[ { "uniprot_canonical_ac": "P0C6U8-1", "uniprot_ac": "P0C6U8", "uniprot_id": "R1A_SARS", "mass": { "chemical_mass": 486373.0, "monoisotopic_mass": 486373.0 }, "refseq": {}, "gene_names": [ { "name": "1a", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ] } ], "protein_names": [ { "name": "Replicase polyprotein 1a", "type": "recommended", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "2.7.7.50", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "GFL", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Growth factor-like peptide", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Leader protein", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Main protease", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Mpro", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 1", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 3", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 5", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 9", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "ORF1a polyprotein", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "PL2-PRO", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "SARS coronavirus main proteinase", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "nsp1", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "nsp3", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "nsp5", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "nsp9", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "p65 homolog", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] }, { "name": "pp1a", "type": "synonym", "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Catalytic subunit of viral RNA capping enzyme which catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs. The kinase-like NiRAN domain of NSP12 transfers RNA to the amino terminus of NSP9, forming a covalent RNA-protein intermediate. Subsequently, the NiRAN domain transfers RNA to GDP, forming the core cap structure GpppA-RNA. The NSP14 and NSP16 methyltransferases then add methyl groups to form functional cap structures.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "UniProtKB", "id": "P0DTC1", "url": "https://www.uniprot.org/uniprotkb/P0DTC1#function" }, { "database": "PubMed", "id": "19153232", "url": "https://glygen.org/publication/PubMed/19153232" } ] }, { "annotation": "Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. Also able to bind an ADP-ribose-1''-phosphate (ADRP). May cleave host ATP6V1G1 thereby modifying host vacuoles intracellular pH.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "16226257", "url": "https://glygen.org/publication/PubMed/16226257" }, { "database": "UniProtKB", "id": "PRU00772", "url": "https://www.uniprot.org/uniprotkb/PRU00772#function" } ] }, { "annotation": "Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "annotation": "Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "annotation": "Inhibits host translation by interacting with the 40S ribosomal subunit. The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation. Viral mRNAs are not susceptible to nsp1-mediated endonucleolytic RNA cleavage thanks to the presence of a 5'-end leader sequence and are therefore protected from degradation. By suppressing host gene expression, nsp1 facilitates efficient viral gene expression in infected cells and evasion from host immune response (PubMed:23035226). May disrupt nuclear pore function by binding and displacing host NUP93 (PubMed:30943371).", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "23035226", "url": "https://glygen.org/publication/PubMed/23035226" }, { "database": "PubMed", "id": "30943371", "url": "https://glygen.org/publication/PubMed/30943371" } ] }, { "annotation": "May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2 (PubMed:19640993). Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses (PubMed:19640993).", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "19640993", "url": "https://glygen.org/publication/PubMed/19640993" } ] }, { "annotation": "Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" } ] }, { "annotation": "Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "22635272", "url": "https://glygen.org/publication/PubMed/22635272" } ] }, { "annotation": "Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763, PubMed:24410069). Alone appears incapable to induce membrane curvature, but together with nsp3 is able to induce paired membranes (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:23943763, PubMed:24410069).", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" }, { "database": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" }, { "database": "PubMed", "id": "24991833", "url": "https://glygen.org/publication/PubMed/24991833" } ] }, { "annotation": "Responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed:17692280). Contains an ADP-ribose hydrolase activity that binds ADP-ribose and catalyzes the removal of mono-ADP-ribose (de-MARylation), usually bound to a glutamate or aspartate (By similarity). ADP-ribose hydrolase activity allows the virus to interfere with the host immune defenses involving poly-ADP-ribose polymerases (PARPs) (Probable). Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:23943763, PubMed:24410069). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed:19369340, PubMed:24622840). Also prevents host NF-kappa-B signaling (PubMed:19369340, PubMed:24622840).", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "database": "PubMed", "id": "17692280", "url": "https://glygen.org/publication/PubMed/17692280" }, { "database": "UniProtKB", "id": "P0DTC1", "url": "https://www.uniprot.org/uniprotkb/P0DTC1#function" }, { "database": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" }, { "database": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" }, { "database": "PubMed", "id": "24622840", "url": "https://glygen.org/publication/PubMed/24622840" }, { "database": "PubMed", "id": "19369340", "url": "https://glygen.org/publication/PubMed/19369340" }, { "database": "PubMed", "id": "16271890", "url": "https://glygen.org/publication/PubMed/16271890" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P0C6U8", "locus": {} } ], "crossref": [ { "id": "CHEMBL3927", "url": "https://www.ebi.ac.uk/chembl/target/inspect/CHEMBL3927", "database": "ChEMBL", "categories": [ "Chemical" ] }, { "id": "1Q2W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Q2W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1QZ8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1QZ8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UJ1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UJ1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UW7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UW7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1WOF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1WOF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1YSY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1YSY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1Z1I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Z1I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1Z1J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Z1J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5A", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5A&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ACF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ACF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AHM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AHM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ALV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ALV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AMD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AMD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AMQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AMQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BX3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BX3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BX4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BX4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2C3S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2C3S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2D2D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2D2D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2DUC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2DUC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FAV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FAV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FE8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FE8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FYG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FYG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2G9T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2G9T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GA6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GA6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GDT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GDT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GRI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GRI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GT7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GT7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GT8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GT8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GTB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GTB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GX4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GX4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2H2Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2H2Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2HOB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2HOB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2HSX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2HSX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2IDY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2IDY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KAF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KAF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KQV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KQV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KQW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KQW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KYS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KYS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2LIZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2LIZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OP9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OP9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2PWX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2PWX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2W2G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2W2G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2WCT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2WCT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ZU4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ZU4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ZU5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ZU5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3ATW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3ATW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AVZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AVZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AW0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AW0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AW1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AW1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3E91", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3E91&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EA7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EA7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EA8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EA8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EA9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EA9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EAJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EAJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EE7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EE7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3F9E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3F9E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3F9F", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3F9F&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3F9G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3F9G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3F9H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3F9H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3FZD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3FZD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3IWM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3IWM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3M3S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3M3S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3M3T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3M3T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3M3V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3M3V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3MJ5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3MJ5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3R24", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3R24&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SN8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SN8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SNA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SNA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SNB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SNB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SNC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SNC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SND", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SND&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SNE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SNE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SZN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SZN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3TIT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3TIT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3TIU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3TIU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3TNS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3TNS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3TNT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3TNT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3V3M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3V3M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3VB3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3VB3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3VB4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3VB4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3VB5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3VB5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3VB6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3VB6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3VB7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3VB7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4HI3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4HI3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4M0W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4M0W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4MDS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4MDS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4MM3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4MM3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4OVZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4OVZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4OW0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4OW0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5F22", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5F22&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y3E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y3E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y3Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y3Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LNY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LNY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LO0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LO0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NUR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NUR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NUS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NUS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6W2A", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6W2A&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6XHL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6XHL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6XHN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6XHN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6XHO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6XHO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6Y7M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6Y7M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6YXJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6YXJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7DQZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7DQZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7END", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7END&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7EO8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7EO8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7FA1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7FA1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7FAC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7FAC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K0G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K0G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K0H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K0H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LFU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LFU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LFV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LFV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LMG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LMG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LMH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LMH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LMI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LMI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LMJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LMJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7OPL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7OPL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7RC1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7RC1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7VLO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7VLO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7WQI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7WQI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XAX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XAX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7YGQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7YGQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7ZQW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7ZQW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HUS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HUS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IG5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IG5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8UFL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8UFL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8ULD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8ULD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y4E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y4E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9CEH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9CEH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P0C6U8", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0C6U8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002589", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002589", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008740", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008740", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014822", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014822", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014828", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014828", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022733", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022733", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024375", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024375", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032505", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032505", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032592", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032592", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036333", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036333", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036499", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036499", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037204", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037204", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037230", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037230", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038166", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038166", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042570", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042570", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043177", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043177", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043472", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043472", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043477", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043477", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043478", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043503", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043503", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043610", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043610", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043612", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043612", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043615", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043615", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044371", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044371", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044389", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044389", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044864", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044864", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046442", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046442", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046443", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046443", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047573", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047573", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR049894", "url": "https://www.ebi.ac.uk/interpro/entry/IPR049894", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001q2w", "url": "https://www.rcsb.org/structure/pdb_00001q2w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001qz8", "url": "https://www.rcsb.org/structure/pdb_00001qz8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uj1", "url": "https://www.rcsb.org/structure/pdb_00001uj1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk2", "url": "https://www.rcsb.org/structure/pdb_00001uk2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk3", "url": "https://www.rcsb.org/structure/pdb_00001uk3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk4", "url": "https://www.rcsb.org/structure/pdb_00001uk4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uw7", "url": "https://www.rcsb.org/structure/pdb_00001uw7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001wof", "url": "https://www.rcsb.org/structure/pdb_00001wof", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001ysy", "url": "https://www.rcsb.org/structure/pdb_00001ysy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001z1i", "url": "https://www.rcsb.org/structure/pdb_00001z1i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001z1j", "url": "https://www.rcsb.org/structure/pdb_00001z1j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5a", "url": "https://www.rcsb.org/structure/pdb_00002a5a", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5i", "url": "https://www.rcsb.org/structure/pdb_00002a5i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5k", "url": "https://www.rcsb.org/structure/pdb_00002a5k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002acf", "url": "https://www.rcsb.org/structure/pdb_00002acf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ahm", "url": "https://www.rcsb.org/structure/pdb_00002ahm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002alv", "url": "https://www.rcsb.org/structure/pdb_00002alv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002amd", "url": "https://www.rcsb.org/structure/pdb_00002amd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002amq", "url": "https://www.rcsb.org/structure/pdb_00002amq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002bx3", "url": "https://www.rcsb.org/structure/pdb_00002bx3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002bx4", "url": "https://www.rcsb.org/structure/pdb_00002bx4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002c3s", "url": "https://www.rcsb.org/structure/pdb_00002c3s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002d2d", "url": "https://www.rcsb.org/structure/pdb_00002d2d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002duc", "url": "https://www.rcsb.org/structure/pdb_00002duc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fav", "url": "https://www.rcsb.org/structure/pdb_00002fav", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fe8", "url": "https://www.rcsb.org/structure/pdb_00002fe8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fyg", "url": "https://www.rcsb.org/structure/pdb_00002fyg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002g9t", "url": "https://www.rcsb.org/structure/pdb_00002g9t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ga6", "url": "https://www.rcsb.org/structure/pdb_00002ga6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gdt", "url": "https://www.rcsb.org/structure/pdb_00002gdt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gri", "url": "https://www.rcsb.org/structure/pdb_00002gri", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gt7", "url": "https://www.rcsb.org/structure/pdb_00002gt7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gt8", "url": "https://www.rcsb.org/structure/pdb_00002gt8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gtb", "url": "https://www.rcsb.org/structure/pdb_00002gtb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gx4", "url": "https://www.rcsb.org/structure/pdb_00002gx4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz7", "url": "https://www.rcsb.org/structure/pdb_00002gz7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz8", "url": "https://www.rcsb.org/structure/pdb_00002gz8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz9", "url": "https://www.rcsb.org/structure/pdb_00002gz9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002h2z", "url": "https://www.rcsb.org/structure/pdb_00002h2z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002hob", "url": "https://www.rcsb.org/structure/pdb_00002hob", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002hsx", "url": "https://www.rcsb.org/structure/pdb_00002hsx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002idy", "url": "https://www.rcsb.org/structure/pdb_00002idy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kaf", "url": "https://www.rcsb.org/structure/pdb_00002kaf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kqv", "url": "https://www.rcsb.org/structure/pdb_00002kqv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kqw", "url": "https://www.rcsb.org/structure/pdb_00002kqw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kys", "url": "https://www.rcsb.org/structure/pdb_00002kys", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002liz", "url": "https://www.rcsb.org/structure/pdb_00002liz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002op9", "url": "https://www.rcsb.org/structure/pdb_00002op9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002pwx", "url": "https://www.rcsb.org/structure/pdb_00002pwx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002w2g", "url": "https://www.rcsb.org/structure/pdb_00002w2g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002wct", "url": "https://www.rcsb.org/structure/pdb_00002wct", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3c", "url": "https://www.rcsb.org/structure/pdb_00002z3c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3d", "url": "https://www.rcsb.org/structure/pdb_00002z3d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3e", "url": "https://www.rcsb.org/structure/pdb_00002z3e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002zu4", "url": "https://www.rcsb.org/structure/pdb_00002zu4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002zu5", "url": "https://www.rcsb.org/structure/pdb_00002zu5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003atw", "url": "https://www.rcsb.org/structure/pdb_00003atw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003avz", "url": "https://www.rcsb.org/structure/pdb_00003avz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003aw0", "url": "https://www.rcsb.org/structure/pdb_00003aw0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003aw1", "url": "https://www.rcsb.org/structure/pdb_00003aw1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003e91", "url": "https://www.rcsb.org/structure/pdb_00003e91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ea7", "url": "https://www.rcsb.org/structure/pdb_00003ea7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ea8", "url": "https://www.rcsb.org/structure/pdb_00003ea8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ea9", "url": "https://www.rcsb.org/structure/pdb_00003ea9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003eaj", "url": "https://www.rcsb.org/structure/pdb_00003eaj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ee7", "url": "https://www.rcsb.org/structure/pdb_00003ee7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003f9e", "url": "https://www.rcsb.org/structure/pdb_00003f9e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003f9f", "url": "https://www.rcsb.org/structure/pdb_00003f9f", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003f9g", "url": "https://www.rcsb.org/structure/pdb_00003f9g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003f9h", "url": "https://www.rcsb.org/structure/pdb_00003f9h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003fzd", "url": "https://www.rcsb.org/structure/pdb_00003fzd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003iwm", "url": "https://www.rcsb.org/structure/pdb_00003iwm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003m3s", "url": "https://www.rcsb.org/structure/pdb_00003m3s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003m3t", "url": "https://www.rcsb.org/structure/pdb_00003m3t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003m3v", "url": "https://www.rcsb.org/structure/pdb_00003m3v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003mj5", "url": "https://www.rcsb.org/structure/pdb_00003mj5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003r24", "url": "https://www.rcsb.org/structure/pdb_00003r24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sn8", "url": "https://www.rcsb.org/structure/pdb_00003sn8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sna", "url": "https://www.rcsb.org/structure/pdb_00003sna", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003snb", "url": "https://www.rcsb.org/structure/pdb_00003snb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003snc", "url": "https://www.rcsb.org/structure/pdb_00003snc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003snd", "url": "https://www.rcsb.org/structure/pdb_00003snd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sne", "url": "https://www.rcsb.org/structure/pdb_00003sne", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003szn", "url": "https://www.rcsb.org/structure/pdb_00003szn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003tit", "url": "https://www.rcsb.org/structure/pdb_00003tit", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003tiu", "url": "https://www.rcsb.org/structure/pdb_00003tiu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003tns", "url": "https://www.rcsb.org/structure/pdb_00003tns", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003tnt", "url": "https://www.rcsb.org/structure/pdb_00003tnt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003v3m", "url": "https://www.rcsb.org/structure/pdb_00003v3m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003vb3", "url": "https://www.rcsb.org/structure/pdb_00003vb3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003vb4", "url": "https://www.rcsb.org/structure/pdb_00003vb4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003vb5", "url": "https://www.rcsb.org/structure/pdb_00003vb5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003vb6", "url": "https://www.rcsb.org/structure/pdb_00003vb6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003vb7", "url": "https://www.rcsb.org/structure/pdb_00003vb7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004hi3", "url": "https://www.rcsb.org/structure/pdb_00004hi3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004m0w", "url": "https://www.rcsb.org/structure/pdb_00004m0w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004mds", "url": "https://www.rcsb.org/structure/pdb_00004mds", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004mm3", "url": "https://www.rcsb.org/structure/pdb_00004mm3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ovz", "url": "https://www.rcsb.org/structure/pdb_00004ovz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ow0", "url": "https://www.rcsb.org/structure/pdb_00004ow0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005f22", "url": "https://www.rcsb.org/structure/pdb_00005f22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y3e", "url": "https://www.rcsb.org/structure/pdb_00005y3e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