 927, 928, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 946, 948, 949, 950, 951, 952, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 986, 987, 989, 990, 991, 992, 993, 995, 996, 999, 1000, 1001, 1002, 1004, 1005, 1006, 1008, 1010, 1011, 1012, 1013, 1016, 1017, 1018, 1019, 1020, 1022, 1023, 1024, 1025, 1026, 1028, 1030, 1032, 1033, 1034, 1035, 1036, 1037, 1040, 1041, 1042, 1043, 1044, 1045, 1046, 1047, 1048, 1049, 1050, 1052, 1055, 1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1074, 1075, 1076, 1078, 1079, 1082, 1083, 1085, 1086, 1087, 1090, 1092, 1093, 1094, 1095, 1097, 1098, 1099, 1101, 1102, 1104, 1105, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1123, 1124, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1137, 1139, 1140, 1142, 1143, 1145, 1146, 1147, 1148, 1149, 1151, 1152, 1156, 1157, 1158, 1159, 1162, 1165, 1167, 1169, 1170, 1173, 1174, 1175, 1177, 1179, 1180, 1181, 1182, 1183, 1184, 1185, 1186, 1187, 1188, 1192, 1193, 1194, 1196, 1197, 1198, 1199, 1200, 1202, 1203, 1204, 1205, 1206, 1207, 1210, 1213, 1214, 1215, 1217, 1218, 1220, 1221, 1222, 1226, 1230, 1231, 1232, 1233, 1235, 1236, 1237, 1238, 1239, 1240, 1241, 1242, 1243, 1244, 1245, 1248, 1249, 1250, 1252, 1253, 1254, 1255, 1256, 1257, 1258, 1259, 1260, 1261, 1262, 1264, 1265, 1266, 1267, 1268, 1269, 1270, 1271, 1272, 1273, 1274, 1276, 1278, 1279, 1281, 1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289, 1290, 1291, 1292, 1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1304, 1305, 1308, 1309, 1310, 1311, 1312, 1313, 1314, 1318, 1320, 1321, 1322, 1323, 1324, 1325, 1327, 1328, 1329, 1331, 1332, 1333, 1334, 1335, 1336, 1338, 1339, 1340, 1341, 1342, 1345, 1347, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1359, 1360, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1369, 1370, 1371, 1373, 1374, 1375, 1376, 1377, 1378, 1379, 1382, 1384, 1385, 1388, 1389, 1390, 1391, 1392, 1393, 1395, 1396, 1399, 1400, 1401, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1414, 1416, 1417, 1418, 1419, 1421, 1422, 1423, 1425, 1426, 1427, 1428, 1429, 1430, 1433, 1434, 1436, 1437, 1438, 1439, 1441, 1442, 1444, 1446, 1447, 1448, 1449, 1450, 1453, 1454, 1455, 1457, 1458, 1459, 1460, 1461, 1462, 1464, 1466, 1467, 1469, 1470, 1471, 1472, 1473, 1475, 1476, 1477, 1478, 1479, 1482, 1484, 1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1503, 1504, 1505, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1531, 1532, 1533, 1534, 1535, 1537, 1538, 1540, 1542, 1543, 1544, 1545, 1546, 1547, 1549, 1550, 1551, 1552, 1554, 1555, 1556, 1557, 1558, 1560, 1561, 1566, 1568, 1573, 1574, 1575, 1576, 1578, 1579, 1580, 1581, 1582, 1583, 1585, 1586, 1587, 1588, 1589, 1590, 1592, 1593, 1594, 1596, 1597, 1598, 1599, 1600, 1601, 1605, 1606, 1607, 1608, 1612, 1613, 1614, 1616, 1617, 1618, 1619, 1621, 1625, 1626, 1627, 1629, 1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1639, 1642, 1643, 1644, 1645, 1646, 1648, 1650, 1652, 1654, 