y3q", "url": "https://www.rcsb.org/structure/pdb_00005y3q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lny", "url": "https://www.rcsb.org/structure/pdb_00006lny", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lo0", "url": "https://www.rcsb.org/structure/pdb_00006lo0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nur", "url": "https://www.rcsb.org/structure/pdb_00006nur", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nus", "url": "https://www.rcsb.org/structure/pdb_00006nus", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006w2a", "url": "https://www.rcsb.org/structure/pdb_00006w2a", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006xhl", "url": "https://www.rcsb.org/structure/pdb_00006xhl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006xhn", "url": "https://www.rcsb.org/structure/pdb_00006xhn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006xho", "url": "https://www.rcsb.org/structure/pdb_00006xho", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006y7m", "url": "https://www.rcsb.org/structure/pdb_00006y7m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006yxj", "url": "https://www.rcsb.org/structure/pdb_00006yxj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007dqz", "url": "https://www.rcsb.org/structure/pdb_00007dqz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007end", "url": "https://www.rcsb.org/structure/pdb_00007end", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007eo8", "url": "https://www.rcsb.org/structure/pdb_00007eo8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007fa1", "url": "https://www.rcsb.org/structure/pdb_00007fa1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007fac", "url": "https://www.rcsb.org/structure/pdb_00007fac", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k0g", "url": "https://www.rcsb.org/structure/pdb_00007k0g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k0h", "url": "https://www.rcsb.org/structure/pdb_00007k0h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lfu", "url": "https://www.rcsb.org/structure/pdb_00007lfu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lfv", "url": "https://www.rcsb.org/structure/pdb_00007lfv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lmg", "url": "https://www.rcsb.org/structure/pdb_00007lmg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lmh", "url": "https://www.rcsb.org/structure/pdb_00007lmh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lmi", "url": "https://www.rcsb.org/structure/pdb_00007lmi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lmj", "url": "https://www.rcsb.org/structure/pdb_00007lmj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007opl", "url": "https://www.rcsb.org/structure/pdb_00007opl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007rc1", "url": "https://www.rcsb.org/structure/pdb_00007rc1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007vlo", "url": "https://www.rcsb.org/structure/pdb_00007vlo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007wqi", "url": "https://www.rcsb.org/structure/pdb_00007wqi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xax", "url": "https://www.rcsb.org/structure/pdb_00007xax", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ygq", "url": "https://www.rcsb.org/structure/pdb_00007ygq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007zqw", "url": "https://www.rcsb.org/structure/pdb_00007zqw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hus", "url": "https://www.rcsb.org/structure/pdb_00008hus", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ig5", "url": "https://www.rcsb.org/structure/pdb_00008ig5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ufl", "url": "https://www.rcsb.org/structure/pdb_00008ufl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008uld", "url": "https://www.rcsb.org/structure/pdb_00008uld", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y4e", "url": "https://www.rcsb.org/structure/pdb_00008y4e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ceh", "url": "https://www.rcsb.org/structure/pdb_00009ceh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Q2W", "url": "https://www.rcsb.org/structure/1Q2W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QZ8", "url": "https://www.rcsb.org/structure/1QZ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UJ1", "url": "https://www.rcsb.org/structure/1UJ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK2", "url": "https://www.rcsb.org/structure/1UK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK3", "url": "https://www.rcsb.org/structure/1UK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK4", "url": "https://www.rcsb.org/structure/1UK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UW7", "url": "https://www.rcsb.org/structure/1UW7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WOF", "url": "https://www.rcsb.org/structure/1WOF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YSY", "url": "https://www.rcsb.org/structure/1YSY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z1I", "url": "https://www.rcsb.org/structure/1Z1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z1J", "url": "https://www.rcsb.org/structure/1Z1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5A", "url": "https://www.rcsb.org/structure/2A5A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5I", "url": "https://www.rcsb.org/structure/2A5I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5K", "url": "https://www.rcsb.org/structure/2A5K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ACF", "url": "https://www.rcsb.org/structure/2ACF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AHM", "url": "https://www.rcsb.org/structure/2AHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ALV", "url": "https://www.rcsb.org/structure/2ALV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AMD", "url": "https://www.rcsb.org/structure/2AMD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AMQ", "url": "https://www.rcsb.org/structure/2AMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BX3", "url": "https://www.rcsb.org/structure/2BX3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BX4", "url": "https://www.rcsb.org/structure/2BX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2C3S", "url": "https://www.rcsb.org/structure/2C3S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2D2D", "url": "https://www.rcsb.org/structure/2D2D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2DUC", "url": "https://www.rcsb.org/structure/2DUC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FAV", "url": "https://www.rcsb.org/structure/2FAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FE8", "url": "https://www.rcsb.org/structure/2FE8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FYG", "url": "https://www.rcsb.org/structure/2FYG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2G9T", "url": "https://www.rcsb.org/structure/2G9T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GA6", "url": "https://www.rcsb.org/structure/2GA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GDT", "url": "https://www.rcsb.org/structure/2GDT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GRI", "url": "https://www.rcsb.org/structure/2GRI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GT7", "url": "https://www.rcsb.org/structure/2GT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GT8", "url": "https://www.rcsb.org/structure/2GT8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GTB", "url": "https://www.rcsb.org/structure/2GTB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GX4", "url": "https://www.rcsb.org/structure/2GX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ7", "url": "https://www.rcsb.org/structure/2GZ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ8", "url": "https://www.rcsb.org/structure/2GZ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ9", "url": "https://www.rcsb.org/structure/2GZ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2H2Z", "url": "https://www.rcsb.org/structure/2H2Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HOB", "url": "https://www.rcsb.org/structure/2HOB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HSX", "url": "https://www.rcsb.org/structure/2HSX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2IDY", "url": "https://www.rcsb.org/structure/2IDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KAF", "url": "https://www.rcsb.org/structure/2KAF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KQV", "url": "https://www.rcsb.org/structure/2KQV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KQW", "url": "https://www.rcsb.org/structure/2KQW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KYS", "url": "https://www.rcsb.org/structure/2KYS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LIZ", "url": "https://www.rcsb.org/structure/2LIZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OP9", "url": "https://www.rcsb.org/structure/2OP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2PWX", "url": "https://www.rcsb.org/structure/2PWX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W2G", "url": "https://www.rcsb.org/structure/2W2G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2WCT", "url": "https://www.rcsb.org/structure/2WCT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3C", "url": "https://www.rcsb.org/structure/2Z3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3D", "url": "https://www.rcsb.org/structure/2Z3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3E", "url": "https://www.rcsb.org/structure/2Z3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZU4", "url": "https://www.rcsb.org/structure/2ZU4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZU5", "url": "https://www.rcsb.org/structure/2ZU5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ATW", "url": "https://www.rcsb.org/structure/3ATW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AVZ", "url": "https://www.rcsb.org/structure/3AVZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AW0", "url": "https://www.rcsb.org/structure/3AW0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AW1", "url": "https://www.rcsb.org/structure/3AW1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3E91", "url": "https://www.rcsb.org/structure/3E91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EA7", "url": "https://www.rcsb.org/structure/3EA7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EA8", "url": "https://www.rcsb.org/structure/3EA8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EA9", "url": "https://www.rcsb.org/structure/3EA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EAJ", "url": "https://www.rcsb.org/structure/3EAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EE7", "url": "https://www.rcsb.org/structure/3EE7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F9E", "url": "https://www.rcsb.org/structure/3F9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F9F", "url": "https://www.rcsb.org/structure/3F9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F9G", "url": "https://www.rcsb.org/structure/3F9G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F9H", "url": "https://www.rcsb.org/structure/3F9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FZD", "url": "https://www.rcsb.org/structure/3FZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IWM", "url": "https://www.rcsb.org/structure/3IWM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3M3S", "url": "https://www.rcsb.org/structure/3M3S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3M3T", "url": "https://www.rcsb.org/structure/3M3T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3M3V", "url": "https://www.rcsb.org/structure/3M3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MJ5", "url": "https://www.rcsb.org/structure/3MJ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3R24", "url": "https://www.rcsb.org/structure/3R24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SN8", "url": "https://www.rcsb.org/structure/3SN8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SNA", "url": "https://www.rcsb.org/structure/3SNA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SNB", "url": "https://www.rcsb.org/structure/3SNB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SNC", "url": "https://www.rcsb.org/structure/3SNC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SND", "url": "https://www.rcsb.org/structure/3SND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SNE", "url": "https://www.rcsb.org/structure/3SNE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SZN", "url": "https://www.rcsb.org/structure/3SZN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TIT", "url": "https://www.rcsb.org/structure/3TIT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TIU", "url": "https://www.rcsb.org/structure/3TIU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TNS", "url": "https://www.rcsb.org/structure/3TNS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TNT", "url": "https://www.rcsb.org/structure/3TNT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V3M", "url": "https://www.rcsb.org/structure/3V3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VB3", "url": "https://www.rcsb.org/structure/3VB3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VB4", "url": "https://www.rcsb.org/structure/3VB4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VB5", "url": "https://www.rcsb.org/structure/3VB5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VB6", "url": "https://www.rcsb.org/structure/3VB6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VB7", "url": "https://www.rcsb.org/structure/3VB7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HI3", "url": "https://www.rcsb.org/structure/4HI3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4M0W", "url": "https://www.rcsb.org/structure/4M0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MDS", "url": "https://www.rcsb.org/structure/4MDS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MM3", "url": "https://www.rcsb.org/structure/4MM3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OVZ", "url": "https://www.rcsb.org/structure/4OVZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OW0", "url": "https://www.rcsb.org/structure/4OW0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5F22", "url": "https://www.rcsb.org/structure/5F22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y3E", "url": "https://www.rcsb.org/structure/5Y3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y3Q", "url": "https://www.rcsb.org/structure/5Y3Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LNY", "url": "https://www.rcsb.org/structure/6LNY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LO0", "url": "https://www.rcsb.org/structure/6LO0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NUR", "url": "https://www.rcsb.org/structure/6NUR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NUS", "url": "https://www.rcsb.org/structure/6NUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6W2A", "url": "https://www.rcsb.org/structure/6W2A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XHL", "url": "https://www.rcsb.org/structure/6XHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XHN", "url": "https://www.rcsb.org/structure/6XHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XHO", "url": "https://www.rcsb.org/structure/6XHO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Y7M", "url": "https://www.rcsb.org/structure/6Y7M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YXJ", "url": "https://www.rcsb.org/structure/6YXJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DQZ", "url": "https://www.rcsb.org/structure/7DQZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7END", "url": "https://www.rcsb.org/structure/7END", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EO8", "url": "https://www.rcsb.org/structure/7EO8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FA1", "url": "https://www.rcsb.org/structure/7FA1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FAC", "url": "https://www.rcsb.org/structure/7FAC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K0G", "url": "https://www.rcsb.org/structure/7K0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K0H", "url": "https://www.rcsb.org/structure/7K0H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LFU", "url": "https://www.rcsb.org/structure/7LFU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LFV", "url": "https://www.rcsb.org/structure/7LFV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMG", "url": "https://www.rcsb.org/structure/7LMG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMH", "url": "https://www.rcsb.org/structure/7LMH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMI", "url": "https://www.rcsb.org/structure/7LMI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMJ", "url": "https://www.rcsb.org/structure/7LMJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OPL", "url": "https://www.rcsb.org/structure/7OPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RC1", "url": "https://www.rcsb.org/structure/7RC1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VLO", "url": "https://www.rcsb.org/structure/7VLO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WQI", "url": "https://www.rcsb.org/structure/7WQI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XAX", "url": "https://www.rcsb.org/structure/7XAX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YGQ", "url": "https://www.rcsb.org/structure/7YGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZQW", "url": "https://www.rcsb.org/structure/7ZQW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HUS", "url": "https://www.rcsb.org/structure/8HUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IG5", "url": "https://www.rcsb.org/structure/8IG5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8UFL", "url": "https://www.rcsb.org/structure/8UFL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8ULD", "url": "https://www.rcsb.org/structure/8ULD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y4E", "url": "https://www.rcsb.org/structure/8Y4E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9CEH", "url": "https://www.rcsb.org/structure/9CEH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01661", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01661", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF05409", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05409", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08710", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08710", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08715", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08715", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08716", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08716", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08717", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08717", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF09401", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF09401", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF11501", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11501", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF11633", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11633", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF12124", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12124", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF12379", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12379", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16251", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16251", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16348", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16348", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19211", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19211", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19213", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19213", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19217", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19217", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19218", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19218", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C6U8-1", "url": "https://www.uniprot.org/uniprotkb/P0C6U8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNGFAV", "length": 4382, "header": "sp|P0C6U8-1|R1A_SARS Isoform 1 of Replicase polyprotein 1a OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P0C6U8-1" }, "isoforms": [ { "isoform_ac": "P0C6U8-1", "url": "https://www.uniprot.org/uniprotkb/P0C6U8/entry#P0C6U8-1", "sequence": { "sequence": "MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNGFAV", "length": 4382, "header": "sp|P0C6U8-1|R1A_SARS Isoform 1 of Replicase polyprotein 1a OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P0C6U8-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 998, "start_aa": "Thr", "end_pos": 998, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr998", "evidence": [ { "id": "GLY_001158", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001158" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus main proteinase (3CLpro) structure: basis for design of anti-SARS drugs.", "journal": "Science", "date": "2003", "authors": "Anand Kanchan, Ziebuhr John, Wadhwani Parvesh, Mesters Jeroen R, Hilgenfeld Rolf", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12746549", "url": "https://glygen.org/publication/PubMed/12746549" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "The Journal of general virology", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Structural genomics of the SARS coronavirus: cloning, expression, crystallization and preliminary crystallographic study of the Nsp9 protein.", "journal": "Acta Crystallogr. D", "date": "2003", "authors": "Campanacci Val\u00e9rie, Egloff Marie-Pierre, Longhi Sonia, Ferron Fran\u00e7ois, Rancurel Corinne, Salomoni Aurelia, Durousseau C\u00e9cile, Tocque Fabienne, Br\u00e9mond Nicolas, Dobbe Jessika C, Snijder Eric J, Canard Bruno, Cambillau Christian", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12925794", "url": "https://glygen.org/publication/PubMed/12925794" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus genotype and its characterization.", "journal": "Chin. Med. J.", "date": "2003", "authors": "Li Lanjuan, Wang Zhigang, Lu Yiyu, Bao Qiyu, Chen Suhong, Wu Nanping, Cheng Suyun, Weng Jingqing, Zhang Yanjun, Yan Juying, Mei Lingling, Wang Xiaomeng, Zhu Hanping, Yu Yingpu, Zhang Minli, Li Minhong, Yao Jun, Lu Qunying, Yao Pingping, Bo Xiaochen, Wo Jianer, Wang Shengqi, Hu Songnian", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "14527350", "url": "https://glygen.org/publication/PubMed/14527350" } ] }, { "title": "Biosynthesis, purification, and substrate specificity of severe acute respiratory syndrome coronavirus 3C-like proteinase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fan K, Wei P, Feng Q, Chen S, Huang C, Ma L, Lai B, Pei J, Liu Y, Chen J, Lai L", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "14561748", "url": "https://glygen.org/publication/PubMed/14561748" } ] }, { "title": "Phylogeny of the SARS coronavirus.", "journal": "Science", "date": "2003", "authors": "Eickmann Markus, Becker Stephan, Klenk Hans-Dieter, Doerr Hans Wilhelm, Stadler Konrad, Censini Stefano, Guidotti Silvia, Masignani Vega, Scarselli Maria, Mora Marirosa, Donati Claudio, Han Jang H, Song Hyun Chul, Abrignani Sergio, Covacci Antonello, Rappuoli Rino", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "14645828", "url": "https://glygen.org/publication/PubMed/14645828" } ] }, { "title": "The nsp9 replicase protein of SARS-coronavirus, structure and functional insights.", "journal": "Structure", "date": "2004", "authors": "Sutton Geoff, Fry Elizabeth, Carter Lester, Sainsbury Sarah, Walter Tom, Nettleship Joanne, Berrow Nick, Owens Ray, Gilbert Robert, Davidson Andrew, Siddell Stuart, Poon Leo L M, Diprose Jonathan, Alderton David, Walsh Martin, Grimes Jonathan M, Stuart David I", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "14962394", "url": "https://glygen.org/publication/PubMed/14962394" } ] }, { "title": "The severe acute respiratory syndrome-coronavirus replicative protein nsp9 is a single-stranded RNA-binding subunit unique in the RNA virus world.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Egloff Marie-Pierre, Ferron Fran\u00e7ois, Campanacci Val\u00e9rie, Longhi Sonia, Rancurel Corinne, Dutartre H\u00e9l\u00e8ne, Snijder Eric J, Gorbalenya Alexander E, Cambillau Christian, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "15007178", "url": "https://glygen.org/publication/PubMed/15007178" } ] }, { "title": "Identification and characterization of severe acute respiratory syndrome coronavirus replicase proteins.", "journal": "Journal of virology", "date": "2004", "authors": "Prentice E, McAuliffe J, Lu X, Subbarao K, Denison MR", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "15331731", "url": "https://glygen.org/publication/PubMed/15331731" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 3C-like proteinase N terminus is indispensable for proteolytic activity but not for enzyme dimerization. Biochemical and thermodynamic investigation in conjunction with molecular dynamics simulations.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Chen Shuai, Chen Lili, Tan Jinzhi, Chen Jing, Du Li, Sun Tao, Shen Jianhua, Chen Kaixian, Jiang Hualiang, Shen Xu", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "15507456", "url": "https://glygen.org/publication/PubMed/15507456" } ] }, { "title": "Identification of severe acute respiratory syndrome coronavirus replicase products and characterization of papain-like protease activity.", "journal": "Journal of virology", "date": "2004", "authors": "Harcourt BH, Jukneliene D, Kanjanahaluethai A, Bechill J, Severson KM, Smith CM, Rota PA, Baker SC", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "15564471", "url": "https://glygen.org/publication/PubMed/15564471" } ] }, { "title": "Binding interaction of SARS coronavirus 3CL(pro) protease with vacuolar-H+ ATPase G1 subunit.", "journal": "FEBS letters", "date": "2005-11-07", "authors": "Lin Cheng-Wen, Tsai Fuu-Jen, Wan Lei, Lai Chien-Chen, Lin Kuan-Hsun, Hsieh Tsung-Han, Shiu Shi-Yi, Li Jeng-Yi", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16226257", "url": "https://glygen.org/publication/PubMed/16226257" } ] }, { "title": "Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer.", "journal": "Nat. Struct. Mol. Biol.", "date": "2005", "authors": "Zhai Yujia, Sun Fei, Li Xuemei, Pang Hai, Xu Xiaoling, Bartlam Mark, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16228002", "url": "https://glygen.org/publication/PubMed/16228002" } ] }, { "title": "Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1''-phosphate dephosphorylation by a conserved domain of nsP3.", "journal": "Structure (London, England : 1993)", "date": "2005-11", "authors": "Saikatendu Kumar Singh, Joseph Jeremiah S, Subramanian Vanitha, Clayton Tom, Griffith Mark, Moy Kin, Velasquez Jeffrey, Neuman Benjamin W, Buchmeier Michael J, Stevens Raymond C, Kuhn Peter", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16271890", "url": "https://glygen.org/publication/PubMed/16271890" } ] }, { "title": "The papain-like protease of severe acute respiratory syndrome coronavirus has deubiquitinating activity.", "journal": "Journal of virology", "date": "2005", "authors": "Barretto N, Jukneliene D, Ratia K, Chen Z, Mesecar AD, Baker SC", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "title": "Severe acute respiratory syndrome coronavirus papain-like protease: structure of a viral deubiquitinating enzyme.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Ratia Kiira, Saikatendu Kumar Singh, Santarsiero Bernard D, Barretto Naina, Baker Susan C, Stevens Raymond C, Mesecar Andrew D", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16581910", "url": "https://glygen.org/publication/PubMed/16581910" } ] }, { "title": "Crystal structure of nonstructural protein 10 from the severe acute respiratory syndrome coronavirus reveals a novel fold with two zinc-binding motifs.", "journal": "J. Virol.", "date": "2006", "authors": "Joseph Jeremiah S, Saikatendu Kumar Singh, Subramanian Vanitha, Neuman Benjamin W, Brooun Alexei, Griffith Mark, Moy Kin, Yadav Maneesh K, Velasquez Jeffrey, Buchmeier Michael J, Stevens Raymond C, Kuhn Peter", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16873246", "url": "https://glygen.org/publication/PubMed/16873246" } ] }, { "title": "Dodecamer structure of severe acute respiratory syndrome coronavirus nonstructural protein nsp10.", "journal": "J. Virol.", "date": "2006", "authors": "Su Dan, Lou Zhiyong, Sun Fei, Zhai Yujia, Yang Haitao, Zhang Rongguang, Joachimiak Andrzej, Zhang Xuejun C, Bartlam Mark, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "16873247", "url": "https://glygen.org/publication/PubMed/16873247" } ] }, { "title": "A second, non-canonical RNA-dependent RNA polymerase in SARS coronavirus.", "journal": "EMBO J.", "date": "2006", "authors": "Imbert Isabelle, Guillemot Jean-Claude, Bourhis Jean-Marie, Bussetta C\u00e9cile, Coutard Bruno, Egloff Marie-Pierre, Ferron Fran\u00e7ois, Gorbalenya Alexander E, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "17024178", "url": "https://glygen.org/publication/PubMed/17024178" } ] }, { "title": "Novel beta-barrel fold in the nuclear magnetic resonance structure of the replicase nonstructural protein 1 from the severe acute respiratory syndrome coronavirus.", "journal": "J. Virol.", "date": "2007", "authors": "Almeida Marcius S, Johnson Margaret A, Herrmann Torsten, Geralt Michael, W\u00fcthrich Kurt", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "17202208", "url": "https://glygen.org/publication/PubMed/17202208" } ] }, { "title": "The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein.", "journal": "Virology", "date": "2007", "authors": "Kumar Purnima, Gunalan Vithiagaran, Liu Boping, Chow Vincent T K, Druce Julian, Birch Chris, Catton Mike, Fielding Burtram C, Tan Yee-Joo, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "17532020", "url": "https://glygen.org/publication/PubMed/17532020" } ] }, { "title": "Selectivity in ISG15 and ubiquitin recognition by the SARS coronavirus papain-like protease.", "journal": "Archives of biochemistry and biophysics", "date": "2007-10-01", "authors": "Lindner Holger A, Lytvyn Viktoria, Qi Hongtao, Lachance Paule, Ziomek Edmund, M\u00e9nard Robert", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "17692280", "url": "https://glygen.org/publication/PubMed/17692280" } ] }, { "title": "Topology and membrane anchoring of the coronavirus replication complex: not all hydrophobic domains of nsp3 and nsp6 are membrane spanning.", "journal": "J. Virol.", "date": "2008", "authors": "Oostra Monique, Hagemeijer Marne C, van Gent Michiel, Bekker Cornelis P J, te Lintelo Eddie G, Rottier Peter J M, de Haan Cornelis A M", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "18842706", "url": "https://glygen.org/publication/PubMed/18842706" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nsp9 dimerization is essential for efficient viral growth.", "journal": "Journal of virology", "date": "2009", "authors": "Miknis ZJ, Donaldson EF, Umland TC, Rimmer RA, Baric RS, Schultz LW", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "19153232", "url": "https://glygen.org/publication/PubMed/19153232" } ] }, { "title": "Severe acute respiratory syndrome coronavirus papain-like protease ubiquitin-like domain and catalytic domain regulate antagonism of IRF3 and NF-kappaB signaling.", "journal": "Journal of virology", "date": "2009-07", "authors": "Frieman Matthew, Ratia Kiira, Johnston Robert E, Mesecar Andrew D, Baric Ralph S", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "19369340", "url": "https://glygen.org/publication/PubMed/19369340" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nonstructural protein 2 interacts with a host protein complex involved in mitochondrial biogenesis and intracellular signaling.", "journal": "Journal of virology", "date": "2009-10", "authors": "Cornillez-Ty Cromwell T, Liao Lujian, Yates John R, Kuhn Peter, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "19640993", "url": "https://glygen.org/publication/PubMed/19640993" } ] }, { "title": "Mobility and interactions of coronavirus nonstructural protein 4.", "journal": "J. Virol.", "date": "2011", "authors": "Hagemeijer Marne C, Ulasli Mustafa, Vonk Annelotte M, Reggiori Fulvio, Rottier Peter J M, de Haan Cornelis A M", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "21345958", "url": "https://glygen.org/publication/PubMed/21345958" } ] }, { "title": "The SARS-coronavirus nsp7+nsp8 complex is a unique multimeric RNA polymerase capable of both de novo initiation and primer extension.", "journal": "Nucleic acids research", "date": "2012-02", "authors": "te Velthuis Aartjan J W, van den Worm Sjoerd H E, Snijder Eric J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "title": "SARS coronavirus nsp1 protein induces template-dependent endonucleolytic cleavage of mRNAs: viral mRNAs are resistant to nsp1-induced RNA cleavage.", "journal": "PLoS Pathog.", "date": "2011", "authors": "Huang C, Lokugamage KG, Rozovics JM, Narayanan K, Semler BL, Makino S", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "22174690", "url": "https://glygen.org/publication/PubMed/22174690" } ] }, { "title": "RNA 3'-end mismatch excision by the severe acute respiratory syndrome coronavirus nonstructural protein nsp10/nsp14 exoribonuclease complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-06-12", "authors": "Bouvet Micka\u00ebl, Imbert Isabelle, Subissi Lorenzo, Gluais Laure, Canard Bruno, Decroly Etienne", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "22635272", "url": "https://glygen.org/publication/PubMed/22635272" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein nsp1 is a novel eukaryotic translation inhibitor that represses multiple steps of translation initiation.", "journal": "Journal of virology", "date": "2012", "authors": "Lokugamage KG, Narayanan K, Huang C, Makino S", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "23035226", "url": "https://glygen.org/publication/PubMed/23035226" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nonstructural proteins 3, 4, and 6 induce double-membrane vesicles.", "journal": "mBio", "date": "2013-08-13", "authors": "Angelini Megan M, Akhlaghpour Marzieh, Neuman Benjamin W, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" } ] }, { "title": "Untangling membrane rearrangement in the nidovirales.", "journal": "DNA and cell biology", "date": "2014-03", "authors": "Angelini Megan Mary, Neuman Benjamin William, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" } ] }, { "title": "SARS coronavirus papain-like protease inhibits the type I interferon signaling pathway through interaction with the STING-TRAF3-TBK1 complex.", "journal": "Protein & cell", "date": "2014", "authors": "Chen X, Yang X, Zheng Y, Yang Y, Xing Y, Chen Z", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "24622840", "url": "https://glygen.org/publication/PubMed/24622840" } ] }, { "title": "Coronavirus NSP6 restricts autophagosome expansion.", "journal": "Autophagy", "date": "2014-08", "authors": "Cottam Eleanor M, Whelband Matthew C, Wileman Thomas", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "24991833", "url": "https://glygen.org/publication/PubMed/24991833" } ] }, { "title": "SARS coronavirus protein nsp1 disrupts localization of Nup93 from the nuclear pore complex.