1655, 1656, 1658, 1659, 1660, 1661, 1662, 1663, 1666, 1667, 1668, 1671, 1674, 1675, 1678, 1679, 1680, 1681, 1683, 1685, 1686, 1687, 1688, 1689, 1690, 1692, 1693, 1694, 1695, 1697, 1699, 1700, 1701, 1703, 1704, 1705, 1706, 1707, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747, 1748, 1749, 1750, 1751, 1752, 1753, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762, 1763, 1765, 1766, 1767, 1770, 1771, 1775, 1776, 1778, 1779, 1780, 1781, 1782, 1783, 1784, 1785, 1786, 1787, 1788, 1789, 1790, 1791, 1792, 1793, 1794, 1796, 1797, 1799, 1800, 1802, 1803, 1805, 1807, 1808, 1809, 1811, 1812, 1816, 1817, 1818, 1819, 1820, 1822, 1823, 1825, 1828, 1829, 1830, 1831, 1834, 1835, 1837, 1839, 1841, 1842, 1843, 1844, 1845, 1847, 1848, 1849, 1851, 1852, 1854, 1855, 1856, 1858, 1859, 1860, 1861, 1862, 1863, 1864, 1865, 1866, 1867, 1868, 1870, 1872, 1873, 1875, 1876, 1877, 1878, 1879, 1880, 1881, 1882, 1883, 1884, 1886, 1888, 1889, 1891, 1893, 1894, 1895, 1896, 1897, 1898, 1899, 1901, 1902, 1903, 1904, 1905, 1906, 1907, 1908, 1909, 1911, 1912, 1913, 1914, 1915, 1916, 1919, 1920, 1921, 1922, 1924, 1925, 1926, 1927, 1928, 1929, 1933, 1934, 1935, 1936, 1937, 1939, 1940, 1942, 1943, 1944, 1945, 1947, 1948, 1949, 1950, 1951, 1952, 1953, 1954, 1955, 1959, 1960, 1961, 1962, 1964, 1966, 1967, 1969, 1971, 1972, 1973, 1974, 1975, 1978, 1979, 1980, 1981, 1982, 1983, 1984, 1985, 1987, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2019, 2020, 2021, 2023, 2024, 2026, 2027, 2028, 2030, 2031, 2033, 2034, 2035, 2036, 2037, 2038, 2039, 2040, 2043, 2044, 2045, 2047, 2048, 2049, 2050, 2051, 2052, 2053, 2054, 2055, 2056, 2058, 2059, 2060, 2061, 2062, 2065, 2068, 2069, 2072, 2073, 2074, 2076, 2077, 2078, 2079, 2080, 2082, 2083, 2084, 2085, 2086, 2087, 2088, 2089, 2090, 2092, 2093, 2094, 2095, 2096, 2097, 2098, 2099, 2100, 2101, 2103, 2104, 2106, 2107, 2108, 2109, 2110, 2114, 2115, 2116, 2117, 2118, 2119, 2121, 2122, 2123, 2124, 2125, 2126, 2127, 2128, 2129, 2130, 2131, 2134, 2135, 2136, 2137, 2138, 2140, 2141, 2143, 2144, 2145, 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, 2160, 2161, 2162, 2163, 2164, 2165, 2168, 2172, 2173, 2174, 2176, 2177, 2178, 2179, 2180, 2181, 2182, 2183, 2184, 2186, 2188, 2189, 2190, 2191, 2192, 2193, 2194, 2195, 2196, 2197, 2199, 2200, 2201, 2204, 2206, 2207, 2208, 2210, 2211, 2212, 2213, 2214, 2215, 2216, 2218, 2219, 2221, 2222, 2223, 2225, 2228, 2229, 2232, 2235, 2236, 2237, 2239, 2240, 2241, 2242, 2243, 2244, 2245, 2250, 2251, 2253, 2255, 2258, 2259, 2260, 2263, 2265, 2266, 2267, 2268, 2269, 2270, 2271, 2272, 2273, 2274, 2276, 2277, 2279, 2280, 2281, 2282, 2283, 2284, 2286, 2287, 2288, 2290, 2291, 2292, 2293, 2294, 2295, 2297, 2298, 2299, 2301, 2302, 2303, 2304, 2305, 2306, 2307, 2308, 2309, 2310, 2312, 2313, 2315, 2316, 2318, 2319, 2321, 2322, 2323, 2324, 2325, 2326, 2327, 2328, 2330, 2331, 2333, 2335, 2336, 2338, 2339, 2340, 2341, 2342, 2343, 2344, 2346, 2347, 2348, 2349, 2350, 2351, 2353, 