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2019", "authors": "Gomez GN, Abrar F, Dodhia MP, Gonzalez FG, Nag A", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "30943371", "url": "https://glygen.org/publication/PubMed/30943371" } ] }, { "title": "Processing of the SARS-CoV pp1a/ab nsp7-10 region.", "journal": "The Biochemical journal", "date": "2020", "authors": "Krichel B, Falke S, Hilgenfeld R, Redecke L, Uetrecht C", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "reference": [ { "type": "PubMed", "id": "32083638", "url": "https://glygen.org/publication/PubMed/32083638" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "viral protein processing", "id": "GO:0019082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019082", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "viral genome replication", "id": "GO:0019079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019079", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated activation of host autophagy", "id": "GO:0039520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039520", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host gene expression", "id": "GO:0039657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039657", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity", "id": "GO:0039548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039548", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host ISG15-protein conjugation", "id": "GO:0039579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039579", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated degradation of host mRNA", "id": "GO:0039595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039595", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host ubiquitin-like protein modification", "id": "GO:0039648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039648", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "viral translational frameshifting", "id": "GO:0075523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075523", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "RNA-directed RNA polymerase activity", "id": "GO:0003968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003968", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "omega peptidase activity", "id": "GO:0008242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008242", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "single-stranded RNA binding", "id": "GO:0003727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003727", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "endonuclease activity", "id": "GO:0004519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004519", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "methyltransferase activity", "id": "GO:0008168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008168", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "G-quadruplex RNA binding", "id": "GO:0002151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002151", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase activity", "id": "GO:0004197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004197", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "lyase activity", "id": "GO:0016829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016829", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "K63-linked deubiquitinase activity", "id": "GO:0061578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061578", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "K48-linked deubiquitinase activity", "id": "GO:1990380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990380", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "mRNA guanylyltransferase activity", "id": "GO:0004484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004484", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "host cell perinuclear region of cytoplasm", "id": "GO:0044220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044220", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum", "id": "GO:0044165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044165", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "host cell Golgi apparatus", "id": "GO:0044177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044177", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "host cell endosome", "id": "GO:0044174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044174", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" }, { "name": "double membrane vesicle viral factory outer membrane", "id": "GO:0062243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062243", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1628, "end_pos": 1630, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1696, "end_pos": 1698, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1899, "end_pos": 1901, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2079, "end_pos": 2081, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2249, "end_pos": 2251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2252, "end_pos": 2254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2507, "end_pos": 2509, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2659, "end_pos": 2661, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2685, "end_pos": 2687, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3303, "end_pos": 3305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3359, "end_pos": 3361, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3373, "end_pos": 3375, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3382, "end_pos": 3384, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3720, "end_pos": 3722, "annotation": "n_glycosylation_sequon" }, { "start_pos": 389, "end_pos": 391, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4150, "end_pos": 4152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4233, "end_pos": 4235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4240, "end_pos": 4242, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" }, { "start_pos": 556, "end_pos": 558, "annotation": "n_glycosylation_sequon" }, { "start_pos": 916, "end_pos": 918, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (PubMed:12917450, PubMed:15331731, PubMed:15564471, PubMed:16306590, PubMed:32083638). 3C-like proteinase nsp5 liberates nsps 6-11 from the polyprotein (PubMed:32083638). Papain-like and 3C-like proteinases are autocatalytically processed.", "evidence": [ { "database": "UniProtKB", "id": "P0C6U8", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" }, { "database": "PubMed", "id": "15564471", "url": "https://glygen.org/publication/PubMed/15564471" }, { "database": "PubMed", "id": "15331731", "url": "https://glygen.org/publication/PubMed/15331731" }, { "database": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" }, { "database": "PubMed", "id": "32083638", "url": "https://glygen.org/publication/PubMed/32083638" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01337", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01337" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "3Ecto", "eco_id": "ECO_0000255", "start_pos": 2224, "end_pos": 2294, "start_aa": "Thr", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01419", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01419" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "4Ecto", "eco_id": "ECO_0000255", "start_pos": 2776, "end_pos": 3020, "start_aa": "His", "end_aa": "Val", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01308", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01308" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "BetaCoV Nsp1 C-terminal", "eco_id": "ECO_0000255", "start_pos": 148, "end_pos": 179, "start_aa": "Glu", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01307", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01307" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp1 globular", "eco_id": "ECO_0000255", "start_pos": 12, "end_pos": 127, "start_aa": "Thr", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01335", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01335" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 C-terminal", "eco_id": "ECO_0000255", "start_pos": 690, "end_pos": 818, "start_aa": "Ile", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 N-terminal", "eco_id": "ECO_0000255", "start_pos": 183, "end_pos": 456, "start_aa": "Thr", "end_aa": "Arg", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01334", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01334" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 middle", "eco_id": "ECO_0000255", "start_pos": 458, "end_pos": 688, "start_aa": "Arg", "end_aa": "Met", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp3 Y", "eco_id": "ECO_0000255", "start_pos": 2372, "end_pos": 2740, "start_aa": "Lys", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01289", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01289" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "DPUP", "eco_id": "ECO_0000255", "start_pos": 1472, "end_pos": 1538, "start_aa": "Thr", "end_aa": "Ser", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "ExoN/MTase coactivator", "eco_id": "ECO_0000255", "start_pos": 4231, "end_pos": 4369, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01338", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01338" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G2M", "eco_id": "ECO_0000255", "start_pos": 2023, "end_pos": 2132, "start_aa": "Pro", "end_aa": "Asn", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 1", "eco_id": "ECO_0000255", "start_pos": 1003, "end_pos": 1169, "start_aa": "Val", "end_aa": "Leu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 2", "eco_id": "ECO_0000255", "start_pos": 1207, "end_pos": 1335, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 3", "eco_id": "ECO_0000255", "start_pos": 1343, "end_pos": 1470, "start_aa": "Ile", "end_aa": "Ser", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01291", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01291" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp4C", "eco_id": "ECO_0000255", "start_pos": 3142, "end_pos": 3240, "start_aa": "Val", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01296", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01296" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp9 ssRNA-binding", "eco_id": "ECO_0000255", "start_pos": 4118, "end_pos": 4230, "start_aa": "Asn", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01290", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01290" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nucleic acid-binding", "eco_id": "ECO_0000255", "start_pos": 1888, "end_pos": 1998, "start_aa": "Pro", "end_aa": "Thr", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peptidase C16", "eco_id": "ECO_0000255", "start_pos": 1611, "end_pos": 1875, "start_aa": "Tyr", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00772", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00772" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peptidase C30", "eco_id": "ECO_0000255", "start_pos": 3241, "end_pos": 3546, "start_aa": "Ser", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01294", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01294" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp Nsp7 cofactor", "eco_id": "ECO_0000255", "start_pos": 3837, "end_pos": 3919, "start_aa": "Ser", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01295", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01295" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp Nsp8 cofactor", "eco_id": "ECO_0000255", "start_pos": 3920, "end_pos": 4117, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00214", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00214" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ubiquitin-like 1", "eco_id": "ECO_0000255", "start_pos": 822, "end_pos": 930, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00214", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00214" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ubiquitin-like 2", "eco_id": "ECO_0000255", "start_pos": 1542, "end_pos": 1597, "start_aa": "Val", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [ { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1729, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1729, "end_pos": 1729, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1732, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1732, "end_pos": 1732, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1764, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1764, "end_pos": 1764, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1766, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1766, "end_pos": 1766, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 200, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 200, "end_pos": 200, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 231, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 231, "end_pos": 231, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 234, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 234, "end_pos": 234, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 236, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 236, "end_pos": 236, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2376, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2376, "end_pos": 2376, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2381, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2381, "end_pos": 2381, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2386, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2386, "end_pos": 2386, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2389, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2389, "end_pos": 2389, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2422, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2422, "end_pos": 2422, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2425, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2425, "end_pos": 2425, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2429, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2429, "end_pos": 2429, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2432, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2432, "end_pos": 2432, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 323, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 323, "end_pos": 323, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 326, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 326, "end_pos": 326, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 341, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 341, "end_pos": 341, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 344, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 344, "end_pos": 344, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 370, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 370, "end_pos": 370, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 373, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 373, "end_pos": 373, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 382, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 382, "end_pos": 382, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 416, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 416, "end_pos": 416, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4304, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4304, "end_pos": 4304, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4307, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4307, "end_pos": 4307, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4313, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4313, "end_pos": 4313, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4320, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4320, "end_pos": 4320, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4347, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4347, "end_pos": 4347, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4350, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4350, "end_pos": 4350, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4358, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4358, "end_pos": 4358, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8#function" }, { "id": "P0C6U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6U8" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4360, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4360, "end_pos": 4360, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.4.19.12", "ec_name": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "3.4.19.12", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.19.12" } ] }, { "ec_number": "2.7.7.50", "ec_name": "a 5'-end diphospho-ribonucleoside in mRNA + GTP + H(+) = a 5'-end (5'-triphosphoguanosine)-ribonucleoside in mRNA + diphosphate.", "evidence": [ { "id": "2.7.7.50", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.50" }, { "id": "2.7.7.50", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.50" } ] }, { "ec_number": "3.4.22.69", "ec_name": "TSAVLQ-|-SGFRK-NH2 and SGVTFQ-|-GKFKK the two peptides corresponding to the two self-cleavage sites of the SARS 3C-like proteinase are the two most reactive peptide substrates. The enzyme exhibits a strong preference for substrates containing Gln at P1 position and Leu at P2 position.", "evidence": [] } ], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 998 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1628, "end_pos": 1630 }, { "start_pos": 1696, "end_pos": 1698 }, { "start_pos": 1899, "end_pos": 1901 }, { "start_pos": 2079, "end_pos": 2081 }, { "start_pos": 2249, "end_pos": 2251 }, { "start_pos": 2252, "end_pos": 2254 }, { "start_pos": 2507, "end_pos": 2509 }, { "start_pos": 2659, "end_pos": 2661 }, { "start_pos": 2685, "end_pos": 2687 }, { "start_pos": 3303, "end_pos": 3305 }, { "start_pos": 3359, "end_pos": 3361 }, { "start_pos": 3373, "end_pos": 3375 }, { "start_pos": 3382, "end_pos": 3384 }, { "start_pos": 3720, "end_pos": 3722 }, { "start_pos": 389, "end_pos": 391 }, { "start_pos": 4150, "end_pos": 4152 }, { "start_pos": 4233, "end_pos": 4235 }, { "start_pos": 4240, "end_pos": 4242 }, { "start_pos": 48, "end_pos": 50 }, { "start_pos": 556, "end_pos": 558 }, { "start_pos": 916, "end_pos": 918 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P0C6X7-1", "uniprot_ac": "P0C6X7", "uniprot_id": "R1AB_SARS", "mass": { "chemical_mass": 790248.0, "monoisotopic_mass": 790248.0 }, "refseq": { "ac": "NP_828849", "name": "ORF1ab polyprotein", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_828849" }, "gene_names": [ { "name": "rep", "type": "recommended", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ] }, { "name": "1a-1b", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ] } ], "protein_names": [ { "name": "Replicase polyprotein 1ab", "type": "recommended", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "ExoN", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "GFL", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Growth factor-like peptide", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Leader protein", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Main protease", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Mpro", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "NendoU", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 12", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 13", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 14", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 15", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 16", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 1", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 3", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 5", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 9", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "ORF1ab polyprotein", "type": "synonym", "evidence": [ { "id": "NP_828849", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_828849" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "PL2-PRO", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "Proofreading exoribonuclease nsp14", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "RNA-capping enzyme subunit nsp9", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "SARS coronavirus main proteinase", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp12", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp13", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp14", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp15", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp16", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp1", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp3", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp5", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "nsp9", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "p65 homolog", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "polyprotein pp1ab", "type": "synonym", "evidence": [ { "id": "NP_828849", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_828849" } ] }, { "name": "pp1ab", "type": "synonym", "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#names_and_taxonomy" } ] }, { "name": "replicase 1AB", "type": "synonym", "evidence": [ { "id": "NP_828849", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_828849" } ] } ], "function": [ { "annotation": "Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. May cleave human NLRP1 in lung epithelial cells, thereby activating the NLRP1 inflammasome pathway (PubMed:35594856). Also able to bind an ADP-ribose-1''-phosphate (ADRP). May cleave host ATP6V1G1 thereby modifying host vacuoles intracellular pH.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "35594856", "url": "https://glygen.org/publication/PubMed/35594856" }, { "database": "PubMed", "id": "16226257", "url": "https://glygen.org/publication/PubMed/16226257" }, { "database": "UniProtKB", "id": "PRU00772", "url": "https://www.uniprot.org/uniprotkb/PRU00772#function" } ] }, { "annotation": "Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "annotation": "Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "annotation": "Forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains. Interacts with ribosome signal recognition particle RNA (SRP). Together with NSP8, suppress protein integration into the cell membrane, thereby disrupting host immune defenses.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "UniProtKB", "id": "P0DTD1", "url": "https://www.uniprot.org/uniprotkb/P0DTD1#function" } ] }, { "annotation": "Inhibits host translation by interacting with the 40S ribosomal subunit. The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation. Viral mRNAs are not susceptible to nsp1-mediated endonucleolytic RNA cleavage thanks to the presence of a 5'-end leader sequence and are therefore protected from degradation. By suppressing host gene expression, nsp1 facilitates efficient viral gene expression in infected cells and evasion from host immune response (PubMed:23035226). May disrupt nuclear pore function by binding and displacing host NUP93 (PubMed:30943371).", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "23035226", "url": "https://glygen.org/publication/PubMed/23035226" }, { "database": "PubMed", "id": "30943371", "url": "https://glygen.org/publication/PubMed/30943371" } ] }, { "annotation": "May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2 (PubMed:19640993). Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses (PubMed:19640993).", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "19640993", "url": "https://glygen.org/publication/PubMed/19640993" } ] }, { "annotation": "Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed:18417574, PubMed:20421945, PubMed:22022266). N7-methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed:18417574). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed:18417574, PubMed:20421945, PubMed:22022266).", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "20421945", "url": "https://glygen.org/publication/PubMed/20421945" }, { "database": "PubMed", "id": "18417574", "url": "https://glygen.org/publication/PubMed/18417574" }, { "database": "PubMed", "id": "22022266", "url": "https://glygen.org/publication/PubMed/22022266" } ] }, { "annotation": "Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "12917423", "url": "https://glygen.org/publication/PubMed/12917423" }, { "database": "PubMed", "id": "22615777", "url": "https://glygen.org/publication/PubMed/22615777" } ] }, { "annotation": "Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "annotation": "Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "22635272", "url": "https://glygen.org/publication/PubMed/22635272" }, { "database": "PubMed", "id": "22022266", "url": "https://glygen.org/publication/PubMed/22022266" } ] }, { "annotation": "Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Alone appears incapable to induce membrane curvature, but together with nsp3 is able to induce paired membranes. Nsp3, nsp4 and nsp6 together are sufficient to form DMV.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" }, { "database": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" }, { "database": "PubMed", "id": "24991833", "url": "https://glygen.org/publication/PubMed/24991833" } ] }, { "annotation": "Plays a role in viral RNA synthesis through two distinct activities. The N7-guanine methyltransferase activity plays a role in the formation of the cap structure GpppA-RNA (PubMed:20421945, PubMed:34845015). The proofreading exoribonuclease reduces the sensitivity of the virus to RNA mutagens during replication (PubMed:16549795, PubMed:21593585, PubMed:22635272, PubMed:23966862, PubMed:29511076). This activity acts on both ssRNA and dsRNA in a 3'-5' direction.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "23966862", "url": "https://glygen.org/publication/PubMed/23966862" }, { "database": "PubMed", "id": "22635272", "url": "https://glygen.org/publication/PubMed/22635272" }, { "database": "PubMed", "id": "21593585", "url": "https://glygen.org/publication/PubMed/21593585" }, { "database": "PubMed", "id": "29511076", "url": "https://glygen.org/publication/PubMed/29511076" }, { "database": "PubMed", "id": "16549795", "url": "https://glygen.org/publication/PubMed/16549795" }, { "database": "PubMed", "id": "20421945", "url": "https://glygen.org/publication/PubMed/20421945" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "annotation": "Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (PubMed:18045871, PubMed:28158275). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs. Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed:16828802). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (PubMed:18045871, PubMed:28158275).", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "18045871", "url": "https://glygen.org/publication/PubMed/18045871" }, { "database": "PubMed", "id": "16828802", "url": "https://glygen.org/publication/PubMed/16828802" }, { "database": "PubMed", "id": "28158275", "url": "https://glygen.org/publication/PubMed/28158275" } ] }, { "annotation": "RNA-directed RNA polymerase that catalyzes the transcription of viral genomic and subgenomic RNAs (PubMed:22791111). Acts in complex with nsp7 and nsp8 to transcribe both the minus and positive strands of genomic RNA. The kinase-like NiRAN domain of NSP12 attaches one or more nucleotides to the amino terminus of NSP9, forming a covalent RNA-protein intermediate that serves as transcription/replication primer. Subgenomic RNAs (sgRNAs) are formed by discontinuous transcription: The polymerase has the ability to pause at transcription-regulating sequences (TRS) and jump to the leader TRS, resulting in a major deletion. This creates a series of subgenomic RNAs that are replicated, transcribed and translated. In addition, Nsp12 is a subunit of the viral RNA capping enzyme that catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs. Subsequently, the NiRAN domain transfers RNA to GDP, and forms the core cap structure GpppA-RNA.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "UniProtKB", "id": "P0DTD1", "url": "https://www.uniprot.org/uniprotkb/P0DTD1#function" }, { "database": "PubMed", "id": "22791111", "url": "https://glygen.org/publication/PubMed/22791111" } ] }, { "annotation": "Responsible for the cleavages located at the N-terminus of the replicase polyprotein (PubMed:16306590). Contains an ADP-ribose hydrolase activity that binds ADP-ribose and catalyzes the removal of mono-ADP-ribose (de-MARylation), usually bound to a glutamate or aspartate (By similarity). ADP-ribose hydrolase activity allows the virus to interfere with the host immune defenses involving poly-ADP-ribose polymerases (PARPs) (Probable). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed:16306590, PubMed:17692280). Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:24410069). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed:19369340, PubMed:24622840). Also prevents host NF-kappa-B signaling (PubMed:19369340, PubMed:24622840).", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" }, { "database": "PubMed", "id": "17692280", "url": "https://glygen.org/publication/PubMed/17692280" }, { "database": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" }, { "database": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" }, { "database": "PubMed", "id": "24622840", "url": "https://glygen.org/publication/PubMed/24622840" }, { "database": "PubMed", "id": "19369340", "url": "https://glygen.org/publication/PubMed/19369340" }, { "database": "UniProtKB", "id": "P0DTC1", "url": "https://www.uniprot.org/uniprotkb/P0DTC1#function" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 1651, "end_pos": 1651, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1688, "end_pos": 1688, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1729, "end_pos": 1729, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1732, "end_pos": 1732, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1764, "end_pos": 1764, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1766, "end_pos": 1766, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 1826, "end_pos": 1826, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of PL-PRO activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "start_pos": 4217, "end_pos": 4217, "sequence_org": "G", "sequence_mut": "E", "comment": "Complete loss of nsp9 dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "19153232", "url": "https://glygen.org/publication/PubMed/19153232" } ] }, { "start_pos": 4221, "end_pos": 4221, "sequence_org": "G", "sequence_mut": "E", "comment": "Complete loss of nsp9 dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "19153232", "url": "https://glygen.org/publication/PubMed/19153232" } ] }, { "start_pos": 4306, "end_pos": 4308, "sequence_org": "YCR", "sequence_mut": "AAA", "comment": "Complete loss of NSP16 binding to SAM and NSP16 MTase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "22022266", "url": "https://glygen.org/publication/PubMed/22022266" } ] }, { "start_pos": 4313, "end_pos": 4314, "sequence_org": "HP", "sequence_mut": "AA", "comment": "Complete loss of NSP16 binding to SAM and NSP16 MTase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "22022266", "url": "https://glygen.org/publication/PubMed/22022266" } ] }, { "start_pos": 6194, "end_pos": 6194, "sequence_org": "W", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. Partial loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6208, "end_pos": 6208, "sequence_org": "N", "sequence_mut": "A", "comment": "Partial loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. No effect on virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6212, "end_pos": 6212, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. Partial loss of ExoN activity ex vivo. Complete loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6233, "end_pos": 6233, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. Complete loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6238, "end_pos": 6238, "sequence_org": "K", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. No effect on virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6254, "end_pos": 6254, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. Partial loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6288, "end_pos": 6288, "sequence_org": "N", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. Complete loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6322, "end_pos": 6322, "sequence_org": "Y", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. Partial loss of ExoN activity ex vivo. Complete loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6324, "end_pos": 6324, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. No effect on virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6326, "end_pos": 6326, "sequence_org": "H", "sequence_mut": "A", "comment": "Partial loss of NSP14 guanine-N7 methyltransferase activity ex vivo. Partial loss of ExoN activity ex vivo. Partial loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6328, "end_pos": 6328, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete loss of NSP14 guanine-N7 methyltransferase activity ex vivo. No effect on ExoN activity ex vivo. Complete loss of virus infectivity in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "start_pos": 6663, "end_pos": 6663, "sequence_org": "H", "sequence_mut": "A", "comment": "Complete loss of NSP15 endonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "18045871", "url": "https://glygen.org/publication/PubMed/18045871" }, { "database": "PubMed", "id": "16828802", "url": "https://glygen.org/publication/PubMed/16828802" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "rep", "url": "https://www.uniprot.org/uniprotkb/P0C6X7", "locus": {} } ], "crossref": [ { "id": "CHEMBL5118", "url": "https://www.ebi.ac.uk/chembl/target/inspect/CHEMBL5118", "database": "ChEMBL", "categories": [ "Chemical" ] }, { "id": "1Q2W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Q2W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1QZ8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1QZ8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UJ1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UJ1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UK4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UK4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1UW7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1UW7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1WOF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1WOF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1YSY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1YSY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1Z1I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Z1I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1Z1J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Z1J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5A", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5A&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2A5K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2A5K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ACF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ACF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AHM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AHM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2ALV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2ALV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AMD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AMD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AMQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AMQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BX3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BX3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BX4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BX4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2C3S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2C3S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2D2D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2D2D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2DUC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2DUC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FAV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FAV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FE8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FE8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FYG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FYG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2G9T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2G9T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GA6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GA6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GDT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GDT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GRI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GRI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GT7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GT7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GT8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GT8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GTB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GTB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GX4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GX4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GZ9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GZ9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2H2Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2H2Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2H85", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2H85&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2HOB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2HOB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2HSX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2HSX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2IDY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2IDY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2JZD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2JZD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2JZE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2JZE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2JZF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2JZF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2K7X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2K7X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2K87", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2K87&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OP9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OP9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OZK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OZK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2PWX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2PWX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Q6G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Q6G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2QC2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2QC2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2QCY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2QCY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2QIQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2QIQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RHB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RHB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RNK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RNK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2V6N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2V6N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2VJ1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2VJ1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2XYQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2XYQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2XYR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2XYR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2XYV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2XYV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z3E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z3E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z94", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z94&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z9G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z9G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z9J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z9J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z9K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z9K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2Z9L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2Z9L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3D62", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3D62&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3E9S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3E9S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3EBN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3EBN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3R24", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3R24&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4TWW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4TWW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4TWY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4TWY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4WY3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4WY3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZUH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZUH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5B6O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5B6O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C5N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C5N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C5O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C5O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C8S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C8S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C8T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C8T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C8U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C8U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5E6J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5E6J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5F22", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5F22&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5N19", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5N19&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5N5O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5N5O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5NFY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5NFY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5TL6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5TL6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5TL7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5TL7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6JYT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6JYT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LNQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LNQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NUR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NUR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NUS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NUS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6W79", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6W79&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6WCO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6WCO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LCP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LCP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LCQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LCQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8C0G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8C0G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8CB3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8CB3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YKK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YKK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P0C6X7", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0C6X7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001205", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001205", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002589", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002589", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008740", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008740", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009461", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009461", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009466", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009466", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009469", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009469", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014822", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014822", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014828", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014828", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022733", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022733", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024375", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024375", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027351", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027351", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032505", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032505", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032592", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032592", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036333", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036333", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036499", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036499", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037204", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037204", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037227", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037227", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037230", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037230", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038166", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038166", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041679", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041679", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042515", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042515", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042570", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042570", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043174", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043174", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043177", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043177", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043472", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043472", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043477", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043477", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043478", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043503", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043503", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043606", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043606", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043609", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043609", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043610", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043610", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043612", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043612", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043615", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043615", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044315", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044315", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044330", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044330", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044343", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044343", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044351", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044351", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044371", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044371", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044389", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044389", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044401", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044864", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044864", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046435", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046435", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046438", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046438", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046440", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046440", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046441", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046441", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046442", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046442", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046443", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046443", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047570", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047570", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047573", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047573", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048672", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048672", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048673", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048673", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR049894", "url": "https://www.ebi.ac.uk/interpro/entry/IPR049894", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050534", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050534", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001q2w", "url": "https://www.rcsb.org/structure/pdb_00001q2w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001qz8", "url": "https://www.rcsb.org/structure/pdb_00001qz8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uj1", "url": "https://www.rcsb.org/structure/pdb_00001uj1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk2", "url": "https://www.rcsb.org/structure/pdb_00001uk2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk3", "url": "https://www.rcsb.org/structure/pdb_00001uk3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uk4", "url": "https://www.rcsb.org/structure/pdb_00001uk4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001uw7", "url": "https://www.rcsb.org/structure/pdb_00001uw7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001wof", "url": "https://www.rcsb.org/structure/pdb_00001wof", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001ysy", "url": "https://www.rcsb.org/structure/pdb_00001ysy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001z1i", "url": "https://www.rcsb.org/structure/pdb_00001z1i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001z1j", "url": "https://www.rcsb.org/structure/pdb_00001z1j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5a", "url": "https://www.rcsb.org/structure/pdb_00002a5a", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5i", "url": "https://www.rcsb.org/structure/pdb_00002a5i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002a5k", "url": "https://www.rcsb.org/structure/pdb_00002a5k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002acf", "url": "https://www.rcsb.org/structure/pdb_00002acf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ahm", "url": "https://www.rcsb.org/structure/pdb_00002ahm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002alv", "url": "https://www.rcsb.org/structure/pdb_00002alv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002amd", "url": "https://www.rcsb.org/structure/pdb_00002amd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002amq", "url": "https://www.rcsb.org/structure/pdb_00002amq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002bx3", "url": "https://www.rcsb.org/structure/pdb_00002bx3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002bx4", "url": "https://www.rcsb.org/structure/pdb_00002bx4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002c3s", "url": "https://www.rcsb.org/structure/pdb_00002c3s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002d2d", "url": "https://www.rcsb.org/structure/pdb_00002d2d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002duc", "url": "https://www.rcsb.org/structure/pdb_00002duc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fav", "url": "https://www.rcsb.org/structure/pdb_00002fav", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fe8", "url": "https://www.rcsb.org/structure/pdb_00002fe8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fyg", "url": "https://www.rcsb.org/structure/pdb_00002fyg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002g9t", "url": "https://www.rcsb.org/structure/pdb_00002g9t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ga6", "url": "https://www.rcsb.org/structure/pdb_00002ga6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gdt", "url": "https://www.rcsb.org/structure/pdb_00002gdt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gri", "url": "https://www.rcsb.org/structure/pdb_00002gri", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gt7", "url": "https://www.rcsb.org/structure/pdb_00002gt7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gt8", "url": "https://www.rcsb.org/structure/pdb_00002gt8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gtb", "url": "https://www.rcsb.org/structure/pdb_00002gtb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gx4", "url": "https://www.rcsb.org/structure/pdb_00002gx4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz7", "url": "https://www.rcsb.org/structure/pdb_00002gz7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz8", "url": "https://www.rcsb.org/structure/pdb_00002gz8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gz9", "url": "https://www.rcsb.org/structure/pdb_00002gz9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002h2z", "url": "https://www.rcsb.org/structure/pdb_00002h2z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002h85", "url": "https://www.rcsb.org/structure/pdb_00002h85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002hob", "url": "https://www.rcsb.org/structure/pdb_00002hob", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002hsx", "url": "https://www.rcsb.org/structure/pdb_00002hsx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002idy", "url": "https://www.rcsb.org/structure/pdb_00002idy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002jzd", "url": "https://www.rcsb.org/structure/pdb_00002jzd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002jze", "url": "https://www.rcsb.org/structure/pdb_00002jze", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002jzf", "url": "https://www.rcsb.org/structure/pdb_00002jzf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002k7x", "url": "https://www.rcsb.org/structure/pdb_00002k7x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002k87", "url": "https://www.rcsb.org/structure/pdb_00002k87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002op9", "url": "https://www.rcsb.org/structure/pdb_00002op9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ozk", "url": "https://www.rcsb.org/structure/pdb_00002ozk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002pwx", "url": "https://www.rcsb.org/structure/pdb_00002pwx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002q6g", "url": "https://www.rcsb.org/structure/pdb_00002q6g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002qc2", "url": "https://www.rcsb.org/structure/pdb_00002qc2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002qcy", "url": "https://www.rcsb.org/structure/pdb_00002qcy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002qiq", "url": "https://www.rcsb.org/structure/pdb_00002qiq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002rhb", "url": "https://www.rcsb.org/structure/pdb_00002rhb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002rnk", "url": "https://www.rcsb.org/structure/pdb_00002rnk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002v6n", "url": "https://www.rcsb.org/structure/pdb_00002v6n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002vj1", "url": "https://www.rcsb.org/structure/pdb_00002vj1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002xyq", "url": "https://www.rcsb.org/structure/pdb_00002xyq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002xyr", "url": "https://www.rcsb.org/structure/pdb_00002xyr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002xyv", "url": "https://www.rcsb.org/structure/pdb_00002xyv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3c", "url": "https://www.rcsb.org/structure/pdb_00002z3c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3d", "url": "https://www.rcsb.org/structure/pdb_00002z3d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z3e", "url": "https://www.rcsb.org/structure/pdb_00002z3e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z94", "url": "https://www.rcsb.org/structure/pdb_00002z94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z9g", "url": "https://www.rcsb.org/structure/pdb_00002z9g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z9j", "url": "https://www.rcsb.org/structure/pdb_00002z9j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z9k", "url": "https://www.rcsb.org/structure/pdb_00002z9k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002z9l", "url": "https://www.rcsb.org/structure/pdb_00002z9l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003d62", "url": "https://www.rcsb.org/structure/pdb_00003d62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003e9s", "url": "https://www.rcsb.org/structure/pdb_00003e9s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ebn", "url": "https://www.rcsb.org/structure/pdb_00003ebn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003r24", "url": "https://www.rcsb.org/structure/pdb_00003r24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004tww", "url": "https://www.rcsb.org/structure/pdb_00004tww", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004twy", "url": "https://www.rcsb.org/structure/pdb_00004twy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004wy3", "url": "https://www.rcsb.org/structure/pdb_00004wy3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004zuh", "url": "https://www.rcsb.org/structure/pdb_00004zuh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005b6o", "url": "https://www.rcsb.org/structure/pdb_00005b6o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c5n", "url": "https://www.rcsb.org/structure/pdb_00005c5n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c5o", "url": "https://www.rcsb.org/structure/pdb_00005c5o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c8s", "url": "https://www.rcsb.org/structure/pdb_00005c8s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c8t", "url": "https://www.rcsb.org/structure/pdb_00005c8t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c8u", "url": "https://www.rcsb.org/structure/pdb_00005c8u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005e6j", "url": "https://www.rcsb.org/structure/pdb_00005e6j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005f22", "url": "https://www.rcsb.org/structure/pdb_00005f22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005n19", "url": "https://www.rcsb.org/structure/pdb_00005n19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005n5o", "url": "https://www.rcsb.org/structure/pdb_00005n5o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005nfy", "url": "https://www.rcsb.org/structure/pdb_00005nfy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005tl6", "url": "https://www.rcsb.org/structure/pdb_00005tl6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005tl7", "url": "https://www.rcsb.org/structure/pdb_00005tl7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006jyt", "url": "https://www.rcsb.org/structure/pdb_00006jyt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lnq", "url": "https://www.rcsb.org/structure/pdb_00006lnq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nur", "url": "https://www.rcsb.org/structure/pdb_00006nur", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nus", "url": "https://www.rcsb.org/structure/pdb_00006nus", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006w79", "url": "https://www.rcsb.org/structure/pdb_00006w79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006wco", "url": "https://www.rcsb.org/structure/pdb_00006wco", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lcp", "url": "https://www.rcsb.org/structure/pdb_00007lcp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lcq", "url": "https://www.rcsb.org/structure/pdb_00007lcq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008c0g", "url": "https://www.rcsb.org/structure/pdb_00008c0g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008cb3", "url": "https://www.rcsb.org/structure/pdb_00008cb3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ykk", "url": "https://www.rcsb.org/structure/pdb_00008ykk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Q2W", "url": "https://www.rcsb.org/structure/1Q2W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QZ8", "url": "https://www.rcsb.org/structure/1QZ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UJ1", "url": "https://www.rcsb.org/structure/1UJ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK2", "url": "https://www.rcsb.org/structure/1UK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK3", "url": "https://www.rcsb.org/structure/1UK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UK4", "url": "https://www.rcsb.org/structure/1UK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UW7", "url": "https://www.rcsb.org/structure/1UW7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WOF", "url": "https://www.rcsb.org/structure/1WOF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YSY", "url": "https://www.rcsb.org/structure/1YSY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z1I", "url": "https://www.rcsb.org/structure/1Z1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z1J", "url": "https://www.rcsb.org/structure/1Z1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5A", "url": "https://www.rcsb.org/structure/2A5A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5I", "url": "https://www.rcsb.org/structure/2A5I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A5K", "url": "https://www.rcsb.org/structure/2A5K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ACF", "url": "https://www.rcsb.org/structure/2ACF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AHM", "url": "https://www.rcsb.org/structure/2AHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ALV", "url": "https://www.rcsb.org/structure/2ALV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AMD", "url": "https://www.rcsb.org/structure/2AMD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AMQ", "url": "https://www.rcsb.org/structure/2AMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BX3", "url": "https://www.rcsb.org/structure/2BX3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BX4", "url": "https://www.rcsb.org/structure/2BX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2C3S", "url": "https://www.rcsb.org/structure/2C3S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2D2D", "url": "https://www.rcsb.org/structure/2D2D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2DUC", "url": "https://www.rcsb.org/structure/2DUC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FAV", "url": "https://www.rcsb.org/structure/2FAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FE8", "url": "https://www.rcsb.org/structure/2FE8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FYG", "url": "https://www.rcsb.org/structure/2FYG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2G9T", "url": "https://www.rcsb.org/structure/2G9T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GA6", "url": "https://www.rcsb.org/structure/2GA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GDT", "url": "https://www.rcsb.org/structure/2GDT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GRI", "url": "https://www.rcsb.org/structure/2GRI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GT7", "url": "https://www.rcsb.org/structure/2GT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GT8", "url": "https://www.rcsb.org/structure/2GT8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GTB", "url": "https://www.rcsb.org/structure/2GTB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GX4", "url": "https://www.rcsb.org/structure/2GX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ7", "url": "https://www.rcsb.org/structure/2GZ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ8", "url": "https://www.rcsb.org/structure/2GZ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GZ9", "url": "https://www.rcsb.org/structure/2GZ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2H2Z", "url": "https://www.rcsb.org/structure/2H2Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2H85", "url": "https://www.rcsb.org/structure/2H85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HOB", "url": "https://www.rcsb.org/structure/2HOB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HSX", "url": "https://www.rcsb.org/structure/2HSX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2IDY", "url": "https://www.rcsb.org/structure/2IDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JZD", "url": "https://www.rcsb.org/structure/2JZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JZE", "url": "https://www.rcsb.org/structure/2JZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JZF", "url": "https://www.rcsb.org/structure/2JZF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2K7X", "url": "https://www.rcsb.org/structure/2K7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2K87", "url": "https://www.rcsb.org/structure/2K87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OP9", "url": "https://www.rcsb.org/structure/2OP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OZK", "url": "https://www.rcsb.org/structure/2OZK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2PWX", "url": "https://www.rcsb.org/structure/2PWX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Q6G", "url": "https://www.rcsb.org/structure/2Q6G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QC2", "url": "https://www.rcsb.org/structure/2QC2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QCY", "url": "https://www.rcsb.org/structure/2QCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QIQ", "url": "https://www.rcsb.org/structure/2QIQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RHB", "url": "https://www.rcsb.org/structure/2RHB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RNK", "url": "https://www.rcsb.org/structure/2RNK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V6N", "url": "https://www.rcsb.org/structure/2V6N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VJ1", "url": "https://www.rcsb.org/structure/2VJ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XYQ", "url": "https://www.rcsb.org/structure/2XYQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XYR", "url": "https://www.rcsb.org/structure/2XYR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XYV", "url": "https://www.rcsb.org/structure/2XYV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3C", "url": "https://www.rcsb.org/structure/2Z3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3D", "url": "https://www.rcsb.org/structure/2Z3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z3E", "url": "https://www.rcsb.org/structure/2Z3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z94", "url": "https://www.rcsb.org/structure/2Z94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z9G", "url": "https://www.rcsb.org/structure/2Z9G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z9J", "url": "https://www.rcsb.org/structure/2Z9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z9K", "url": "https://www.rcsb.org/structure/2Z9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z9L", "url": "https://www.rcsb.org/structure/2Z9L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D62", "url": "https://www.rcsb.org/structure/3D62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3E9S", "url": "https://www.rcsb.org/structure/3E9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EBN", "url": "https://www.rcsb.org/structure/3EBN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3R24", "url": "https://www.rcsb.org/structure/3R24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TWW", "url": "https://www.rcsb.org/structure/4TWW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TWY", "url": "https://www.rcsb.org/structure/4TWY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WY3", "url": "https://www.rcsb.org/structure/4WY3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZUH", "url": "https://www.rcsb.org/structure/4ZUH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B6O", "url": "https://www.rcsb.org/structure/5B6O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C5N", "url": "https://www.rcsb.org/structure/5C5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C5O", "url": "https://www.rcsb.org/structure/5C5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C8S", "url": "https://www.rcsb.org/structure/5C8S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C8T", "url": "https://www.rcsb.org/structure/5C8T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C8U", "url": "https://www.rcsb.org/structure/5C8U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5E6J", "url": "https://www.rcsb.org/structure/5E6J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5F22", "url": "https://www.rcsb.org/structure/5F22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N19", "url": "https://www.rcsb.org/structure/5N19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N5O", "url": "https://www.rcsb.org/structure/5N5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NFY", "url": "https://www.rcsb.org/structure/5NFY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TL6", "url": "https://www.rcsb.org/structure/5TL6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TL7", "url": "https://www.rcsb.org/structure/5TL7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JYT", "url": "https://www.rcsb.org/structure/6JYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LNQ", "url": "https://www.rcsb.org/structure/6LNQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NUR", "url": "https://www.rcsb.org/structure/6NUR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NUS", "url": "https://www.rcsb.org/structure/6NUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6W79", "url": "https://www.rcsb.org/structure/6W79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WCO", "url": "https://www.rcsb.org/structure/6WCO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LCP", "url": "https://www.rcsb.org/structure/7LCP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LCQ", "url": "https://www.rcsb.org/structure/7LCQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8C0G", "url": "https://www.rcsb.org/structure/8C0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CB3", "url": "https://www.rcsb.org/structure/8CB3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YKK", "url": "https://www.rcsb.org/structure/8YKK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00680", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00680", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF01661", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01661", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF05409", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05409", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF06460", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06460", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF06471", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06471", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF06478", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06478", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08710", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08710", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08715", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08715", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08716", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08716", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08717", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08717", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF09401", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF09401", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF11501", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11501", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF11633", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11633", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF12124", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12124", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF12379", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12379", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13087", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13087", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16251", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16251", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16348", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16348", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19211", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19211", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19213", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19213", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19215", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19215", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19216", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19216", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19217", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19217", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19218", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19218", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF19219", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19219", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF20631", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF20631", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF20632", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF20632", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF20633", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF20633", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_828849", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_828849", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C6X7-1", "url": "https://www.uniprot.org/uniprotkb/P0C6X7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN", "length": 