2355, 2356, 2357, 2358, 2359, 2361, 2362, 2363, 2364, 2365, 2366, 2368, 2369, 2370, 2371, 2372, 2373, 2374, 2375, 2377, 2379, 2380, 2381, 2382, 2383, 2384, 2386, 2387, 2389, 2393, 2394, 2395, 2396, 2397, 2398, 2400, 2401, 2402, 2403, 2404, 2405, 2406, 2407, 2408, 2409, 2410, 2411, 2412, 2413, 2414, 2415, 2416, 2418, 2419, 2420, 2421, 2422, 2423, 2424, 2426, 2427, 2428, 2430, 2431, 2432, 2433, 2434, 2435, 2436, 2437, 2438, 2440, 2441, 2442, 2444, 2445, 2446, 2447, 2449, 2450, 2451, 2452, 2453, 2455, 2457, 2458, 2459, 2460, 2461, 2462, 2463, 2464, 2465, 2466, 2467, 2468, 2469, 2470, 2471, 2473, 2474, 2475, 2478, 2480, 2481, 2482, 2483, 2484, 2486, 2487, 2488, 2489, 2492, 2493, 2494, 2495, 2496, 2499, 2500, 2501, 2502, 2504, 2505, 2506, 2507, 2508, 2510, 2511, 2512, 2514, 2516, 2518, 2519, 2520, 2521, 2523, 2525, 2526, 2527, 2528, 2529, 2531, 2532, 2533, 2534, 2535, 2536, 2537, 2538, 2539, 2540, 2542, 2543, 2544, 2545, 2547, 2548, 2549, 2550, 2551, 2552, 2553, 2554, 2555, 2556, 2557, 2558, 2561, 2562, 2563, 2565, 2566, 2567, 2569, 2570, 2572, 2573, 2574, 2575, 2576, 2577, 2580, 2581, 2582, 2583, 2584, 2586, 2587, 2588, 2592, 2593, 2594, 2595, 2596, 2597, 2599, 2601, 2602, 2603, 2604, 2605, 2606, 2607, 2608, 2609, 2612, 2613, 2615, 2616, 2617, 2618, 2619, 2621, 2622, 2623, 2624, 2625, 2626, 2627, 2628, 2630, 2631, 2632, 2633, 2634, 2635, 2636, 2638, 2639, 2640, 2641, 2642, 2643, 2644, 2645, 2646, 2649, 2651, 2652, 2653, 2654, 2656, 2657, 2658, 2659, 2660, 2661, 2662, 2665, 2666, 2667, 2668, 2669, 2670, 2671, 2672, 2673, 2674, 2675, 2676, 2677, 2678, 2679, 2680, 2681, 2682, 2684, 2685, 2686, 2687, 2688, 2689, 2691, 2692, 2693, 2694, 2696, 2697, 2698, 2701, 2702, 2703, 2704, 2706, 2707, 2708, 2709, 2710, 2711, 2712, 2713, 2714, 2715, 2716, 2717, 2718, 2719, 2720, 2721, 2722, 2723, 2724, 2725, 2726, 2727, 2730, 2731, 2733, 2734, 2735, 2736, 2737, 2738, 2739, 2740, 2741, 2742, 2743, 2744, 2747, 2749, 2751, 2752, 2754, 2755, 2757, 2759, 2760, 2761, 2763, 2764, 2765, 2767, 2768, 2769, 2770, 2771, 2772, 2773, 2774, 2775, 2776, 2777, 2779, 2781, 2782, 2784, 2785, 2786, 2787, 2788, 2789, 2790, 2791, 2792, 2793, 2794, 2795, 2796, 2797, 2798, 2799, 2800, 2802, 2803, 2804, 2806, 2808, 2809, 2810, 2811, 2812, 2813, 2814, 2815, 2816, 2817, 2818, 2819, 2820, 2821, 2822, 2823, 2824, 2825, 2826, 2827, 2828, 2829, 2830, 2831, 2832, 2833, 2834, 2835, 2836, 2837, 2838, 2839, 2841, 2842, 2843, 2847, 2849, 2850, 2851, 2852, 2854, 2856, 2859, 2860, 2862, 2863, 2864, 2865, 2866, 2868, 2869, 2870, 2871, 2872, 2873, 2874, 2875, 2879, 2880, 2882, 2883, 2884, 2885, 2886, 2888, 2890, 2891, 2892, 2893, 2894, 2896, 2897, 2899, 2900, 2904, 2906, 2907, 2908, 2910, 2912, 2913, 2919, 2920, 2921, 2925, 2926, 2927, 2928, 2929, 2930, 2931, 2933, 2935, 2936, 2938, 2939, 2941, 2943, 2946, 2947, 2948, 2950, 2951, 2952, 2953, 2954, 2955, 2956, 2957, 2958, 2959, 2960, 2961, 2962, 2965, 2966, 2967, 2968, 2969, 2970, 2971, 2972, 2973, 2974, 2977, 2979, 2980, 