7073, "header": "sp|P0C6X7-1|R1AB_SARS Isoform 1 of Replicase polyprotein 1ab OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=rep PE=1 SV=1 CANONICAL=P0C6X7-1" }, "isoforms": [ { "isoform_ac": "P0C6X7-1", "url": "https://www.uniprot.org/uniprotkb/P0C6X7/entry#P0C6X7-1", "sequence": { "sequence": "MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN", "length": 7073, "header": "sp|P0C6X7-1|R1AB_SARS Isoform 1 of Replicase polyprotein 1ab OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=rep PE=1 SV=1 CANONICAL=P0C6X7-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 998, "start_aa": "Thr", "end_pos": 998, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr998", "evidence": [ { "id": "GLY_001158", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001158" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus main proteinase (3CLpro) structure: basis for design of anti-SARS drugs.", "journal": "Science", "date": "2003", "authors": "Anand Kanchan, Ziebuhr John, Wadhwani Parvesh, Mesters Jeroen R, Hilgenfeld Rolf", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12746549", "url": "https://glygen.org/publication/PubMed/12746549" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "The severe acute respiratory syndrome (SARS) coronavirus NTPase/helicase belongs to a distinct class of 5' to 3' viral helicases.", "journal": "The Journal of biological chemistry", "date": "2003-10-10", "authors": "Tanner Julian A, Watt Rory M, Chai Yu-Bo, Lu Lin-Yu, Lin Marie C, Peiris J S Malik, Poon Leo L M, Kung Hsiang-Fu, Huang Jian-Dong", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12917423", "url": "https://glygen.org/publication/PubMed/12917423" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "The Journal of general virology", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Structural genomics of the SARS coronavirus: cloning, expression, crystallization and preliminary crystallographic study of the Nsp9 protein.", "journal": "Acta Crystallogr. D", "date": "2003", "authors": "Campanacci Val\u00e9rie, Egloff Marie-Pierre, Longhi Sonia, Ferron Fran\u00e7ois, Rancurel Corinne, Salomoni Aurelia, Durousseau C\u00e9cile, Tocque Fabienne, Br\u00e9mond Nicolas, Dobbe Jessika C, Snijder Eric J, Canard Bruno, Cambillau Christian", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12925794", "url": "https://glygen.org/publication/PubMed/12925794" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus genotype and its characterization.", "journal": "Chin. Med. J.", "date": "2003", "authors": "Li Lanjuan, Wang Zhigang, Lu Yiyu, Bao Qiyu, Chen Suhong, Wu Nanping, Cheng Suyun, Weng Jingqing, Zhang Yanjun, Yan Juying, Mei Lingling, Wang Xiaomeng, Zhu Hanping, Yu Yingpu, Zhang Minli, Li Minhong, Yao Jun, Lu Qunying, Yao Pingping, Bo Xiaochen, Wo Jianer, Wang Shengqi, Hu Songnian", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "14527350", "url": "https://glygen.org/publication/PubMed/14527350" } ] }, { "title": "Biosynthesis, purification, and substrate specificity of severe acute respiratory syndrome coronavirus 3C-like proteinase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fan K, Wei P, Feng Q, Chen S, Huang C, Ma L, Lai B, Pei J, Liu Y, Chen J, Lai L", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "14561748", "url": "https://glygen.org/publication/PubMed/14561748" } ] }, { "title": "Phylogeny of the SARS coronavirus.", "journal": "Science", "date": "2003", "authors": "Eickmann Markus, Becker Stephan, Klenk Hans-Dieter, Doerr Hans Wilhelm, Stadler Konrad, Censini Stefano, Guidotti Silvia, Masignani Vega, Scarselli Maria, Mora Marirosa, Donati Claudio, Han Jang H, Song Hyun Chul, Abrignani Sergio, Covacci Antonello, Rappuoli Rino", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "14645828", "url": "https://glygen.org/publication/PubMed/14645828" } ] }, { "title": "The nsp9 replicase protein of SARS-coronavirus, structure and functional insights.", "journal": "Structure", "date": "2004", "authors": "Sutton Geoff, Fry Elizabeth, Carter Lester, Sainsbury Sarah, Walter Tom, Nettleship Joanne, Berrow Nick, Owens Ray, Gilbert Robert, Davidson Andrew, Siddell Stuart, Poon Leo L M, Diprose Jonathan, Alderton David, Walsh Martin, Grimes Jonathan M, Stuart David I", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "14962394", "url": "https://glygen.org/publication/PubMed/14962394" } ] }, { "title": "The severe acute respiratory syndrome-coronavirus replicative protein nsp9 is a single-stranded RNA-binding subunit unique in the RNA virus world.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Egloff Marie-Pierre, Ferron Fran\u00e7ois, Campanacci Val\u00e9rie, Longhi Sonia, Rancurel Corinne, Dutartre H\u00e9l\u00e8ne, Snijder Eric J, Gorbalenya Alexander E, Cambillau Christian, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "15007178", "url": "https://glygen.org/publication/PubMed/15007178" } ] }, { "title": "Identification and characterization of severe acute respiratory syndrome coronavirus replicase proteins.", "journal": "Journal of virology", "date": "2004", "authors": "Prentice E, McAuliffe J, Lu X, Subbarao K, Denison MR", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "15331731", "url": "https://glygen.org/publication/PubMed/15331731" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 3C-like proteinase N terminus is indispensable for proteolytic activity but not for enzyme dimerization. Biochemical and thermodynamic investigation in conjunction with molecular dynamics simulations.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Chen Shuai, Chen Lili, Tan Jinzhi, Chen Jing, Du Li, Sun Tao, Shen Jianhua, Chen Kaixian, Jiang Hualiang, Shen Xu", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "15507456", "url": "https://glygen.org/publication/PubMed/15507456" } ] }, { "title": "Identification of severe acute respiratory syndrome coronavirus replicase products and characterization of papain-like protease activity.", "journal": "Journal of virology", "date": "2004", "authors": "Harcourt BH, Jukneliene D, Kanjanahaluethai A, Bechill J, Severson KM, Smith CM, Rota PA, Baker SC", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "15564471", "url": "https://glygen.org/publication/PubMed/15564471" } ] }, { "title": "Binding interaction of SARS coronavirus 3CL(pro) protease with vacuolar-H+ ATPase G1 subunit.", "journal": "FEBS letters", "date": "2005-11-07", "authors": "Lin Cheng-Wen, Tsai Fuu-Jen, Wan Lei, Lai Chien-Chen, Lin Kuan-Hsun, Hsieh Tsung-Han, Shiu Shi-Yi, Li Jeng-Yi", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16226257", "url": "https://glygen.org/publication/PubMed/16226257" } ] }, { "title": "Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer.", "journal": "Nat. Struct. Mol. Biol.", "date": "2005", "authors": "Zhai Yujia, Sun Fei, Li Xuemei, Pang Hai, Xu Xiaoling, Bartlam Mark, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16228002", "url": "https://glygen.org/publication/PubMed/16228002" } ] }, { "title": "Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1''-phosphate dephosphorylation by a conserved domain of nsP3.", "journal": "Structure", "date": "2005", "authors": "Saikatendu Kumar Singh, Joseph Jeremiah S, Subramanian Vanitha, Clayton Tom, Griffith Mark, Moy Kin, Velasquez Jeffrey, Neuman Benjamin W, Buchmeier Michael J, Stevens Raymond C, Kuhn Peter", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16271890", "url": "https://glygen.org/publication/PubMed/16271890" } ] }, { "title": "The papain-like protease of severe acute respiratory syndrome coronavirus has deubiquitinating activity.", "journal": "Journal of virology", "date": "2005", "authors": "Barretto N, Jukneliene D, Ratia K, Chen Z, Mesecar AD, Baker SC", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" } ] }, { "title": "Discovery of an RNA virus 3'->5' exoribonuclease that is critically involved in coronavirus RNA synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-03-28", "authors": "Minskaia Ekaterina, Hertzig Tobias, Gorbalenya Alexander E, Campanacci Val\u00e9rie, Cambillau Christian, Canard Bruno, Ziebuhr John", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16549795", "url": "https://glygen.org/publication/PubMed/16549795" } ] }, { "title": "Severe acute respiratory syndrome coronavirus papain-like protease: structure of a viral deubiquitinating enzyme.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Ratia Kiira, Saikatendu Kumar Singh, Santarsiero Bernard D, Barretto Naina, Baker Susan C, Stevens Raymond C, Mesecar Andrew D", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16581910", "url": "https://glygen.org/publication/PubMed/16581910" } ] }, { "title": "RNA recognition and cleavage by the SARS coronavirus endoribonuclease.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Bhardwaj K, Sun J, Holzenburg A, Guarino LA, Kao CC", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16828802", "url": "https://glygen.org/publication/PubMed/16828802" } ] }, { "title": "Crystal structure of nonstructural protein 10 from the severe acute respiratory syndrome coronavirus reveals a novel fold with two zinc-binding motifs.", "journal": "J. Virol.", "date": "2006", "authors": "Joseph Jeremiah S, Saikatendu Kumar Singh, Subramanian Vanitha, Neuman Benjamin W, Brooun Alexei, Griffith Mark, Moy Kin, Yadav Maneesh K, Velasquez Jeffrey, Buchmeier Michael J, Stevens Raymond C, Kuhn Peter", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16873246", "url": "https://glygen.org/publication/PubMed/16873246" } ] }, { "title": "Dodecamer structure of severe acute respiratory syndrome coronavirus nonstructural protein nsp10.", "journal": "J. Virol.", "date": "2006", "authors": "Su Dan, Lou Zhiyong, Sun Fei, Zhai Yujia, Yang Haitao, Zhang Rongguang, Joachimiak Andrzej, Zhang Xuejun C, Bartlam Mark, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16873247", "url": "https://glygen.org/publication/PubMed/16873247" } ] }, { "title": "Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Ricagno Stefano, Egloff Marie-Pierre, Ulferts Rachel, Coutard Bruno, Nurizzo Didier, Campanacci Val\u00e9rie, Cambillau Christian, Ziebuhr John, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "16882730", "url": "https://glygen.org/publication/PubMed/16882730" } ] }, { "title": "A second, non-canonical RNA-dependent RNA polymerase in SARS coronavirus.", "journal": "EMBO J.", "date": "2006", "authors": "Imbert Isabelle, Guillemot Jean-Claude, Bourhis Jean-Marie, Bussetta C\u00e9cile, Coutard Bruno, Egloff Marie-Pierre, Ferron Fran\u00e7ois, Gorbalenya Alexander E, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "17024178", "url": "https://glygen.org/publication/PubMed/17024178" } ] }, { "title": "Novel beta-barrel fold in the nuclear magnetic resonance structure of the replicase nonstructural protein 1 from the severe acute respiratory syndrome coronavirus.", "journal": "J. Virol.", "date": "2007", "authors": "Almeida Marcius S, Johnson Margaret A, Herrmann Torsten, Geralt Michael, W\u00fcthrich Kurt", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "17202208", "url": "https://glygen.org/publication/PubMed/17202208" } ] }, { "title": "The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein.", "journal": "Virology", "date": "2007", "authors": "Kumar Purnima, Gunalan Vithiagaran, Liu Boping, Chow Vincent T K, Druce Julian, Birch Chris, Catton Mike, Fielding Burtram C, Tan Yee-Joo, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "17532020", "url": "https://glygen.org/publication/PubMed/17532020" } ] }, { "title": "Selectivity in ISG15 and ubiquitin recognition by the SARS coronavirus papain-like protease.", "journal": "Archives of biochemistry and biophysics", "date": "2007-10-01", "authors": "Lindner Holger A, Lytvyn Viktoria, Qi Hongtao, Lachance Paule, Ziomek Edmund, M\u00e9nard Robert", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "17692280", "url": "https://glygen.org/publication/PubMed/17692280" } ] }, { "title": "Localization and membrane topology of coronavirus nonstructural protein 4: involvement of the early secretory pathway in replication.", "journal": "J. Virol.", "date": "2007", "authors": "Oostra M, te Lintelo E G, Deijs M, Verheije M H, Rottier P J M, de Haan C A M", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "17855519", "url": "https://glygen.org/publication/PubMed/17855519" } ] }, { "title": "Structural and functional analyses of the severe acute respiratory syndrome coronavirus endoribonuclease Nsp15.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Bhardwaj K, Palaninathan S, Alcantara JMO, Li Yi L, Guarino L, Sacchettini JC, Kao CC", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "18045871", "url": "https://glygen.org/publication/PubMed/18045871" } ] }, { "title": "Coronavirus nonstructural protein 16 is a cap-0 binding enzyme possessing (nucleoside-2'O)-methyltransferase activity.", "journal": "Journal of virology", "date": "2008-08", "authors": "Decroly Etienne, Imbert Isabelle, Coutard Bruno, Bouvet Micka\u00ebl, Selisko Barbara, Alvarez Karine, Gorbalenya Alexander E, Snijder Eric J, Canard Bruno", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "18417574", "url": "https://glygen.org/publication/PubMed/18417574" } ] }, { "title": "Genome-wide analysis of protein-protein interactions and involvement of viral proteins in SARS-CoV replication.", "journal": "PLoS ONE", "date": "2008", "authors": "Pan Ji'an, Peng Xiaoxue, Gao Yajing, Li Zhilin, Lu Xiaolu, Chen Yingzhao, Ishaq Musarat, Liu Dan, Dediego Marta L, Enjuanes Luis, Guo Deyin", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "18827877", "url": "https://glygen.org/publication/PubMed/18827877" } ] }, { "title": "Topology and membrane anchoring of the coronavirus replication complex: not all hydrophobic domains of nsp3 and nsp6 are membrane spanning.", "journal": "J. Virol.", "date": "2008", "authors": "Oostra Monique, Hagemeijer Marne C, van Gent Michiel, Bekker Cornelis P J, te Lintelo Eddie G, Rottier Peter J M, de Haan Cornelis A M", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "18842706", "url": "https://glygen.org/publication/PubMed/18842706" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nsp9 dimerization is essential for efficient viral growth.", "journal": "Journal of virology", "date": "2009", "authors": "Miknis ZJ, Donaldson EF, Umland TC, Rimmer RA, Baric RS, Schultz LW", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "19153232", "url": "https://glygen.org/publication/PubMed/19153232" } ] }, { "title": "Severe acute respiratory syndrome coronavirus papain-like protease ubiquitin-like domain and catalytic domain regulate antagonism of IRF3 and NF-kappaB signaling.", "journal": "Journal of virology", "date": "2009-07", "authors": "Frieman Matthew, Ratia Kiira, Johnston Robert E, Mesecar Andrew D, Baric Ralph S", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "19369340", "url": "https://glygen.org/publication/PubMed/19369340" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nonstructural protein 2 interacts with a host protein complex involved in mitochondrial biogenesis and intracellular signaling.", "journal": "Journal of virology", "date": "2009-10", "authors": "Cornillez-Ty Cromwell T, Liao Lujian, Yates John R, Kuhn Peter, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "19640993", "url": "https://glygen.org/publication/PubMed/19640993" } ] }, { "title": "In vitro reconstitution of SARS-coronavirus mRNA cap methylation.", "journal": "PLoS pathogens", "date": "2010-04-22", "authors": "Bouvet Micka\u00ebl, Debarnot Claire, Imbert Isabelle, Selisko Barbara, Snijder Eric J, Canard Bruno, Decroly Etienne", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "20421945", "url": "https://glygen.org/publication/PubMed/20421945" } ] }, { "title": "The cellular RNA helicase DDX1 interacts with coronavirus nonstructural protein 14 and enhances viral replication.", "journal": "J. Virol.", "date": "2010", "authors": "Xu Linghui, Khadijah Siti, Fang Shouguo, Wang Li, Tay Felicia P L, Liu Ding Xiang", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "20573827", "url": "https://glygen.org/publication/PubMed/20573827" } ] }, { "title": "Mobility and interactions of coronavirus nonstructural protein 4.", "journal": "J. Virol.", "date": "2011", "authors": "Hagemeijer Marne C, Ulasli Mustafa, Vonk Annelotte M, Reggiori Fulvio, Rottier Peter J M, de Haan Cornelis A M", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "21345958", "url": "https://glygen.org/publication/PubMed/21345958" } ] }, { "title": "Coronaviruses: an RNA proofreading machine regulates replication fidelity and diversity.", "journal": "RNA biology", "date": "2011", "authors": "Denison Mark R, Graham Rachel L, Donaldson Eric F, Eckerle Lance D, Baric Ralph S", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "21593585", "url": "https://glygen.org/publication/PubMed/21593585" } ] }, { "title": "Biochemical and structural insights into the mechanisms of SARS coronavirus RNA ribose 2'-O-methylation by nsp16/nsp10 protein complex.", "journal": "PLoS pathogens", "date": "2011", "authors": "Chen Y, Su C, Ke M, Jin X, Xu L, Zhang Z, Wu A, Sun Y, Yang Z, Tien P, Ahola T, Liang Y, Liu X, Guo D", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22022266", "url": "https://glygen.org/publication/PubMed/22022266" } ] }, { "title": "The SARS-coronavirus nsp7+nsp8 complex is a unique multimeric RNA polymerase capable of both de novo initiation and primer extension.", "journal": "Nucleic acids research", "date": "2012-02", "authors": "te Velthuis Aartjan J W, van den Worm Sjoerd H E, Snijder Eric J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22039154", "url": "https://glygen.org/publication/PubMed/22039154" } ] }, { "title": "SARS coronavirus nsp1 protein induces template-dependent endonucleolytic cleavage of mRNAs: viral mRNAs are resistant to nsp1-induced RNA cleavage.", "journal": "PLoS Pathog.", "date": "2011", "authors": "Huang C, Lokugamage KG, Rozovics JM, Narayanan K, Semler BL, Makino S", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22174690", "url": "https://glygen.org/publication/PubMed/22174690" } ] }, { "title": "Mechanism of nucleic acid unwinding by SARS-CoV helicase.", "journal": "PloS one", "date": "2012", "authors": "Adedeji Adeyemi O, Marchand Bruno, Te Velthuis Aartjan J W, Snijder Eric J, Weiss Susan, Eoff Robert L, Singh Kamalendra, Sarafianos Stefan G", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22615777", "url": "https://glygen.org/publication/PubMed/22615777" } ] }, { "title": "RNA 3'-end mismatch excision by the severe acute respiratory syndrome coronavirus nonstructural protein nsp10/nsp14 exoribonuclease complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-06-12", "authors": "Bouvet Micka\u00ebl, Imbert Isabelle, Subissi Lorenzo, Gluais Laure, Canard Bruno, Decroly Etienne", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22635272", "url": "https://glygen.org/publication/PubMed/22635272" } ] }, { "title": "Biochemical characterization of a recombinant SARS coronavirus nsp12 RNA-dependent RNA polymerase capable of copying viral RNA templates.", "journal": "Archives of virology", "date": "2012-11", "authors": "Ahn Dae-Gyun, Choi Jin-Kyu, Taylor Deborah R, Oh Jong-Won", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "22791111", "url": "https://glygen.org/publication/PubMed/22791111" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein nsp1 is a novel eukaryotic translation inhibitor that represses multiple steps of translation initiation.", "journal": "Journal of virology", "date": "2012", "authors": "Lokugamage KG, Narayanan K, Huang C, Makino S", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "23035226", "url": "https://glygen.org/publication/PubMed/23035226" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nonstructural proteins 3, 4, and 6 induce double-membrane vesicles.", "journal": "mBio", "date": "2013-08-13", "authors": "Angelini Megan M, Akhlaghpour Marzieh, Neuman Benjamin W, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "23943763", "url": "https://glygen.org/publication/PubMed/23943763" } ] }, { "title": "Coronaviruses lacking exoribonuclease activity are susceptible to lethal mutagenesis: evidence for proofreading and potential therapeutics.", "journal": "PLoS pathogens", "date": "2013-08", "authors": "Smith Everett Clinton, Blanc Herv\u00e9, Surdel Matthew C, Vignuzzi Marco, Denison Mark R", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "23966862", "url": "https://glygen.org/publication/PubMed/23966862" } ] }, { "title": "Untangling membrane rearrangement in the nidovirales.", "journal": "DNA and cell biology", "date": "2014-03", "authors": "Angelini Megan Mary, Neuman Benjamin William, Buchmeier Michael J", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "24410069", "url": "https://glygen.org/publication/PubMed/24410069" } ] }, { "title": "SARS coronavirus papain-like protease inhibits the type I interferon signaling pathway through interaction with the STING-TRAF3-TBK1 complex.", "journal": "Protein & cell", "date": "2014", "authors": "Chen X, Yang X, Zheng Y, Yang Y, Xing Y, Chen Z", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "24622840", "url": "https://glygen.org/publication/PubMed/24622840" } ] }, { "title": "Coronavirus NSP6 restricts autophagosome expansion.", "journal": "Autophagy", "date": "2014-08", "authors": "Cottam Eleanor M, Whelband Matthew C, Wileman Thomas", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "24991833", "url": "https://glygen.org/publication/PubMed/24991833" } ] }, { "title": "Early endonuclease-mediated evasion of RNA sensing ensures efficient coronavirus replication.", "journal": "PLoS pathogens", "date": "2017-02", "authors": "Kindler Eveline, Gil-Cruz Cristina, Spanier Julia, Li Yize, Wilhelm Jochen, Rabouw Huib H, Z\u00fcst Roland, Hwang Mihyun, V'kovski Philip, Stalder Hanspeter, Marti Sabrina, Habjan Matthias, Cervantes-Barragan Luisa, Elliot Ruth, Karl Nadja, Gaughan Christina, van Kuppeveld Frank J M, Silverman Robert H, Keller Markus, Ludewig Burkhard, Bergmann Cornelia C, Ziebuhr John, Weiss Susan R, Kalinke Ulrich, Thiel Volker", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "28158275", "url": "https://glygen.org/publication/PubMed/28158275" } ] }, { "title": "Coronavirus Susceptibility to the Antiviral Remdesivir (GS-5734) Is Mediated by the Viral Polymerase and the Proofreading Exoribonuclease.", "journal": "mBio", "date": "2018-03-06", "authors": "Agostini Maria L, Andres Erica L, Sims Amy C, Graham Rachel L, Sheahan Timothy P, Lu Xiaotao, Smith Everett Clinton, Case James Brett, Feng Joy Y, Jordan Robert, Ray Adrian S, Cihlar Tomas, Siegel Dustin, Mackman Richard L, Clarke Michael O, Baric Ralph S, Denison Mark R", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "29511076", "url": "https://glygen.org/publication/PubMed/29511076" } ] }, { "title": "SARS coronavirus protein nsp1 disrupts localization of Nup93 from the nuclear pore complex.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2019", "authors": "Gomez GN, Abrar F, Dodhia MP, Gonzalez FG, Nag A", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "30943371", "url": "https://glygen.org/publication/PubMed/30943371" } ] }, { "title": "Processing of the SARS-CoV pp1a/ab nsp7-10 region.", "journal": "The Biochemical journal", "date": "2020", "authors": "Krichel B, Falke S, Hilgenfeld R, Redecke L, Uetrecht C", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "32083638", "url": "https://glygen.org/publication/PubMed/32083638" } ] }, { "title": "Structure-function analysis of the nsp14 N7-guanine methyltransferase reveals an essential role in Betacoronavirus replication.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Ogando NS, El Kazzi P, Zevenhoven-Dobbe JC, Bontes BW, Decombe A, Posthuma CC, Thiel V, Canard B, Ferron F, Decroly E, Snijder EJ", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "34845015", "url": "https://glygen.org/publication/PubMed/34845015" } ] }, { "title": "Human NLRP1 is a sensor of pathogenic coronavirus 3CL proteases in lung epithelial cells.", "journal": "Molecular cell", "date": "2022", "authors": "Planes R, Pinilla M, Santoni K, Hessel A, Passemar C, Lay K, Paillette P, Valadao AC, Robinson KS, Bastard P, Lam N, Fadrique R, Rossi I, Pericat D, Bagayoko S, Leon-Icaza SA, Rombouts Y, Perouzel E, Tiraby M, Zhang Q, Cicuta P, Jouanguy E, Neyrolles O, Bryant CE, Floto AR, Goujon C, Lei FZ, Martin-Blondel G, Silva S, Casanova JL, Cougoule C, Reversade B, Marcoux J, Ravet E, Meunier E", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "reference": [ { "type": "PubMed", "id": "35594856", "url": "https://glygen.org/publication/PubMed/35594856" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTD1-1", "protein_name": "Replicase polyprotein 1ab", "gene_name": "rep", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN", "length": 7096 }, "evidence": [ { "id": "UniRef50_P0C6X7", "url": "https://www.uniprot.org/uniref/UniRef50_P0C6X7", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 20, "go_terms": [ { "name": "methyltransferase cap1 activity", "id": "GO:0004483", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004483", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "RNA-directed RNA polymerase activity", "id": "GO:0003968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003968", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "omega peptidase activity", "id": "GO:0008242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008242", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "single-stranded RNA binding", "id": "GO:0003727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003727", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "endonuclease activity", "id": "GO:0004519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004519", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "G-quadruplex RNA binding", "id": "GO:0002151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002151", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase activity", "id": "GO:0004197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004197", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "lyase activity", "id": "GO:0016829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016829", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "3'-5'-RNA exonuclease activity", "id": "GO:0000175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000175", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "K63-linked deubiquitinase activity", "id": "GO:0061578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061578", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "K48-linked deubiquitinase activity", "id": "GO:1990380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990380", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "5'-3' DNA helicase activity", "id": "GO:0043139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043139", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "mRNA 5'-cap (guanine-N7-)-methyltransferase activity", "id": "GO:0004482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004482", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "mRNA guanylyltransferase activity", "id": "GO:0004484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004484", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "5'-3' RNA helicase activity", "id": "GO:0032574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032574", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "viral protein processing", "id": "GO:0019082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019082", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "viral transcription", "id": "GO:0019083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019083", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated activation of host autophagy", "id": "GO:0039520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039520", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "viral RNA genome replication", "id": "GO:0039694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039694", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host gene expression", "id": "GO:0039657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039657", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host ISG15-protein conjugation", "id": "GO:0039579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039579", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated degradation of host mRNA", "id": "GO:0039595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039595", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host ubiquitin-like protein modification", "id": "GO:0039648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039648", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "viral translational frameshifting", "id": "GO:0075523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075523", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host NF-kappaB cascade", "id": "GO:0085034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0085034", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "host cell perinuclear region of cytoplasm", "id": "GO:0044220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044220", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum-Golgi intermediate compartment", "id": "GO:0044172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044172", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum", "id": "GO:0044165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044165", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "host cell Golgi apparatus", "id": "GO:0044177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044177", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "host cell endosome", "id": "GO:0044174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044174", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" }, { "name": "double membrane vesicle viral factory outer membrane", "id": "GO:0062243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062243", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1628, "end_pos": 1630, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1696, "end_pos": 1698, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1899, "end_pos": 1901, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2079, "end_pos": 2081, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2249, "end_pos": 2251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2252, "end_pos": 2254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2507, "end_pos": 2509, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2659, "end_pos": 2661, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2685, "end_pos": 2687, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3303, "end_pos": 3305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3359, "end_pos": 3361, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3373, "end_pos": 3375, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3382, "end_pos": 3384, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3720, "end_pos": 3722, "annotation": "n_glycosylation_sequon" }, { "start_pos": 389, "end_pos": 391, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4150, "end_pos": 4152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4233, "end_pos": 4235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4240, "end_pos": 4242, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5016, "end_pos": 5018, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5280, "end_pos": 5282, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5403, "end_pos": 5405, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5558, "end_pos": 5560, "annotation": "n_glycosylation_sequon" }, { "start_pos": 556, "end_pos": 558, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5650, "end_pos": 5652, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5905, "end_pos": 5907, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6031, "end_pos": 6033, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6130, "end_pos": 6132, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6474, "end_pos": 6476, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6918, "end_pos": 6920, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6973, "end_pos": 6975, "annotation": "n_glycosylation_sequon" }, { "start_pos": 916, "end_pos": 918, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (PubMed:12917450, PubMed:15331731, PubMed:15564471, PubMed:16306590, PubMed:32083638). 3C-like proteinase nsp5 liberates nsps 6-16 from the polyprotein (PubMed:32083638). Papain-like and 3C-like proteinases are autocatalytically processed.", "evidence": [ { "database": "UniProtKB", "id": "P0C6X7", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "database": "PubMed", "id": "32083638", "url": "https://glygen.org/publication/PubMed/32083638" }, { "database": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" }, { "database": "PubMed", "id": "16306590", "url": "https://glygen.org/publication/PubMed/16306590" }, { "database": "PubMed", "id": "15564471", "url": "https://glygen.org/publication/PubMed/15564471" }, { "database": "PubMed", "id": "15331731", "url": "https://glygen.org/publication/PubMed/15331731" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01337", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01337" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "3Ecto", "eco_id": "ECO_0000255", "start_pos": 2224, "end_pos": 2294, "start_aa": "Thr", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01419", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01419" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "4Ecto", "eco_id": "ECO_0000255", "start_pos": 2776, "end_pos": 3020, "start_aa": "His", "end_aa": "Val", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01306", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01306" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "AV-Nsp11N/CoV-Nsp15M", "eco_id": "ECO_0000255", "start_pos": 6491, "end_pos": 6616, "start_aa": "Asn", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01308", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01308" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "BetaCoV Nsp1 C-terminal", "eco_id": "ECO_0000255", "start_pos": 148, "end_pos": 179, "start_aa": "Glu", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CV ZBD", "eco_id": "ECO_0000255", "start_pos": 5302, "end_pos": 5414, "start_aa": "Ala", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01307", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01307" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp1 globular", "eco_id": "ECO_0000255", "start_pos": 12, "end_pos": 127, "start_aa": "Thr", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01335", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01335" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 C-terminal", "eco_id": "ECO_0000255", "start_pos": 690, "end_pos": 818, "start_aa": "Ile", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 N-terminal", "eco_id": "ECO_0000255", "start_pos": 183, "end_pos": 456, "start_aa": "Thr", "end_aa": "Arg", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01334", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01334" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp2 middle", "eco_id": "ECO_0000255", "start_pos": 458, "end_pos": 688, "start_aa": "Arg", "end_aa": "Met", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV Nsp3 Y", "eco_id": "ECO_0000255", "start_pos": 2372, "end_pos": 2740, "start_aa": "Lys", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01289", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01289" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "DPUP", "eco_id": "ECO_0000255", "start_pos": 1472, "end_pos": 1538, "start_aa": "Thr", "end_aa": "Ser", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "ExoN", "eco_id": "ECO_0000255", "start_pos": 5974, "end_pos": 6189, "start_aa": "Met", "end_aa": "Val", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "ExoN/MTase coactivator", "eco_id": "ECO_0000255", "start_pos": 4231, "end_pos": 4369, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01338", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01338" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G2M", "eco_id": "ECO_0000255", "start_pos": 2023, "end_pos": 2132, "start_aa": "Pro", "end_aa": "Asn", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 1", "eco_id": "ECO_0000255", "start_pos": 1003, "end_pos": 1169, "start_aa": "Val", "end_aa": "Leu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 2", "eco_id": "ECO_0000255", "start_pos": 1207, "end_pos": 1335, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00490", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Macro 3", "eco_id": "ECO_0000255", "start_pos": 1343, "end_pos": 1470, "start_aa": "Ile", "end_aa": "Ser", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01299", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01299" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "N7-MTase", "eco_id": "ECO_0000255", "start_pos": 6198, "end_pos": 6429, "start_aa": "Tyr", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01303", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01303" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "NendoU", "eco_id": "ECO_0000255", "start_pos": 6633, "end_pos": 6772, "start_aa": "Lys", "end_aa": "Pro", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01292", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01292" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "NiRAN", "eco_id": "ECO_0000255", "start_pos": 4376, "end_pos": 4630, "start_aa": "Phe", "end_aa": "Leu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01300", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01300" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nidovirus-type SAM-dependent 2'-O-MTase", "eco_id": "ECO_0000255", "start_pos": 6777, "end_pos": 7071, "start_aa": "Ser", "end_aa": "Val", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01344", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01344" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp12 Interface", "eco_id": "ECO_0000255", "start_pos": 4635, "end_pos": 4733, "start_aa": "Ile", "end_aa": "Ser", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01293", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01293" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp12 RNA-dependent RNA polymerase", "eco_id": "ECO_0000255", "start_pos": 4734, "end_pos": 5301, "start_aa": "Arg", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01305", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01305" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp15 N-terminal oligomerization", "eco_id": "ECO_0000255", "start_pos": 6430, "end_pos": 6490, "start_aa": "Ser", "end_aa": "Arg", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01291", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01291" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp4C", "eco_id": "ECO_0000255", "start_pos": 3142, "end_pos": 3240, "start_aa": "Val", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01296", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01296" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nsp9 ssRNA-binding", "eco_id": "ECO_0000255", "start_pos": 4118, "end_pos": 4230, "start_aa": "Asn", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01290", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01290" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nucleic acid-binding", "eco_id": "ECO_0000255", "start_pos": 1888, "end_pos": 1998, "start_aa": "Pro", "end_aa": "Thr", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peptidase C16", "eco_id": "ECO_0000255", "start_pos": 1611, "end_pos": 1875, "start_aa": "Tyr", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00772", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00772" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peptidase C30", "eco_id": "ECO_0000255", "start_pos": 3241, "end_pos": 3546, "start_aa": "Ser", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01294", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01294" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp Nsp7 cofactor", "eco_id": "ECO_0000255", "start_pos": 3837, "end_pos": 3919, "start_aa": "Ser", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01295", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01295" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp Nsp8 cofactor", "eco_id": "ECO_0000255", "start_pos": 3920, "end_pos": 4117, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00539", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00539" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp catalytic", "eco_id": "ECO_0000255", "start_pos": 4981, "end_pos": 5143, "start_aa": "Pro", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00214", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00214" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ubiquitin-like 1", "eco_id": "ECO_0000255", "start_pos": 822, "end_pos": 930, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00214", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00214" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ubiquitin-like 2", "eco_id": "ECO_0000255", "start_pos": 1542, "end_pos": 1597, "start_aa": "Val", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [ { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1729, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1729, "end_pos": 1729, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1732, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1732, "end_pos": 1732, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1764, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1764, "end_pos": 1764, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00444", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00444" } ], "binding_site_uniprot": 1766, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "6", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 1766, "end_pos": 1766, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 200, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 200, "end_pos": 200, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 231, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 231, "end_pos": 231, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 234, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 234, "end_pos": 234, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 236, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 236, "end_pos": 236, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2376, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2376, "end_pos": 2376, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2381, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2381, "end_pos": 2381, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2386, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2386, "end_pos": 2386, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2389, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "4", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2389, "end_pos": 2389, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2422, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2422, "end_pos": 2422, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2425, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2425, "end_pos": 2425, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2429, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2429, "end_pos": 2429, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01336", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01336" } ], "binding_site_uniprot": 2432, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "5", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 2432, "end_pos": 2432, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 323, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 323, "end_pos": 323, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 326, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 326, "end_pos": 326, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 341, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 341, "end_pos": 341, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 344, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 344, "end_pos": 344, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 370, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 370, "end_pos": 370, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 373, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 373, "end_pos": 373, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 382, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 382, "end_pos": 382, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01333", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01333" } ], "binding_site_uniprot": 416, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "3", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 416, "end_pos": 416, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4304, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4304, "end_pos": 4304, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4307, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4307, "end_pos": 4307, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4313, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4313, "end_pos": 4313, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4320, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "7", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4320, "end_pos": 4320, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4347, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4347, "end_pos": 4347, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4350, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4350, "end_pos": 4350, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4358, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4358, "end_pos": 4358, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "22022266", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22022266" }, { "id": "PRU01297", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01297" } ], "binding_site_uniprot": 4360, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "8", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4360, "end_pos": 4360, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 4578, "amino_acid": "Asn", "chebi_lig_id": "CHEBI_29035", "ligand": "Mn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 4578, "end_pos": 4578, "start_aa": "Asn", "end_aa": "Asn", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 4587, "amino_acid": "Asp", "chebi_lig_id": "CHEBI_29035", "ligand": "Mn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 4587, "end_pos": 4587, "start_aa": "Asp", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01344", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01344" } ], "binding_site_uniprot": 4664, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "9", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4664, "end_pos": 4664, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01344", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01344" } ], "binding_site_uniprot": 4670, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "9", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4670, "end_pos": 4670, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01344", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01344" } ], "binding_site_uniprot": 4675, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "9", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4675, "end_pos": 4675, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01344", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01344" } ], "binding_site_uniprot": 4679, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "9", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4679, "end_pos": 4679, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01293", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01293" } ], "binding_site_uniprot": 4856, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "10", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 4856, "end_pos": 4856, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01293", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01293" } ], "binding_site_uniprot": 5011, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "10", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5011, "end_pos": 5011, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01293", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01293" } ], "binding_site_uniprot": 5014, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "10", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5014, "end_pos": 5014, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01293", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01293" } ], "binding_site_uniprot": 5015, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "10", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5015, "end_pos": 5015, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5306, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "11", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5306, "end_pos": 5306, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5309, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "11", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5309, "end_pos": 5309, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5317, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "12", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5317, "end_pos": 5317, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5320, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "12", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5320, "end_pos": 5320, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5327, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "11", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5327, "end_pos": 5327, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5330, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "11", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5330, "end_pos": 5330, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5334, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "12", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5334, "end_pos": 5334, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5340, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "12", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5340, "end_pos": 5340, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5351, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "13", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5351, "end_pos": 5351, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5356, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "13", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5356, "end_pos": 5356, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5373, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "13", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5373, "end_pos": 5373, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU00986", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00986" } ], "binding_site_uniprot": 5376, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "13", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 5376, "end_pos": 5376, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 5994, "amino_acid": "Glu", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 5994, "end_pos": 5994, "start_aa": "Glu", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 6093, "amino_acid": "Glu", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 6093, "end_pos": 6093, "start_aa": "Glu", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6109, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "14", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6109, "end_pos": 6109, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6112, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "14", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6112, "end_pos": 6112, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6128, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "14", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6128, "end_pos": 6128, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6131, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "14", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6131, "end_pos": 6131, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6159, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "15", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6159, "end_pos": 6159, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6163, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "15", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6163, "end_pos": 6163, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6166, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "15", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6166, "end_pos": 6166, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 6170, "amino_acid": "His", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 6170, "end_pos": 6170, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" } ], "binding_site_uniprot": 6175, "amino_acid": "Asp", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000250", "start_pos": 6175, "end_pos": 6175, "start_aa": "Asp", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01298", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01298" } ], "binding_site_uniprot": 6181, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "15", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6181, "end_pos": 6181, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01299", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01299" } ], "binding_site_uniprot": 6354, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "16", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6354, "end_pos": 6354, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01299", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01299" } ], "binding_site_uniprot": 6375, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "16", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6375, "end_pos": 6375, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01299", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01299" } ], "binding_site_uniprot": 6386, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "16", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6386, "end_pos": 6386, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7#function" }, { "id": "P0C6X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0C6X7" }, { "id": "PRU01299", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01299" } ], "binding_site_uniprot": 6389, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "16", "uniprotkb_ligand_comment": "", "eco_id": "ECO_0000255", "start_pos": 6389, "end_pos": 6389, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.1.1.57", "ec_name": "a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-ribonucleoside in mRNA + S-adenosyl-L-methionine = a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-(2'-O-methyl-ribonucleoside) in mRNA + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "2.1.1.57", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.1.1.57" }, { "id": "2.1.1.57", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.57" } ] }, { "ec_number": "2.7.7.48", "ec_name": "RNA(n) + a ribonucleoside 5'-triphosphate = RNA(n+1) + diphosphate.", "evidence": [ { "id": "2.7.7.48", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.48" }, { "id": "2.7.7.48", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.48" } ] }, { "ec_number": "3.4.19.12", "ec_name": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "3.4.19.12", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.19.12" } ] }, { "ec_number": "3.6.4.12", "ec_name": "ATP + H2O = ADP + phosphate + H(+).", "evidence": [ { "id": "3.6.4.12", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:3.6.4.12" } ] }, { "ec_number": "2.1.1.56", "ec_name": "a 5'-end (5'-triphosphoguanosine)-ribonucleoside in mRNA + S-adenosyl-L-methionine = a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-ribonucleoside in mRNA + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "2.1.1.56", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.1.1.56" }, { "id": "2.1.1.56", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.56" } ] }, { "ec_number": "3.6.4.13", "ec_name": "ATP + H2O = ADP + phosphate + H(+).", "evidence": [ { "id": "3.6.4.13", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:3.6.4.13" }, { "id": "3.6.4.13", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.6.4.13" } ] }, { "ec_number": "2.7.7.50", "ec_name": "a 5'-end diphospho-ribonucleoside in mRNA + GTP + H(+) = a 5'-end (5'-triphosphoguanosine)-ribonucleoside in mRNA + diphosphate.", "evidence": [ { "id": "2.7.7.50", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.50" }, { "id": "2.7.7.50", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.50" } ] }, { "ec_number": "3.4.22.69", "ec_name": "TSAVLQ-|-SGFRK-NH2 and SGVTFQ-|-GKFKK the two peptides corresponding to the two self-cleavage sites of the SARS 3C-like proteinase are the two most reactive peptide substrates. The enzyme exhibits a strong preference for substrates containing Gln at P1 position and Leu at P2 position.", "evidence": [] } ], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 998 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1628, "end_pos": 1630 }, { "start_pos": 1696, "end_pos": 1698 }, { "start_pos": 1899, "end_pos": 1901 }, { "start_pos": 2079, "end_pos": 2081 }, { "start_pos": 2249, "end_pos": 2251 }, { "start_pos": 2252, "end_pos": 2254 }, { "start_pos": 2507, "end_pos": 2509 }, { "start_pos": 2659, "end_pos": 2661 }, { "start_pos": 2685, "end_pos": 2687 }, { "start_pos": 3303, "end_pos": 3305 }, { "start_pos": 3359, "end_pos": 3361 }, { "start_pos": 3373, "end_pos": 3375 }, { "start_pos": 3382, "end_pos": 3384 }, { "start_pos": 3720, "end_pos": 3722 }, { "start_pos": 389, "end_pos": 391 }, { "start_pos": 4150, "end_pos": 4152 }, { "start_pos": 4233, "end_pos": 4235 }, { "start_pos": 4240, "end_pos": 4242 }, { "start_pos": 48, "end_pos": 50 }, { "start_pos": 5016, "end_pos": 5018 }, { "start_pos": 5280, "end_pos": 5282 }, { "start_pos": 5403, "end_pos": 5405 }, { "start_pos": 5558, "end_pos": 5560 }, { "start_pos": 556, "end_pos": 558 }, { "start_pos": 5650, "end_pos": 5652 }, { "start_pos": 5905, "end_pos": 5907 }, { "start_pos": 6031, "end_pos": 6033 }, { "start_pos": 6130, "end_pos": 6132 }, { "start_pos": 6474, "end_pos": 6476 }, { "start_pos": 6918, "end_pos": 6920 }, { "start_pos": 6973, "end_pos": 6975 }, { "start_pos": 916, "end_pos": 918 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 62 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59594-1", "uniprot_ac": "P59594", "uniprot_id": "SPIKE_SARS", "mass": { "chemical_mass": 139125.0, "monoisotopic_mass": 139125.0 }, "refseq": {}, "gene_names": [ { "name": "S", "type": "recommended", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594" } ] }, { "name": "2", "type": "synonym", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594" } ] } ], "protein_names": [ { "name": "Spike glycoprotein", "type": "recommended", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594/entry#names_and_taxonomy" } ] }, { "name": "E2", "type": "synonym", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594/entry#names_and_taxonomy" } ] }, { "name": "Peplomer protein", "type": "synonym", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594/entry#names_and_taxonomy" } ] }, { "name": "S glycoprotein", "type": "synonym", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594#function" }, { "database": "PubMed", "id": "19321428", "url": "https://glygen.org/publication/PubMed/19321428" }, { "database": "HAMAP", "id": "MF_04099", "url": "https://hamap.expasy.org/signature/MF_04099" } ] }, { "annotation": "Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection (By similarity). Binding to human ACE2 and CLEC4M/DC-SIGNR receptors and internalization of the virus into the endosomes of the host cell induces conformational changes in the S glycoprotein. Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membrane fusion within endosomes.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594#function" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" }, { "database": "PubMed", "id": "15496474", "url": "https://glygen.org/publication/PubMed/15496474" }, { "database": "HAMAP", "id": "MF_04099", "url": "https://hamap.expasy.org/signature/MF_04099" } ] }, { "annotation": "May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594#function" }, { "database": "PubMed", "id": "31199522", "url": "https://glygen.org/publication/PubMed/31199522" } ] }, { "annotation": "Mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594#function" }, { "database": "HAMAP", "id": "MF_04099", "url": "https://hamap.expasy.org/signature/MF_04099" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 1251, "end_pos": 1251, "sequence_org": "K", "sequence_mut": "A", "comment": "Decrease in Golgi localization, and complete loss of COPI binding; when associated with A-1253.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "17166901", "url": "https://glygen.org/publication/PubMed/17166901" } ] }, { "start_pos": 1253, "end_pos": 1253, "sequence_org": "H", "sequence_mut": "A", "comment": "Decrease in Golgi localization, and complete loss of COPI binding; when associated with A-1251.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "17166901", "url": "https://glygen.org/publication/PubMed/17166901" } ] }, { "start_pos": 323, "end_pos": 323, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 348, "end_pos": 348, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 452, "end_pos": 452, "sequence_org": "E", "sequence_mut": "A", "comment": "90% loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 454, "end_pos": 454, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 463, "end_pos": 463, "sequence_org": "D", "sequence_mut": "A", "comment": "Partial loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 467, "end_pos": 467, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 474, "end_pos": 474, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 480, "end_pos": 480, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on human ACE2 binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "start_pos": 667, "end_pos": 667, "sequence_org": "R", "sequence_mut": "S", "comment": "40% loss of cell-cell fusion.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "16519916", "url": "https://glygen.org/publication/PubMed/16519916" } ] }, { "start_pos": 672, "end_pos": 672, "sequence_org": "K", "sequence_mut": "S", "comment": "No effect on cell-cell fusion.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "16519916", "url": "https://glygen.org/publication/PubMed/16519916" } ] }, { "start_pos": 797, "end_pos": 797, "sequence_org": "R", "sequence_mut": "N", "comment": "Complete loss of trypsin-induced membrane fusion.