2981, 2982, 2983, 2984, 2985, 2988, 2990, 2991, 2992, 2993, 2995, 2996, 2998, 2999, 3002, 3003, 3004, 3006, 3007, 3008, 3009, 3010, 3011, 3013, 3014, 3015, 3016, 3017, 3018, 3021, 3022, 3023, 3024, 3025, 3027, 3028, 3029, 3030, 3031, 3032, 3033, 3034, 3035, 3036, 3037, 3038, 3041, 3042, 3046, 3047, 3048, 3049, 3050, 3051, 3052, 3053, 3055, 3056, 3057, 3059, 3060, 3061, 3062, 3063, 3064, 3065, 3066, 3067, 3068, 3069, 3070, 3072, 3073, 3077, 3078, 3079, 3080, 3081, 3082, 3083, 3084, 3086, 3087, 3088, 3090, 3091, 3092, 3095, 3096, 3097, 3098, 3099, 3100, 3101, 3102, 3104, 3105, 3107, 3108, 3109, 3110, 3111, 3114, 3115, 3116, 3118, 3119, 3121, 3122, 3123, 3124, 3126, 3127, 3128, 3129, 3130, 3131, 3132, 3133, 3135, 3136, 3137, 3138, 3139, 3140, 3141, 3142, 3143, 3144, 3145, 3146, 3148, 3151, 3152, 3153, 3155, 3156, 3157, 3159, 3160, 3162, 3163, 3164, 3165, 3166, 3167, 3168, 3169, 3171, 3172, 3174, 3175, 3176, 3178, 3179, 3180, 3182, 3183, 3184, 3186, 3188, 3190, 3191, 3192, 3193, 3194, 3196, 3197, 3198, 3199, 3200, 3202, 3203, 3204, 3206, 3207, 3208, 3209, 3210, 3211, 3212, 3213, 3214, 3215, 3217, 3218, 3220, 3221, 3223, 3224, 3225, 3226, 3227, 3228, 3229, 3230, 3232, 3234, 3235, 3236, 3238, 3239, 3240, 3242, 3243, 3244, 3246, 3247, 3249, 3251, 3254, 3255, 3256, 3257, 3260, 3261, 3262, 3263, 3264, 3265, 3267, 3268, 3269, 3270, 3271, 3273, 3274, 3276, 3277, 3278, 3279, 3280, 3281, 3284, 3286, 3287, 3288, 3290, 3291, 3294, 3295, 3296, 3297, 3298, 3300, 3301, 3302, 3303, 3305, 3307, 3308, 3309, 3310, 3311, 3313, 3314, 3315, 3317, 3318, 3319, 3320, 3323, 3324, 3325, 3326, 3327, 3329, 3331, 3332, 3333, 3334, 3335, 3336, 3338, 3341, 3342, 3343, 3344, 3345, 3346, 3347, 3348, 3349, 3351, 3352, 3353, 3354, 3355, 3356, 3357, 3358, 3359, 3360, 3362, 3363, 3364, 3365, 3366, 3367, 3369, 3370, 3371, 3372, 3373, 3374, 3375, 3376, 3377, 3378, 3379, 3380, 3381, 3382, 3384, 3385, 3386, 3387, 3389, 3390, 3392, 3393, 3394, 3395, 3396, 3397, 3398, 3399, 3402, 3403, 3404, 3405, 3407, 3408, 3409, 3410, 3411, 3412, 3413, 3414, 3415, 3416, 3417, 3418, 3419, 3420, 3421, 3423, 3424, 3425, 3426, 3427, 3428, 3429, 3431, 3432, 3433, 3437, 3438, 3439, 3441, 3442, 3443, 3445, 3446, 3447, 3449, 3450, 3451, 3452, 3454, 3455, 3456, 3457, 3458, 3459, 3463, 3465, 3468, 3469, 3470, 3471, 3472, 3473, 3474, 3475, 3476, 3478, 3479, 3480, 3481, 3483, 3484, 3485, 3487, 3488, 3489, 3490, 3491, 3494, 3496, 3497, 3498, 3500, 3501, 3502, 3505, 3506, 3507, 3508, 3509, 3512, 3515, 3516, 3517, 3518, 3519, 3520, 3522, 3525, 3526, 3527, 3528, 3530, 3531, 3532, 3533, 3536, 3537, 3538, 3539, 3540, 3542, 3543, 3544, 3545, 3546, 3548, 3549, 3550, 3554, 3555, 3556, 3558, 3559, 3560, 3561, 3562, 3563, 3564, 3565, 3566, 3567, 3568, 3571, 3572, 3573, 3574, 3576, 3577, 3578, 3579, 3580, 3581, 3584, 3585, 3586, 3588, 3590, 3591, 3592, 3593, 3594, 3595, 3596, 3597, 3598, 3599, 3601, 3603, 3604, 3605, 3607, 3608, 3609, 3612, 3614, 3617, 3618, 3619, 3620, 3621, 3622, 3623, 