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "19321428", "url": "https://glygen.org/publication/PubMed/19321428" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "S", "url": "https://www.uniprot.org/uniprotkb/P59594", "locus": {} } ], "crossref": [ { "id": "CHEMBL4802007", "url": "https://www.ebi.ac.uk/chembl/target/inspect/CHEMBL4802007", "database": "ChEMBL", "categories": [ "Chemical" ] }, { "id": "1WNC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1WNC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1WYY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1WYY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1ZV7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1ZV7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1ZV8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1ZV8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1ZVA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1ZVA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1ZVB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1ZVB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2AJF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2AJF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BEQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BEQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2BEZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2BEZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2DD8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2DD8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FXP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FXP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GHV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GHV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GHW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GHW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RUM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RUM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RUN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RUN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RUO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RUO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3BGF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3BGF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3D0G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3D0G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3D0H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3D0H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3D0I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3D0I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SCI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SCI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SCJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SCJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SCK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SCK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SCL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SCL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WRG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WRG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5X4S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5X4S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5X58", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5X58&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5X5B", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5X5B&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XJK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XJK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XLR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XLR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5ZVM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5ZVM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6ACC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6ACC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6ACD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6ACD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6ACG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6ACG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6ACJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6ACJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6ACK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6ACK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CRV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CRV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CRW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CRW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CRX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CRX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CRZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CRZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CS0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CS0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CS1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CS1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6CS2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6CS2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M3W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M3W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NB6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NB6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NB7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NB7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6VW1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6VW1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6WAQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6WAQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7AKJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7AKJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7FC6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7FC6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7JN5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7JN5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7RKS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7RKS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SG4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SG4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7WR9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7WR9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7WSF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7WSF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7WSG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7WSG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7X2J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7X2J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7X7V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7X7V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y3N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y3N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7ZH1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7ZH1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7ZH2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7ZH2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7ZH5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7ZH5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H0X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H0X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H0Y", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H0Y&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H0Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H0Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H10", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H10&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H11", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H11&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H12", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H12&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H13", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H13&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H14", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H14&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H15", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H15&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H16", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H16&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JAG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JAG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KDM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KDM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KDS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KDS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KDT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KDT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KEK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KEK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SPH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SPH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SPI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SPI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8TC5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8TC5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VPF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VPF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8WCG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8WCG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8WOZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8WOZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XZB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XZB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59594", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59594*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018548", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018548", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032500", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032500", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043002", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043002", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043473", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043473", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044370", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044370", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044873", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044873", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044874", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044874", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001wnc", "url": "https://www.rcsb.org/structure/pdb_00001wnc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001wyy", "url": "https://www.rcsb.org/structure/pdb_00001wyy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001zv7", "url": "https://www.rcsb.org/structure/pdb_00001zv7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001zv8", "url": "https://www.rcsb.org/structure/pdb_00001zv8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001zva", "url": "https://www.rcsb.org/structure/pdb_00001zva", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001zvb", "url": "https://www.rcsb.org/structure/pdb_00001zvb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ajf", "url": "https://www.rcsb.org/structure/pdb_00002ajf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002beq", "url": "https://www.rcsb.org/structure/pdb_00002beq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002bez", "url": "https://www.rcsb.org/structure/pdb_00002bez", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002dd8", "url": "https://www.rcsb.org/structure/pdb_00002dd8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fxp", "url": "https://www.rcsb.org/structure/pdb_00002fxp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ghv", "url": "https://www.rcsb.org/structure/pdb_00002ghv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ghw", "url": "https://www.rcsb.org/structure/pdb_00002ghw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002rum", "url": "https://www.rcsb.org/structure/pdb_00002rum", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002run", "url": "https://www.rcsb.org/structure/pdb_00002run", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ruo", "url": "https://www.rcsb.org/structure/pdb_00002ruo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003bgf", "url": "https://www.rcsb.org/structure/pdb_00003bgf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003d0g", "url": "https://www.rcsb.org/structure/pdb_00003d0g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003d0h", "url": "https://www.rcsb.org/structure/pdb_00003d0h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003d0i", "url": "https://www.rcsb.org/structure/pdb_00003d0i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sci", "url": "https://www.rcsb.org/structure/pdb_00003sci", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003scj", "url": "https://www.rcsb.org/structure/pdb_00003scj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sck", "url": "https://www.rcsb.org/structure/pdb_00003sck", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003scl", "url": "https://www.rcsb.org/structure/pdb_00003scl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wrg", "url": "https://www.rcsb.org/structure/pdb_00005wrg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005x4s", "url": "https://www.rcsb.org/structure/pdb_00005x4s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005x58", "url": "https://www.rcsb.org/structure/pdb_00005x58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005x5b", "url": "https://www.rcsb.org/structure/pdb_00005x5b", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xjk", "url": "https://www.rcsb.org/structure/pdb_00005xjk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xlr", "url": "https://www.rcsb.org/structure/pdb_00005xlr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005zvm", "url": "https://www.rcsb.org/structure/pdb_00005zvm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006acc", "url": "https://www.rcsb.org/structure/pdb_00006acc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006acd", "url": "https://www.rcsb.org/structure/pdb_00006acd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006acg", "url": "https://www.rcsb.org/structure/pdb_00006acg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006acj", "url": "https://www.rcsb.org/structure/pdb_00006acj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ack", "url": "https://www.rcsb.org/structure/pdb_00006ack", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006crv", "url": "https://www.rcsb.org/structure/pdb_00006crv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006crw", "url": "https://www.rcsb.org/structure/pdb_00006crw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006crx", "url": "https://www.rcsb.org/structure/pdb_00006crx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006crz", "url": "https://www.rcsb.org/structure/pdb_00006crz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006cs0", "url": "https://www.rcsb.org/structure/pdb_00006cs0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006cs1", "url": "https://www.rcsb.org/structure/pdb_00006cs1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006cs2", "url": "https://www.rcsb.org/structure/pdb_00006cs2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m3w", "url": "https://www.rcsb.org/structure/pdb_00006m3w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nb6", "url": "https://www.rcsb.org/structure/pdb_00006nb6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nb7", "url": "https://www.rcsb.org/structure/pdb_00006nb7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006vw1", "url": "https://www.rcsb.org/structure/pdb_00006vw1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006waq", "url": "https://www.rcsb.org/structure/pdb_00006waq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007akj", "url": "https://www.rcsb.org/structure/pdb_00007akj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007fc6", "url": "https://www.rcsb.org/structure/pdb_00007fc6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007jn5", "url": "https://www.rcsb.org/structure/pdb_00007jn5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007rks", "url": "https://www.rcsb.org/structure/pdb_00007rks", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007sg4", "url": "https://www.rcsb.org/structure/pdb_00007sg4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007wr9", "url": "https://www.rcsb.org/structure/pdb_00007wr9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007wsf", "url": "https://www.rcsb.org/structure/pdb_00007wsf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007wsg", "url": "https://www.rcsb.org/structure/pdb_00007wsg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007x2j", "url": "https://www.rcsb.org/structure/pdb_00007x2j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007x7v", "url": "https://www.rcsb.org/structure/pdb_00007x7v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y3n", "url": "https://www.rcsb.org/structure/pdb_00007y3n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007zh1", "url": "https://www.rcsb.org/structure/pdb_00007zh1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007zh2", "url": "https://www.rcsb.org/structure/pdb_00007zh2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007zh5", "url": "https://www.rcsb.org/structure/pdb_00007zh5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h0x", "url": "https://www.rcsb.org/structure/pdb_00008h0x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h0y", "url": "https://www.rcsb.org/structure/pdb_00008h0y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h0z", "url": "https://www.rcsb.org/structure/pdb_00008h0z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h10", "url": "https://www.rcsb.org/structure/pdb_00008h10", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h11", "url": "https://www.rcsb.org/structure/pdb_00008h11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h12", "url": "https://www.rcsb.org/structure/pdb_00008h12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h13", "url": "https://www.rcsb.org/structure/pdb_00008h13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h14", "url": "https://www.rcsb.org/structure/pdb_00008h14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h15", "url": "https://www.rcsb.org/structure/pdb_00008h15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h16", "url": "https://www.rcsb.org/structure/pdb_00008h16", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jag", "url": "https://www.rcsb.org/structure/pdb_00008jag", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kdm", "url": "https://www.rcsb.org/structure/pdb_00008kdm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kds", "url": "https://www.rcsb.org/structure/pdb_00008kds", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kdt", "url": "https://www.rcsb.org/structure/pdb_00008kdt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kek", "url": "https://www.rcsb.org/structure/pdb_00008kek", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sph", "url": "https://www.rcsb.org/structure/pdb_00008sph", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008spi", "url": "https://www.rcsb.org/structure/pdb_00008spi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008tc5", "url": "https://www.rcsb.org/structure/pdb_00008tc5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vpf", "url": "https://www.rcsb.org/structure/pdb_00008vpf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008wcg", "url": "https://www.rcsb.org/structure/pdb_00008wcg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008woz", "url": "https://www.rcsb.org/structure/pdb_00008woz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xzb", "url": "https://www.rcsb.org/structure/pdb_00008xzb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WNC", "url": "https://www.rcsb.org/structure/1WNC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WYY", "url": "https://www.rcsb.org/structure/1WYY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZV7", "url": "https://www.rcsb.org/structure/1ZV7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZV8", "url": "https://www.rcsb.org/structure/1ZV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZVA", "url": "https://www.rcsb.org/structure/1ZVA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZVB", "url": "https://www.rcsb.org/structure/1ZVB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AJF", "url": "https://www.rcsb.org/structure/2AJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BEQ", "url": "https://www.rcsb.org/structure/2BEQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BEZ", "url": "https://www.rcsb.org/structure/2BEZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2DD8", "url": "https://www.rcsb.org/structure/2DD8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FXP", "url": "https://www.rcsb.org/structure/2FXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GHV", "url": "https://www.rcsb.org/structure/2GHV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GHW", "url": "https://www.rcsb.org/structure/2GHW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RUM", "url": "https://www.rcsb.org/structure/2RUM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RUN", "url": "https://www.rcsb.org/structure/2RUN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RUO", "url": "https://www.rcsb.org/structure/2RUO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BGF", "url": "https://www.rcsb.org/structure/3BGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D0G", "url": "https://www.rcsb.org/structure/3D0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D0H", "url": "https://www.rcsb.org/structure/3D0H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D0I", "url": "https://www.rcsb.org/structure/3D0I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SCI", "url": "https://www.rcsb.org/structure/3SCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SCJ", "url": "https://www.rcsb.org/structure/3SCJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SCK", "url": "https://www.rcsb.org/structure/3SCK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SCL", "url": "https://www.rcsb.org/structure/3SCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WRG", "url": "https://www.rcsb.org/structure/5WRG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X4S", "url": "https://www.rcsb.org/structure/5X4S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X58", "url": "https://www.rcsb.org/structure/5X58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X5B", "url": "https://www.rcsb.org/structure/5X5B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XJK", "url": "https://www.rcsb.org/structure/5XJK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XLR", "url": "https://www.rcsb.org/structure/5XLR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZVM", "url": "https://www.rcsb.org/structure/5ZVM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACC", "url": "https://www.rcsb.org/structure/6ACC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACD", "url": "https://www.rcsb.org/structure/6ACD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACG", "url": "https://www.rcsb.org/structure/6ACG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACJ", "url": "https://www.rcsb.org/structure/6ACJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACK", "url": "https://www.rcsb.org/structure/6ACK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CRV", "url": "https://www.rcsb.org/structure/6CRV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CRW", "url": "https://www.rcsb.org/structure/6CRW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CRX", "url": "https://www.rcsb.org/structure/6CRX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CRZ", "url": "https://www.rcsb.org/structure/6CRZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CS0", "url": "https://www.rcsb.org/structure/6CS0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CS1", "url": "https://www.rcsb.org/structure/6CS1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CS2", "url": "https://www.rcsb.org/structure/6CS2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M3W", "url": "https://www.rcsb.org/structure/6M3W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NB6", "url": "https://www.rcsb.org/structure/6NB6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NB7", "url": "https://www.rcsb.org/structure/6NB7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VW1", "url": "https://www.rcsb.org/structure/6VW1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WAQ", "url": "https://www.rcsb.org/structure/6WAQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AKJ", "url": "https://www.rcsb.org/structure/7AKJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FC6", "url": "https://www.rcsb.org/structure/7FC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JN5", "url": "https://www.rcsb.org/structure/7JN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RKS", "url": "https://www.rcsb.org/structure/7RKS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SG4", "url": "https://www.rcsb.org/structure/7SG4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WR9", "url": "https://www.rcsb.org/structure/7WR9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WSF", "url": "https://www.rcsb.org/structure/7WSF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WSG", "url": "https://www.rcsb.org/structure/7WSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7X2J", "url": "https://www.rcsb.org/structure/7X2J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7X7V", "url": "https://www.rcsb.org/structure/7X7V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y3N", "url": "https://www.rcsb.org/structure/7Y3N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZH1", "url": "https://www.rcsb.org/structure/7ZH1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZH2", "url": "https://www.rcsb.org/structure/7ZH2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZH5", "url": "https://www.rcsb.org/structure/7ZH5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0X", "url": "https://www.rcsb.org/structure/8H0X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0Y", "url": "https://www.rcsb.org/structure/8H0Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0Z", "url": "https://www.rcsb.org/structure/8H0Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H10", "url": "https://www.rcsb.org/structure/8H10", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H11", "url": "https://www.rcsb.org/structure/8H11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H12", "url": "https://www.rcsb.org/structure/8H12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H13", "url": "https://www.rcsb.org/structure/8H13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H14", "url": "https://www.rcsb.org/structure/8H14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H15", "url": "https://www.rcsb.org/structure/8H15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H16", "url": "https://www.rcsb.org/structure/8H16", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JAG", "url": "https://www.rcsb.org/structure/8JAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KDM", "url": "https://www.rcsb.org/structure/8KDM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KDS", "url": "https://www.rcsb.org/structure/8KDS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KDT", "url": "https://www.rcsb.org/structure/8KDT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KEK", "url": "https://www.rcsb.org/structure/8KEK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SPH", "url": "https://www.rcsb.org/structure/8SPH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SPI", "url": "https://www.rcsb.org/structure/8SPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TC5", "url": "https://www.rcsb.org/structure/8TC5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VPF", "url": "https://www.rcsb.org/structure/8VPF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8WCG", "url": "https://www.rcsb.org/structure/8WCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8WOZ", "url": "https://www.rcsb.org/structure/8WOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XZB", "url": "https://www.rcsb.org/structure/8XZB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01601", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01601", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF09408", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF09408", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16451", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16451", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59594-1", "url": "https://www.uniprot.org/uniprotkb/P59594-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT", "length": 1255, "header": "sp|P59594-1|SPIKE_SARS Isoform 1 of Spike glycoprotein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=S PE=1 SV=1 CANONICAL=P59594-1" }, "isoforms": [ { "isoform_ac": "P59594-1", "url": "https://www.uniprot.org/uniprotkb/P59594/entry#P59594-1", "sequence": { "sequence": "MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT", "length": 1255, "header": "sp|P59594-1|SPIKE_SARS Isoform 1 of Spike glycoprotein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=S PE=1 SV=1 CANONICAL=P59594-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1056, "start_aa": "Asn", "end_pos": 1056, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1056", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.A:1056;+center+selection;+zoom+selection" }, "start_pos": 1056, "start_aa": "Asn", "end_pos": 1056, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1056", "evidence": [ { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB6|A|1056", "database": "", "url": "" }, { "id": "6NB7|A|1056", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:1056;+center+selection;+zoom+selection" }, "start_pos": 1056, "start_aa": "Asn", "end_pos": 1056, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1056", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "5X58|C|1056", "database": "", "url": "" }, { "id": "5X58|B|1056", "database": "", "url": "" }, { "id": "5X58|A|1056", "database": "", "url": "" }, { "id": "6CRV|A|1056", "database": "", "url": "" }, { "id": "6CRV|B|1056", "database": "", "url": "" }, { "id": "6CRV|C|1056", "database": "", "url": "" }, { "id": "6CRW|C|1056", "database": "", "url": "" }, { "id": "6CRW|A|1056", "database": "", "url": "" }, { "id": "6CRZ|A|1056", "database": "", "url": "" }, { "id": "6CRZ|C|1056", "database": "", "url": "" }, { "id": "6CS0|C|1056", "database": "", "url": "" }, { "id": "6CS0|A|1056", "database": "", "url": "" }, { "id": "6CS1|A|1056", "database": "", "url": "" }, { "id": "6CS1|B|1056", "database": "", "url": "" }, { "id": "6CS1|C|1056", "database": "", "url": "" }, { "id": "6CS2|C|1056", "database": "", "url": "" }, { "id": "6CS2|B|1056", "database": "", "url": "" }, { "id": "6M3W|C|1056", "database": "", "url": "" }, { "id": "6M3W|B|1056", "database": "", "url": "" }, { "id": "6M3W|A|1056", "database": "", "url": "" }, { "id": "7AKJ|C|1056", "database": "", "url": "" }, { "id": "7AKJ|B|1056", "database": "", "url": "" }, { "id": "7AKJ|A|1056", "database": "", "url": "" }, { "id": "7SG4|C|1056", "database": "", "url": "" }, { "id": "7SG4|B|1056", "database": "", "url": "" }, { "id": "7SG4|A|1056", "database": "", "url": "" }, { "id": "7ZH5|B|1056", "database": "", "url": "" }, { "id": "7ZH5|C|1056", "database": "", "url": "" }, { "id": "7ZH5|A|1056", "database": "", "url": "" }, { "id": "8H0Y|C|1056", "database": "", "url": "" }, { "id": "8H0Y|B|1056", "database": "", "url": "" }, { "id": "8H0Y|A|1056", "database": "", "url": "" }, { "id": "8H0Z|C|1056", "database": "", "url": "" }, { "id": "8H0Z|B|1056", "database": "", "url": "" }, { "id": "8H0Z|A|1056", "database": "", "url": "" }, { "id": "8H10|C|1056", "database": "", "url": "" }, { "id": "8H10|B|1056", "database": "", "url": "" }, { "id": "8H10|A|1056", "database": "", "url": "" }, { "id": "8H11|C|1056", "database": "", "url": "" }, { "id": "8H11|B|1056", "database": "", "url": "" }, { "id": "8H11|A|1056", "database": "", "url": "" }, { "id": "8H12|C|1056", "database": "", "url": "" }, { "id": "8H12|B|1056", "database": "", "url": "" }, { "id": "8H12|A|1056", "database": "", "url": "" }, { "id": "8H13|C|1056", "database": "", "url": "" }, { "id": "8H13|B|1056", "database": "", "url": "" }, { "id": "8H13|A|1056", "database": "", "url": "" }, { "id": "8H16|C|1056", "database": "", "url": "" }, { "id": "8H16|B|1056", "database": "", "url": "" }, { "id": "8H16|A|1056", "database": "", "url": "" }, { "id": "8VPF|C|1056", "database": "", "url": "" }, { "id": "8VPF|B|1056", "database": "", "url": "" }, { "id": "8VPF|A|1056", "database": "", "url": "" } ] }, { "glytoucan_ac": "G22573RC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS2&bu=0&command=select+.B:1080;+center+selection;+zoom+selection" }, "start_pos": 1080, "start_aa": "Asn", "end_pos": 1080, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1080", "evidence": [ { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6CS2|B|1080", "database": "", "url": "" }, { "id": "6NB6|B|1080", "database": "", "url": "" }, { "id": "6NB7|B|1080", "database": "", "url": "" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.C:1080;+center+selection;+zoom+selection" }, "start_pos": 1080, "start_aa": "Asn", "end_pos": 1080, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1080", "evidence": [ { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6|C|1080", "database": "", "url": "" }, { "id": "6NB6|A|1080", "database": "", "url": "" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS2&bu=0&command=select+.C:1080;+center+selection;+zoom+selection" }, "start_pos": 1080, "start_aa": "Asn", "end_pos": 1080, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1080", "evidence": [ { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6CS2|C|1080", "database": "", "url": "" }, { "id": "6CS2|A|1080", "database": "", "url": "" }, { "id": "6NB7|C|1080", "database": "", "url": "" }, { "id": "6NB7|A|1080", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRV&bu=0&command=select+.A:1080;+center+selection;+zoom+selection" }, "start_pos": 1080, "start_aa": "Asn", "end_pos": 1080, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1080", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "6CRV|A|1080", "database": "", "url": "" }, { "id": "6CRV|B|1080", "database": "", "url": "" }, { "id": "6CRV|C|1080", "database": "", "url": "" }, { "id": "6CRW|B|1080", "database": "", "url": "" }, { "id": "6CRZ|B|1080", "database": "", "url": "" }, { "id": "6CS0|B|1080", "database": "", "url": "" }, { "id": "6M3W|C|1080", "database": "", "url": "" }, { "id": "6M3W|B|1080", "database": "", "url": "" }, { "id": "6M3W|A|1080", "database": "", "url": "" }, { "id": "7AKJ|C|1080", "database": "", "url": "" }, { "id": "7AKJ|B|1080", "database": "", "url": "" }, { "id": "7AKJ|A|1080", "database": "", "url": "" }, { "id": "7SG4|C|1080", "database": "", "url": "" }, { "id": "7SG4|B|1080", "database": "", "url": "" }, { "id": "7SG4|A|1080", "database": "", "url": "" }, { "id": "7ZH5|B|1080", "database": "", "url": "" }, { "id": "7ZH5|A|1080", "database": "", "url": "" }, { "id": "8H0Y|C|1080", "database": "", "url": "" }, { "id": "8H0Y|B|1080", "database": "", "url": "" }, { "id": "8H0Y|A|1080", "database": "", "url": "" }, { "id": "8H0Z|C|1080", "database": "", "url": "" }, { "id": "8H0Z|B|1080", "database": "", "url": "" }, { "id": "8H0Z|A|1080", "database": "", "url": "" }, { "id": "8H10|C|1080", "database": "", "url": "" }, { "id": "8H10|B|1080", "database": "", "url": "" }, { "id": "8H10|A|1080", "database": "", "url": "" }, { "id": "8H11|C|1080", "database": "", "url": "" }, { "id": "8H11|B|1080", "database": "", "url": "" }, { "id": "8H11|A|1080", "database": "", "url": "" }, { "id": "8H12|C|1080", "database": "", "url": "" }, { "id": "8H12|B|1080", "database": "", "url": "" }, { "id": "8H12|A|1080", "database": "", "url": "" }, { "id": "8H13|C|1080", "database": "", "url": "" }, { "id": "8H13|B|1080", "database": "", "url": "" }, { "id": "8H13|A|1080", "database": "", "url": "" }, { "id": "8H14|C|1080", "database": "", "url": "" }, { "id": "8H14|B|1080", "database": "", "url": "" }, { "id": "8H14|A|1080", "database": "", "url": "" }, { "id": "8H15|C|1080", "database": "", "url": "" }, { "id": "8H15|B|1080", "database": "", "url": "" }, { "id": "8H15|A|1080", "database": "", "url": "" }, { "id": "8H16|C|1080", "database": "", "url": "" }, { "id": "8H16|B|1080", "database": "", "url": "" }, { "id": "8H16|A|1080", "database": "", "url": "" }, { "id": "8H0X|C|1080", "database": "", "url": "" }, { "id": "8H0X|B|1080", "database": "", "url": "" }, { "id": "8H0X|A|1080", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X4S&bu=0&command=select+.A:109;+center+selection;+zoom+selection" }, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X4S", "database": "PDB", "url": "https://www.rcsb.org/structure/5X4S" }, { "id": "5X4S", "database": "PDB", "url": "https://www.rcsb.org/structure/5X4S" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X4S|A|109", "database": "", "url": "" }, { "id": "7SG4|C|109", "database": "", "url": "" }, { "id": "7SG4|B|109", "database": "", "url": "" }, { "id": "7SG4|A|109", "database": "", "url": "" }, { "id": "7ZH2|C|109", "database": "", "url": "" }, { "id": "7ZH2|B|109", "database": "", "url": "" }, { "id": "7ZH2|A|109", "database": "", "url": "" }, { "id": "8H0Y|C|109", "database": "", "url": "" }, { "id": "8H0Y|B|109", "database": "", "url": "" }, { "id": "8H0Y|A|109", "database": "", "url": "" }, { "id": "8H0Z|C|109", "database": "", "url": "" }, { "id": "8H0Z|B|109", "database": "", "url": "" }, { "id": "8H0Z|A|109", "database": "", "url": "" }, { "id": "8H10|C|109", "database": "", "url": "" }, { "id": "8H10|B|109", "database": "", "url": "" }, { "id": "8H10|A|109", "database": "", "url": "" }, { "id": "8H12|C|109", "database": "", "url": "" }, { "id": "8H12|B|109", "database": "", "url": "" }, { "id": "8H12|A|109", "database": "", "url": "" }, { "id": "8H14|C|109", "database": "", "url": "" }, { "id": "8H14|B|109", "database": "", "url": "" }, { "id": "8H14|A|109", "database": "", "url": "" }, { "id": "8H0X|C|109", "database": "", "url": "" }, { "id": "8H0X|B|109", "database": "", "url": "" }, { "id": "8H0X|A|109", "database": "", "url": "" }, { "id": "7ZH1|C|109", "database": "", "url": "" }, { "id": "7ZH1|B|109", "database": "", "url": "" }, { "id": "7ZH1|A|109", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G22573RC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB7&bu=0&command=select+.B:1116;+center+selection;+zoom+selection" }, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7|B|1116", "database": "", "url": "" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.B:1116;+center+selection;+zoom+selection" }, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB6|B|1116", "database": "", "url": "" }, { "id": "6NB6|A|1116", "database": "", "url": "" }, { "id": "6NB7|A|1116", "database": "", "url": "" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS2&bu=0&command=select+.A:1116;+center+selection;+zoom+selection" }, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2|A|1116", "database": "", "url": "" } ] }, { "glytoucan_ac": "G93579XB", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRV&bu=0&command=select+.A:1116;+center+selection;+zoom+selection" }, "start_pos": 