3624, 3629, 3630, 3632, 3633, 3635, 3636, 3637, 3639, 3640, 3641, 3642, 3643, 3644, 3646, 3647, 3648, 3650, 3652, 3653, 3655, 3656, 3657, 3658, 3660, 3661, 3662, 3663, 3664, 3665, 3666, 3667, 3669, 3670, 3671, 3672, 3673, 3675, 3677, 3680, 3681, 3683, 3684, 3685, 3687, 3688, 3689, 3690, 3691, 3693, 3694, 3695, 3696, 3698, 3700, 3703, 3704, 3705, 3706, 3707, 3708, 3709, 3712, 3713, 3715, 3717, 3718, 3719, 3721, 3722, 3723, 3726, 3727, 3729, 3730, 3731, 3732, 3734, 3735, 3736, 3738, 3739, 3740, 3741, 3742, 3743, 3744, 3745, 3746, 3747, 3748, 3749, 3750, 3751, 3752, 3753, 3754, 3755, 3758, 3759, 3760, 3762, 3763, 3764, 3765, 3767, 3774, 3775, 3777, 3778, 3779, 3780, 3781, 3782, 3783, 3784, 3786, 3787, 3788, 3789, 3792, 3794, 3795, 3797, 3798, 3799, 3801, 3803, 3805, 3806, 3808, 3809, 3810, 3811, 3813, 3814, 3815, 3817, 3821, 3822, 3823, 3824, 3825, 3826, 3827, 3828, 3829, 3830, 3831, 3832, 3833, 3834, 3837, 3838, 3839, 3840, 3841, 3846, 3849, 3850, 3851, 3854, 3856, 3857, 3859, 3860, 3865, 3867, 3868, 3869, 3870, 3872, 3874, 3877, 3878, 3879, 3880, 3881, 3883, 3885, 3887, 3889, 3890, 3891, 3892, 3894, 3895, 3896, 3897, 3899, 3902, 3903, 3904, 3905, 3906, 3907, 3908, 3909, 3910, 3911, 3912, 3913, 3914, 3915, 3916, 3917, 3918, 3919, 3920, 3921, 3922, 3923, 3924, 3925, 3926, 3927, 3928, 3929, 3930, 3931, 3933, 3934, 3935, 3936, 3937, 3939, 3940, 3941, 3942, 3943, 3944, 3945, 3946, 3947, 3948, 3949, 3950, 3952, 3955, 3956, 3957, 3959, 3960, 3961, 3962, 3963, 3964, 3967, 3968, 3969, 3970, 3971, 3972, 3973, 3974, 3975, 3976, 3978, 3980, 3981, 3982, 3983, 3984, 3985, 3986, 3987, 3989, 3991, 3992, 3993, 3994, 3996, 4000, 4001, 4002, 4003, 4004, 4005, 4006, 4007, 4008, 4009, 4010, 4011, 4012, 4014, 4015, 4016, 4017, 4019, 4020, 4021, 4023, 4024, 4025, 4027, 4028, 4029, 4030, 4032, 4033, 4034, 4035, 4037, 4038, 4039, 4040, 4041, 4043, 4044, 4045, 4047, 4048, 4050, 4051, 4053, 4054, 4055, 4056, 4057, 4058, 4059, 4061, 4062, 4063, 4064, 4065, 4066, 4067, 4069, 4070, 4071, 4072, 4073, 4074, 4075, 4077, 4079, 4080, 4081, 4082, 4086, 4088, 4089, 4090, 4092, 4093, 4095, 4096, 4097, 4098, 4099, 4100, 4103, 4104, 4105, 4107, 4109, 4110, 4113, 4115, 4116, 4117, 4118, 4120, 4121, 4122, 4123, 4124, 4125, 4126, 4128, 4131, 4132, 4135, 4138, 4141, 4143, 4144, 4145, 4146, 4147, 4148, 4149, 4150, 4152, 4154, 4156, 4157, 4158, 4159, 4160, 4161, 4162, 4163, 4167, 4168, 4170, 4171, 4173, 4174, 4180, 4181, 4183, 4184, 4185, 4187, 4189, 4190, 4191, 4193, 4194, 4195, 4199, 4200, 4201, 4202, 4203, 4204, 4205, 4208, 4209, 4211, 4213, 4214, 4215, 4216, 4217, 4222, 4224, 4225, 4226, 4227, 4228, 4230, 4231, 4232, 4233, 4235, 4236, 4238, 4241, 4244, 4247, 4249, 4250, 4251, 4252, 4254, 4255, 4258, 4261, 4263, 4264, 4266, 4267, 4269, 4270, 4271, 4274, 4276, 4277, 4278, 4279, 4280, 4281, 4282, 4283, 4285, 4286, 4288, 4289, 4290, 4291, 4292, 4293, 4294, 4295, 4296, 4298, 4299, 4300, 4302, 4303, 4305, 4306, 4307, 4308, 4309, 4310, 4311, 4314, 4316, 4317, 4318, 4319, 4320, 4321, 4322, 4323, 4324, 4328, 4329, 4330, 4331, 4332, 4334, 4335, 4336, 4337, 4338, 4340, 4341, 4342, 4344, 4345, 4346, 4347, 4350, 4351, 4353, 4354, 4356, 4357, 4359, 4360, 4361, 4362, 4363, 4364, 4365, 4366, 4367, 4368, 4369, 4370, 4372, 4373, 4378, 4379, 4380, 4381, 4382, 4383, 4385, 4387, 4388, 4389, 4390, 4391 ], "glycation_sites": [], "phosphorylation_sites": [ 472, 477, 478, 2843 ], "sequon_annotation_sites": [ { "start_pos": 1755, "end_pos": 1757 }, { "start_pos": 2121, "end_pos": 2123 }, { "start_pos": 3072, "end_pos": 3074 }, { "start_pos": 3105, "end_pos": 3107 }, { "start_pos": 3279, "end_pos": 3281 }, { "start_pos": 3780, "end_pos": 3782 }, { "start_pos": 3836, "end_pos": 3838 }, { "start_pos": 4068, "end_pos": 4070 }, { "start_pos": 554, "end_pos": 556 }, { "start_pos": 89, "end_pos": 91 } ] }, "class_list": [ "glycogene" ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 436 }, { "field": "total_sites", "count": 90 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 79 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycan_sites", "count": 71 }, { "field": "n_linked_glycans", "count": 172 }, { "field": "o_linked_glycans", "count": 12 }, { "field": "exact_sites", "count": 90 }, { "field": "exact_o_linked_sites", "count": 79 }, { "field": "exact_o_linked_glycan_sites", "count": 71 }, { "field": "exact_o_linked_glycans", "count": 12 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "exact_n_linked_glycan_sites", "count": 8 }, { "field": "exact_n_linked_glycans", "count": 172 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 }, { "field": "n_linked_sites", "count": 9 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 13 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 9 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 415 }, { "field": "total_sites", "count": 79 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 71 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycan_sites", "count": 71 }, { "field": "n_linked_glycans", "count": 172 }, { "field": "o_linked_glycans", "count": 12 }, { "field": "exact_sites", "count": 79 }, { "field": "exact_o_linked_sites", "count": 71 }, { "field": "exact_o_linked_glycan_sites", "count": 71 }, { "field": "exact_o_linked_glycans", "count": 12 }, { "field": "exact_n_linked_sites", "count": 8 }, { "field": "exact_n_linked_glycan_sites", "count": 8 }, { "field": "exact_n_linked_glycans", "count": 172 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_o_linked_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5851 }, { "field": "total_sites", "count": 3356 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1529 }, { "field": "total_sites", "count": 1296 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4322 }, { "field": "total_sites", "count": 2842 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 635 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ], "tool_support": { "graph_view": "yes" } } ]