1116, "start_aa": "Asn", "end_pos": 1116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1116", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "6CRV|A|1116", "database": "", "url": "" }, { "id": "6CRV|B|1116", "database": "", "url": "" }, { "id": "6CRV|C|1116", "database": "", "url": "" }, { "id": "6CRZ|B|1116", "database": "", "url": "" }, { "id": "6CS0|B|1116", "database": "", "url": "" }, { "id": "6CS1|A|1116", "database": "", "url": "" }, { "id": "6CS1|C|1116", "database": "", "url": "" }, { "id": "6M3W|C|1116", "database": "", "url": "" }, { "id": "6M3W|B|1116", "database": "", "url": "" }, { "id": "6M3W|A|1116", "database": "", "url": "" }, { "id": "7AKJ|C|1116", "database": "", "url": "" }, { "id": "7AKJ|B|1116", "database": "", "url": "" }, { "id": "7AKJ|A|1116", "database": "", "url": "" }, { "id": "7SG4|C|1116", "database": "", "url": "" }, { "id": "7SG4|B|1116", "database": "", "url": "" }, { "id": "7SG4|A|1116", "database": "", "url": "" }, { "id": "8H0Y|C|1116", "database": "", "url": "" }, { "id": "8H0Y|B|1116", "database": "", "url": "" }, { "id": "8H0Y|A|1116", "database": "", "url": "" }, { "id": "8H0Z|C|1116", "database": "", "url": "" }, { "id": "8H10|C|1116", "database": "", "url": "" }, { "id": "8H10|B|1116", "database": "", "url": "" }, { "id": "8H10|A|1116", "database": "", "url": "" }, { "id": "8H11|C|1116", "database": "", "url": "" }, { "id": "8H11|B|1116", "database": "", "url": "" }, { "id": "8H11|A|1116", "database": "", "url": "" }, { "id": "8H14|C|1116", "database": "", "url": "" }, { "id": "8H14|B|1116", "database": "", "url": "" }, { "id": "8H14|A|1116", "database": "", "url": "" }, { "id": "8H15|C|1116", "database": "", "url": "" }, { "id": "8H16|C|1116", "database": "", "url": "" }, { "id": "8H16|B|1116", "database": "", "url": "" }, { "id": "8H16|A|1116", "database": "", "url": "" }, { "id": "8H0X|C|1116", "database": "", "url": "" }, { "id": "8H0X|B|1116", "database": "", "url": "" }, { "id": "8H0X|A|1116", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1140, "start_aa": "Asn", "end_pos": 1140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1140", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1140, "start_aa": "Asn", "end_pos": 1140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1140", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6M3W&bu=0&command=select+.C:1140;+center+selection;+zoom+selection" }, "start_pos": 1140, "start_aa": "Asn", "end_pos": 1140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1140", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W|C|1140", "database": "", "url": "" }, { "id": "6M3W|B|1140", "database": "", "url": "" }, { "id": "6M3W|A|1140", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6M3W&bu=0&command=select+.C:1155;+center+selection;+zoom+selection" }, "start_pos": 1155, "start_aa": "Asn", "end_pos": 1155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1155", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W|C|1155", "database": "", "url": "" }, { "id": "6M3W|B|1155", "database": "", "url": "" }, { "id": "6M3W|A|1155", "database": "", "url": "" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6M3W&bu=0&command=select+.C:1176;+center+selection;+zoom+selection" }, "start_pos": 1176, "start_aa": "Asn", "end_pos": 1176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1176", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W|C|1176", "database": "", "url": "" }, { "id": "6M3W|B|1176", "database": "", "url": "" }, { "id": "6M3W|A|1176", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.C:119;+center+selection;+zoom+selection" }, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW|C|119", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:119;+center+selection;+zoom+selection" }, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|119", "database": "", "url": "" }, { "id": "5X58|B|119", "database": "", "url": "" }, { "id": "5X58|A|119", "database": "", "url": "" }, { "id": "7ZH2|C|119", "database": "", "url": "" }, { "id": "7ZH2|B|119", "database": "", "url": "" }, { "id": "7ZH2|A|119", "database": "", "url": "" }, { "id": "8H0Y|C|119", "database": "", "url": "" }, { "id": "8H0Y|B|119", "database": "", "url": "" }, { "id": "8H0Y|A|119", "database": "", "url": "" }, { "id": "8H0Z|C|119", "database": "", "url": "" }, { "id": "8H0Z|B|119", "database": "", "url": "" }, { "id": "8H0Z|A|119", "database": "", "url": "" }, { "id": "8H10|C|119", "database": "", "url": "" }, { "id": "8H10|B|119", "database": "", "url": "" }, { "id": "8H10|A|119", "database": "", "url": "" }, { "id": "8H11|C|119", "database": "", "url": "" }, { "id": "8H11|B|119", "database": "", "url": "" }, { "id": "8H11|A|119", "database": "", "url": "" }, { "id": "8H12|C|119", "database": "", "url": "" }, { "id": "8H12|B|119", "database": "", "url": "" }, { "id": "8H12|A|119", "database": "", "url": "" }, { "id": "8H14|C|119", "database": "", "url": "" }, { "id": "8H14|B|119", "database": "", "url": "" }, { "id": "8H14|A|119", "database": "", "url": "" }, { "id": "8H16|C|119", "database": "", "url": "" }, { "id": "8H16|B|119", "database": "", "url": "" }, { "id": "8H0X|C|119", "database": "", "url": "" }, { "id": "8H0X|B|119", "database": "", "url": "" }, { "id": "8H0X|A|119", "database": "", "url": "" }, { "id": "7ZH1|C|119", "database": "", "url": "" }, { "id": "7ZH1|B|119", "database": "", "url": "" }, { "id": "7ZH1|A|119", "database": "", "url": "" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:158;+center+selection;+zoom+selection" }, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|158", "database": "", "url": "" }, { "id": "5X58|B|158", "database": "", "url": "" }, { "id": "5X58|A|158", "database": "", "url": "" }, { "id": "6NB6|A|158", "database": "", "url": "" }, { "id": "6NB7|B|158", "database": "", "url": "" }, { "id": "6NB7|A|158", "database": "", "url": "" }, { "id": "7AKJ|C|158", "database": "", "url": "" }, { "id": "7AKJ|B|158", "database": "", "url": "" }, { "id": "7AKJ|A|158", "database": "", "url": "" }, { "id": "7SG4|C|158", "database": "", "url": "" }, { "id": "7SG4|A|158", "database": "", "url": "" }, { "id": "7ZH2|C|158", "database": "", "url": "" }, { "id": "7ZH2|B|158", "database": "", "url": "" }, { "id": "7ZH2|A|158", "database": "", "url": "" }, { "id": "7ZH5|A|158", "database": "", "url": "" }, { "id": "8H0Y|C|158", "database": "", "url": "" }, { "id": "8H0Y|B|158", "database": "", "url": "" }, { "id": "8H0Y|A|158", "database": "", "url": "" }, { "id": "8H0Z|C|158", "database": "", "url": "" }, { "id": "8H0Z|B|158", "database": "", "url": "" }, { "id": "8H0Z|A|158", "database": "", "url": "" }, { "id": "8H10|C|158", "database": "", "url": "" }, { "id": "8H10|B|158", "database": "", "url": "" }, { "id": "8H10|A|158", "database": "", "url": "" }, { "id": "8H11|B|158", "database": "", "url": "" }, { "id": "8H11|A|158", "database": "", "url": "" }, { "id": "8H12|C|158", "database": "", "url": "" }, { "id": "8H12|B|158", "database": "", "url": "" }, { "id": "8H12|A|158", "database": "", "url": "" }, { "id": "8H14|C|158", "database": "", "url": "" }, { "id": "8H14|B|158", "database": "", "url": "" }, { "id": "8H14|A|158", "database": "", "url": "" }, { "id": "8H15|B|158", "database": "", "url": "" }, { "id": "8H16|B|158", "database": "", "url": "" }, { "id": "8H0X|C|158", "database": "", "url": "" }, { "id": "8H0X|B|158", "database": "", "url": "" }, { "id": "8H0X|A|158", "database": "", "url": "" }, { "id": "7ZH1|C|158", "database": "", "url": "" }, { "id": "7ZH1|B|158", "database": "", "url": "" }, { "id": "7ZH1|A|158", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-T", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:227;+center+selection;+zoom+selection" }, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "5X58|C|227", "database": "", "url": "" }, { "id": "5X58|B|227", "database": "", "url": "" }, { "id": "5X58|A|227", "database": "", "url": "" }, { "id": "6CRW|C|227", "database": "", "url": "" }, { "id": "6CRZ|C|227", "database": "", "url": "" }, { "id": "6CS0|C|227", "database": "", "url": "" }, { "id": "6NB6|B|227", "database": "", "url": "" }, { "id": "6NB6|A|227", "database": "", "url": "" }, { "id": "6NB7|B|227", "database": "", "url": "" }, { "id": "6NB7|A|227", "database": "", "url": "" }, { "id": "7SG4|C|227", "database": "", "url": "" }, { "id": "7SG4|B|227", "database": "", "url": "" }, { "id": "7SG4|A|227", "database": "", "url": "" }, { "id": "7ZH5|C|227", "database": "", "url": "" }, { "id": "7ZH5|A|227", "database": "", "url": "" }, { "id": "8H0Y|C|227", "database": "", "url": "" }, { "id": "8H0Y|B|227", "database": "", "url": "" }, { "id": "8H0Y|A|227", "database": "", "url": "" }, { "id": "8H11|C|227", "database": "", "url": "" }, { "id": "8H11|B|227", "database": "", "url": "" }, { "id": "8H14|C|227", "database": "", "url": "" }, { "id": "8H14|B|227", "database": "", "url": "" }, { "id": "8H14|A|227", "database": "", "url": "" }, { "id": "8H15|C|227", "database": "", "url": "" }, { "id": "8H15|B|227", "database": "", "url": "" }, { "id": "8H15|A|227", "database": "", "url": "" }, { "id": "8H16|C|227", "database": "", "url": "" }, { "id": "8H16|B|227", "database": "", "url": "" }, { "id": "8JAG|A|227", "database": "", "url": "" }, { "id": "8H0X|C|227", "database": "", "url": "" }, { "id": "8H0X|B|227", "database": "", "url": "" }, { "id": "8H0X|A|227", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS1&bu=0&command=select+.C:269;+center+selection;+zoom+selection" }, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1|C|269", "database": "", "url": "" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:269;+center+selection;+zoom+selection" }, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|269", "database": "", "url": "" }, { "id": "5X58|B|269", "database": "", "url": "" }, { "id": "5X58|A|269", "database": "", "url": "" }, { "id": "7SG4|C|269", "database": "", "url": "" }, { "id": "7SG4|B|269", "database": "", "url": "" }, { "id": "7SG4|A|269", "database": "", "url": "" }, { "id": "7ZH2|C|269", "database": "", "url": "" }, { "id": "7ZH2|B|269", "database": "", "url": "" }, { "id": "7ZH2|A|269", "database": "", "url": "" }, { "id": "7ZH5|C|269", "database": "", "url": "" }, { "id": "7ZH5|A|269", "database": "", "url": "" }, { "id": "8H0Y|C|269", "database": "", "url": "" }, { "id": "8H0Y|B|269", "database": "", "url": "" }, { "id": "8H0Y|A|269", "database": "", "url": "" }, { "id": "8H0Z|B|269", "database": "", "url": "" }, { "id": "8H0Z|A|269", "database": "", "url": "" }, { "id": "8H10|C|269", "database": "", "url": "" }, { "id": "8H10|B|269", "database": "", "url": "" }, { "id": "8H10|A|269", "database": "", "url": "" }, { "id": "8H11|C|269", "database": "", "url": "" }, { "id": "8H11|B|269", "database": "", "url": "" }, { "id": "8H11|A|269", "database": "", "url": "" }, { "id": "8H12|C|269", "database": "", "url": "" }, { "id": "8H12|B|269", "database": "", "url": "" }, { "id": "8H12|A|269", "database": "", "url": "" }, { "id": "8H14|C|269", "database": "", "url": "" }, { "id": "8H14|B|269", "database": "", "url": "" }, { "id": "8H14|A|269", "database": "", "url": "" }, { "id": "8H15|C|269", "database": "", "url": "" }, { "id": "8H15|A|269", "database": "", "url": "" }, { "id": "8H16|C|269", "database": "", "url": "" }, { "id": "8H16|B|269", "database": "", "url": "" }, { "id": "8H16|A|269", "database": "", "url": "" }, { "id": "8JAG|A|269", "database": "", "url": "" }, { "id": "8VPF|C|269", "database": "", "url": "" }, { "id": "8VPF|B|269", "database": "", "url": "" }, { "id": "8VPF|A|269", "database": "", "url": "" }, { "id": "8H0X|C|269", "database": "", "url": "" }, { "id": "8H0X|B|269", "database": "", "url": "" }, { "id": "8H0X|A|269", "database": "", "url": "" }, { "id": "7ZH1|C|269", "database": "", "url": "" }, { "id": "7ZH1|B|269", "database": "", "url": "" }, { "id": "7ZH1|A|269", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 29, "start_aa": "Asn", "end_pos": 29, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn29", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.C:29;+center+selection;+zoom+selection" }, "start_pos": 29, "start_aa": "Asn", "end_pos": 29, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn29", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "6NB6|C|29", "database": "", "url": "" }, { "id": "6NB6|B|29", "database": "", "url": "" }, { "id": "6NB7|B|29", "database": "", "url": "" }, { "id": "8TC5|B|16", "database": "", "url": "" }, { "id": "8TC5|A|16", "database": "", "url": "" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS2&bu=0&command=select+.B:318;+center+selection;+zoom+selection" }, "start_pos": 318, "start_aa": "Asn", "end_pos": 318, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn318", "evidence": [ { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2|B|318", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:318;+center+selection;+zoom+selection" }, "start_pos": 318, "start_aa": "Asn", "end_pos": 318, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn318", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|318", "database": "", "url": "" }, { "id": "5X58|B|318", "database": "", "url": "" }, { "id": "5X58|A|318", "database": "", "url": "" }, { "id": "6CRW|C|318", "database": "", "url": "" }, { "id": "6CRZ|C|318", "database": "", "url": "" }, { "id": "6CS0|C|318", "database": "", "url": "" }, { "id": "6NB6|A|318", "database": "", "url": "" }, { "id": "7AKJ|C|318", "database": "", "url": "" }, { "id": "7AKJ|B|318", "database": "", "url": "" }, { "id": "7AKJ|A|318", "database": "", "url": "" }, { "id": "7SG4|C|318", "database": "", "url": "" }, { "id": "7SG4|B|318", "database": "", "url": "" }, { "id": "7SG4|A|318", "database": "", "url": "" }, { "id": "7ZH2|C|318", "database": "", "url": "" }, { "id": "7ZH2|B|318", "database": "", "url": "" }, { "id": "7ZH2|A|318", "database": "", "url": "" }, { "id": "7ZH5|B|318", "database": "", "url": "" }, { "id": "8H0Y|C|318", "database": "", "url": "" }, { "id": "8H0Y|B|318", "database": "", "url": "" }, { "id": "8H0Y|A|318", "database": "", "url": "" }, { "id": "8H0Z|C|318", "database": "", "url": "" }, { "id": "8H0Z|B|318", "database": "", "url": "" }, { "id": "8H0Z|A|318", "database": "", "url": "" }, { "id": "8H10|C|318", "database": "", "url": "" }, { "id": "8H10|B|318", "database": "", "url": "" }, { "id": "8H10|A|318", "database": "", "url": "" }, { "id": "8H11|C|318", "database": "", "url": "" }, { "id": "8H11|B|318", "database": "", "url": "" }, { "id": "8H11|A|318", "database": "", "url": "" }, { "id": "8H12|C|318", "database": "", "url": "" }, { "id": "8H12|B|318", "database": "", "url": "" }, { "id": "8H12|A|318", "database": "", "url": "" }, { "id": "8H13|C|318", "database": "", "url": "" }, { "id": "8H13|B|318", "database": "", "url": "" }, { "id": "8H13|A|318", "database": "", "url": "" }, { "id": "8H14|C|318", "database": "", "url": "" }, { "id": "8H14|B|318", "database": "", "url": "" }, { "id": "8H14|A|318", "database": "", "url": "" }, { "id": "8H15|C|318", "database": "", "url": "" }, { "id": "8H15|B|318", "database": "", "url": "" }, { "id": "8H16|C|318", "database": "", "url": "" }, { "id": "8H16|A|318", "database": "", "url": "" }, { "id": "8H0X|C|318", "database": "", "url": "" }, { "id": "8H0X|B|318", "database": "", "url": "" }, { "id": "8H0X|A|318", "database": "", "url": "" }, { "id": "7ZH1|C|318", "database": "", "url": "" }, { "id": "7ZH1|B|318", "database": "", "url": "" }, { "id": "7ZH1|A|318", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G78231ZN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7AKJ&bu=0&command=select+.C:330;+center+selection;+zoom+selection" }, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ|C|330", "database": "", "url": "" }, { "id": "7AKJ|B|330", "database": "", "url": "" }, { "id": "7AKJ|A|330", "database": "", "url": "" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G93579XB", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2AJF&bu=0&command=select+.E:330;+center+selection;+zoom+selection" }, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "2DD8", "database": "PDB", "url": "https://www.rcsb.org/structure/2DD8" }, { "id": "2DD8", "database": "PDB", "url": "https://www.rcsb.org/structure/2DD8" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6WAQ", "database": "PDB", "url": "https://www.rcsb.org/structure/6WAQ" }, { "id": "6WAQ", "database": "PDB", "url": "https://www.rcsb.org/structure/6WAQ" }, { "id": "7FC6", "database": "PDB", "url": "https://www.rcsb.org/structure/7FC6" }, { "id": "7FC6", "database": "PDB", "url": "https://www.rcsb.org/structure/7FC6" }, { "id": "7JN5", "database": "PDB", "url": "https://www.rcsb.org/structure/7JN5" }, { "id": "7JN5", "database": "PDB", "url": "https://www.rcsb.org/structure/7JN5" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8WCG", "database": "PDB", "url": "https://www.rcsb.org/structure/8WCG" }, { "id": "8WCG", "database": "PDB", "url": "https://www.rcsb.org/structure/8WCG" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7X2J", "database": "PDB", "url": "https://www.rcsb.org/structure/7X2J" }, { "id": "7X2J", "database": "PDB", "url": "https://www.rcsb.org/structure/7X2J" }, { "id": "2AJF|E|330", "database": "", "url": "" }, { "id": "2AJF|F|330", "database": "", "url": "" }, { "id": "2DD8|S|330", "database": "", "url": "" }, { "id": "5X58|C|330", "database": "", "url": "" }, { "id": "5X58|B|330", "database": "", "url": "" }, { "id": "5X58|A|330", "database": "", "url": "" }, { "id": "6WAQ|B|330", "database": "", "url": "" }, { "id": "6WAQ|D|330", "database": "", "url": "" }, { "id": "7FC6|S|330", "database": "", "url": "" }, { "id": "7JN5|F|330", "database": "", "url": "" }, { "id": "7SG4|C|330", "database": "", "url": "" }, { "id": "7SG4|B|330", "database": "", "url": "" }, { "id": "7SG4|A|330", "database": "", "url": "" }, { "id": "8H0Y|B|330", "database": "", "url": "" }, { "id": "8H0Y|A|330", "database": "", "url": "" }, { "id": "8H14|C|330", "database": "", "url": "" }, { "id": "8H14|B|330", "database": "", "url": "" }, { "id": "8H14|A|330", "database": "", "url": "" }, { "id": "8JAG|A|330", "database": "", "url": "" }, { "id": "8WCG|B|330", "database": "", "url": "" }, { "id": "8H0X|C|330", "database": "", "url": "" }, { "id": "8H0X|B|330", "database": "", "url": "" }, { "id": "8H0X|A|330", "database": "", "url": "" }, { "id": "7X2J|S|330", "database": "", "url": "" } ] }, { "glytoucan_ac": "G00395TQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8TC5&bu=0&command=select+.C:344;+center+selection;+zoom+selection" }, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5|C|344", "database": "", "url": "" }, { "id": "8TC5|B|344", "database": "", "url": "" }, { "id": "8TC5|A|344", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:357;+center+selection;+zoom+selection" }, "start_pos": 357, "start_aa": "Asn", "end_pos": 357, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn357", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6WAQ", "database": "PDB", "url": "https://www.rcsb.org/structure/6WAQ" }, { "id": "6WAQ", "database": "PDB", "url": "https://www.rcsb.org/structure/6WAQ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7WR9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WR9" }, { "id": "7WR9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WR9" }, { "id": "7Y3N", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y3N" }, { "id": "7Y3N", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y3N" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7X2J", "database": "PDB", "url": "https://www.rcsb.org/structure/7X2J" }, { "id": "7X2J", "database": "PDB", "url": "https://www.rcsb.org/structure/7X2J" }, { "id": "5X58|C|357", "database": "", "url": "" }, { "id": "5X58|B|357", "database": "", "url": "" }, { "id": "5X58|A|357", "database": "", "url": "" }, { "id": "6NB6|C|357", "database": "", "url": "" }, { "id": "6NB6|B|357", "database": "", "url": "" }, { "id": "6NB6|A|357", "database": "", "url": "" }, { "id": "6NB7|C|357", "database": "", "url": "" }, { "id": "6NB7|B|357", "database": "", "url": "" }, { "id": "6NB7|A|357", "database": "", "url": "" }, { "id": "6WAQ|B|357", "database": "", "url": "" }, { "id": "7AKJ|C|357", "database": "", "url": "" }, { "id": "7AKJ|B|357", "database": "", "url": "" }, { "id": "7AKJ|A|357", "database": "", "url": "" }, { "id": "7SG4|C|357", "database": "", "url": "" }, { "id": "7SG4|B|357", "database": "", "url": "" }, { "id": "7SG4|A|357", "database": "", "url": "" }, { "id": "7WR9|F|357", "database": "", "url": "" }, { "id": "7Y3N|B|52", "database": "", "url": "" }, { "id": "7ZH2|C|357", "database": "", "url": "" }, { "id": "7ZH2|B|357", "database": "", "url": "" }, { "id": "7ZH2|A|357", "database": "", "url": "" }, { "id": "8H0Y|C|357", "database": "", "url": "" }, { "id": "8H0Y|B|357", "database": "", "url": "" }, { "id": "8H0Y|A|357", "database": "", "url": "" }, { "id": "8H0Z|C|357", "database": "", "url": "" }, { "id": "8H0Z|B|357", "database": "", "url": "" }, { "id": "8H0Z|A|357", "database": "", "url": "" }, { "id": "8H10|C|357", "database": "", "url": "" }, { "id": "8H10|B|357", "database": "", "url": "" }, { "id": "8H10|A|357", "database": "", "url": "" }, { "id": "8H12|C|357", "database": "", "url": "" }, { "id": "8H12|B|357", "database": "", "url": "" }, { "id": "8H12|A|357", "database": "", "url": "" }, { "id": "8H14|C|357", "database": "", "url": "" }, { "id": "8H14|B|357", "database": "", "url": "" }, { "id": "8H14|A|357", "database": "", "url": "" }, { "id": "8H0X|C|357", "database": "", "url": "" }, { "id": "8H0X|B|357", "database": "", "url": "" }, { "id": "8H0X|A|357", "database": "", "url": "" }, { "id": "7ZH1|C|357", "database": "", "url": "" }, { "id": "7ZH1|B|357", "database": "", "url": "" }, { "id": "7ZH1|A|357", "database": "", "url": "" }, { "id": "7X2J|S|357", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 589, "start_aa": "Asn", "end_pos": 589, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn589", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 589, "start_aa": "Asn", "end_pos": 589, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn589", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.C:589;+center+selection;+zoom+selection" }, "start_pos": 589, "start_aa": "Asn", "end_pos": 589, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn589", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "6CRW|C|589", "database": "", "url": "" }, { "id": "6CRW|B|589", "database": "", "url": "" }, { "id": "6CRW|A|589", "database": "", "url": "" }, { "id": "6CRZ|A|589", "database": "", "url": "" }, { "id": "6CRZ|B|589", "database": "", "url": "" }, { "id": "6CRZ|C|589", "database": "", "url": "" }, { "id": "6CS0|C|589", "database": "", "url": "" }, { "id": "6CS0|B|589", "database": "", "url": "" }, { "id": "6CS0|A|589", "database": "", "url": "" }, { "id": "6CS1|B|589", "database": "", "url": "" }, { "id": "6CS1|C|589", "database": "", "url": "" }, { "id": "6CS2|C|589", "database": "", "url": "" }, { "id": "6CS2|B|589", "database": "", "url": "" }, { "id": "6CS2|A|589", "database": "", "url": "" }, { "id": "6NB6|C|589", "database": "", "url": "" }, { "id": "6NB6|B|589", "database": "", "url": "" }, { "id": "6NB6|A|589", "database": "", "url": "" }, { "id": "6NB7|C|589", "database": "", "url": "" }, { "id": "6NB7|B|589", "database": "", "url": "" }, { "id": "6NB7|A|589", "database": "", "url": "" }, { "id": "7SG4|C|589", "database": "", "url": "" }, { "id": "7SG4|B|589", "database": "", "url": "" }, { "id": "7SG4|A|589", "database": "", "url": "" }, { "id": "8TC5|B|576", "database": "", "url": "" }, { "id": "8TC5|A|576", "database": "", "url": "" } ] }, { "glytoucan_ac": "G00395TQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8TC5&bu=0&command=select+.C:589;+center+selection;+zoom+selection" }, "start_pos": 602, "start_aa": "Asn", "end_pos": 602, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn602", "evidence": [ { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5|C|589", "database": "", "url": "" }, { "id": "8TC5|B|589", "database": "", "url": "" }, { "id": "8TC5|A|589", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 602, "start_aa": "Asn", "end_pos": 602, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn602", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.C:602;+center+selection;+zoom+selection" }, "start_pos": 602, "start_aa": "Asn", "end_pos": 602, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn602", "evidence": [ { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CRW|C|602", "database": "", "url": "" }, { "id": "6CRW|A|602", "database": "", "url": "" }, { "id": "6CRZ|A|602", "database": "", "url": "" }, { "id": "6CS0|A|602", "database": "", "url": "" }, { "id": "6CS1|B|602", "database": "", "url": "" }, { "id": "6CS2|C|602", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:602;+center+selection;+zoom+selection" }, "start_pos": 602, "start_aa": "Asn", "end_pos": 602, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn602", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|602", "database": "", "url": "" }, { "id": "5X58|B|602", "database": "", "url": "" }, { "id": "6CRV|A|602", "database": "", "url": "" }, { "id": "6CRV|B|602", "database": "", "url": "" }, { "id": "6CRV|C|602", "database": "", "url": "" }, { "id": "7SG4|C|602", "database": "", "url": "" }, { "id": "7SG4|B|602", "database": "", "url": "" }, { "id": "7SG4|A|602", "database": "", "url": "" }, { "id": "7ZH2|C|602", "database": "", "url": "" }, { "id": "7ZH2|B|602", "database": "", "url": "" }, { "id": "7ZH2|A|602", "database": "", "url": "" }, { "id": "7ZH5|B|602", "database": "", "url": "" }, { "id": "7ZH5|C|602", "database": "", "url": "" }, { "id": "8H0Y|C|602", "database": "", "url": "" }, { "id": "8H0Y|B|602", "database": "", "url": "" }, { "id": "8H0Y|A|602", "database": "", "url": "" }, { "id": "8H0Z|C|602", "database": "", "url": "" }, { "id": "8H0Z|B|602", "database": "", "url": "" }, { "id": "8H0Z|A|602", "database": "", "url": "" }, { "id": "8H10|C|602", "database": "", "url": "" }, { "id": "8H10|B|602", "database": "", "url": "" }, { "id": "8H10|A|602", "database": "", "url": "" }, { "id": "8H11|C|602", "database": "", "url": "" }, { "id": "8H11|B|602", "database": "", "url": "" }, { "id": "8H11|A|602", "database": "", "url": "" }, { "id": "8H12|C|602", "database": "", "url": "" }, { "id": "8H12|B|602", "database": "", "url": "" }, { "id": "8H12|A|602", "database": "", "url": "" }, { "id": "8H13|C|602", "database": "", "url": "" }, { "id": "8H13|B|602", "database": "", "url": "" }, { "id": "8H13|A|602", "database": "", "url": "" }, { "id": "8H14|C|602", "database": "", "url": "" }, { "id": "8H14|B|602", "database": "", "url": "" }, { "id": "8H14|A|602", "database": "", "url": "" }, { "id": "8H16|C|602", "database": "", "url": "" }, { "id": "8H16|B|602", "database": "", "url": "" }, { "id": "8H16|A|602", "database": "", "url": "" }, { "id": "8VPF|C|602", "database": "", "url": "" }, { "id": "8VPF|B|602", "database": "", "url": "" }, { "id": "8VPF|A|602", "database": "", "url": "" }, { "id": "8H0X|C|602", "database": "", "url": "" }, { "id": "8H0X|B|602", "database": "", "url": "" }, { "id": "8H0X|A|602", "database": "", "url": "" }, { "id": "7ZH1|C|602", "database": "", "url": "" }, { "id": "7ZH1|B|602", "database": "", "url": "" }, { "id": "7ZH1|A|602", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:65;+center+selection;+zoom+selection" }, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "5X58|C|65", "database": "", "url": "" }, { "id": "5X58|B|65", "database": "", "url": "" }, { "id": "5X58|A|65", "database": "", "url": "" }, { "id": "6CRV|A|65", "database": "", "url": "" }, { "id": "6CRV|B|65", "database": "", "url": "" }, { "id": "6CRV|C|65", "database": "", "url": "" }, { "id": "6CRW|C|65", "database": "", "url": "" }, { "id": "6CRW|A|65", "database": "", "url": "" }, { "id": "6CRZ|A|65", "database": "", "url": "" }, { "id": "6CRZ|B|65", "database": "", "url": "" }, { "id": "6CRZ|C|65", "database": "", "url": "" }, { "id": "6CS0|C|65", "database": "", "url": "" }, { "id": "6CS0|B|65", "database": "", "url": "" }, { "id": "6CS0|A|65", "database": "", "url": "" }, { "id": "6CS1|A|65", "database": "", "url": "" }, { "id": "6CS1|C|65", "database": "", "url": "" }, { "id": "6CS2|A|65", "database": "", "url": "" }, { "id": "6NB6|C|65", "database": "", "url": "" }, { "id": "6NB6|B|65", "database": "", "url": "" }, { "id": "6NB6|A|65", "database": "", "url": "" }, { "id": "6NB7|C|65", "database": "", "url": "" }, { "id": "6NB7|B|65", "database": "", "url": "" }, { "id": "6NB7|A|65", "database": "", "url": "" }, { "id": "7AKJ|C|65", "database": "", "url": "" }, { "id": "7AKJ|B|65", "database": "", "url": "" }, { "id": "7AKJ|A|65", "database": "", "url": "" }, { "id": "7SG4|C|65", "database": "", "url": "" }, { "id": "7SG4|B|65", "database": "", "url": "" }, { "id": "7SG4|A|65", "database": "", "url": "" }, { "id": "7ZH5|A|65", "database": "", "url": "" }, { "id": "8H0Y|C|65", "database": "", "url": "" }, { "id": "8H0Y|B|65", "database": "", "url": "" }, { "id": "8H0Y|A|65", "database": "", "url": "" }, { "id": "8H0Z|C|65", "database": "", "url": "" }, { "id": "8H0Z|B|65", "database": "", "url": "" }, { "id": "8H0Z|A|65", "database": "", "url": "" }, { "id": "8H10|C|65", "database": "", "url": "" }, { "id": "8H10|B|65", "database": "", "url": "" }, { "id": "8H10|A|65", "database": "", "url": "" }, { "id": "8H11|C|65", "database": "", "url": "" }, { "id": "8H11|B|65", "database": "", "url": "" }, { "id": "8H11|A|65", "database": "", "url": "" }, { "id": "8H12|C|65", "database": "", "url": "" }, { "id": "8H12|B|65", "database": "", "url": "" }, { "id": "8H12|A|65", "database": "", "url": "" }, { "id": "8H14|C|65", "database": "", "url": "" }, { "id": "8H14|B|65", "database": "", "url": "" }, { "id": "8H14|A|65", "database": "", "url": "" }, { "id": "8H16|C|65", "database": "", "url": "" }, { "id": "8JAG|A|65", "database": "", "url": "" }, { "id": "8VPF|C|65", "database": "", "url": "" }, { "id": "8VPF|B|65", "database": "", "url": "" }, { "id": "8VPF|A|65", "database": "", "url": "" }, { "id": "8H0X|C|65", "database": "", "url": "" }, { "id": "8H0X|B|65", "database": "", "url": "" }, { "id": "8H0X|A|65", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G16407EV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.A:691;+center+selection;+zoom+selection" }, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB6|A|691", "database": "", "url": "" }, { "id": "6NB7|A|691", "database": "", "url": "" } ] }, { "glytoucan_ac": "G53434XO", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G82364UA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:691;+center+selection;+zoom+selection" }, "start_pos": 691, "start_aa": "Asn", "end_pos": 691, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn691", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRV", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRV" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8TC5", "database": "PDB", "url": "https://www.rcsb.org/structure/8TC5" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "8VPF", "database": "PDB", "url": "https://www.rcsb.org/structure/8VPF" }, { "id": "5X58|C|691", "database": "", "url": "" }, { "id": "5X58|B|691", "database": "", "url": "" }, { "id": "5X58|A|691", "database": "", "url": "" }, { "id": "6CRV|A|691", "database": "", "url": "" }, { "id": "6CRV|B|691", "database": "", "url": "" }, { "id": "6CRV|C|691", "database": "", "url": "" }, { "id": "6CRW|C|691", "database": "", "url": "" }, { "id": "6CRW|B|691", "database": "", "url": "" }, { "id": "6CRW|A|691", "database": "", "url": "" }, { "id": "6CRZ|A|691", "database": "", "url": "" }, { "id": "6CRZ|B|691", "database": "", "url": "" }, { "id": "6CRZ|C|691", "database": "", "url": "" }, { "id": "6CS0|C|691", "database": "", "url": "" }, { "id": "6CS0|B|691", "database": "", "url": "" }, { "id": "6CS0|A|691", "database": "", "url": "" }, { "id": "6CS1|A|691", "database": "", "url": "" }, { "id": "6CS1|B|691", "database": "", "url": "" }, { "id": "6CS1|C|691", "database": "", "url": "" }, { "id": "6M3W|C|691", "database": "", "url": "" }, { "id": "6M3W|B|691", "database": "", "url": "" }, { "id": "6M3W|A|691", "database": "", "url": "" }, { "id": "7AKJ|C|691", "database": "", "url": "" }, { "id": "7AKJ|B|691", "database": "", "url": "" }, { "id": "7AKJ|A|691", "database": "", "url": "" }, { "id": "7SG4|C|691", "database": "", "url": "" }, { "id": "7SG4|B|691", "database": "", "url": "" }, { "id": "7SG4|A|691", "database": "", "url": "" }, { "id": "7ZH5|B|691", "database": "", "url": "" }, { "id": "7ZH5|C|691", "database": "", "url": "" }, { "id": "7ZH5|A|691", "database": "", "url": "" }, { "id": "8H0Y|C|691", "database": "", "url": "" }, { "id": "8H0Y|A|691", "database": "", "url": "" }, { "id": "8H0Z|C|691", "database": "", "url": "" }, { "id": "8H0Z|B|691", "database": "", "url": "" }, { "id": "8H0Z|A|691", "database": "", "url": "" }, { "id": "8H10|C|691", "database": "", "url": "" }, { "id": "8H10|B|691", "database": "", "url": "" }, { "id": "8H10|A|691", "database": "", "url": "" }, { "id": "8H11|C|691", "database": "", "url": "" }, { "id": "8H11|B|691", "database": "", "url": "" }, { "id": "8H11|A|691", "database": "", "url": "" }, { "id": "8H12|C|691", "database": "", "url": "" }, { "id": "8H12|B|691", "database": "", "url": "" }, { "id": "8H12|A|691", "database": "", "url": "" }, { "id": "8H13|C|691", "database": "", "url": "" }, { "id": "8H13|B|691", "database": "", "url": "" }, { "id": "8H13|A|691", "database": "", "url": "" }, { "id": "8H16|C|691", "database": "", "url": "" }, { "id": "8H16|B|691", "database": "", "url": "" }, { "id": "8H16|A|691", "database": "", "url": "" }, { "id": "8TC5|C|678", "database": "", "url": "" }, { "id": "8TC5|B|678", "database": "", "url": "" }, { "id": "8TC5|A|678", "database": "", "url": "" }, { "id": "8VPF|C|691", "database": "", "url": "" }, { "id": "8VPF|B|691", "database": "", "url": "" }, { "id": "8VPF|A|691", "database": "", "url": "" } ] }, { "glytoucan_ac": "G22573RC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.C:699;+center+selection;+zoom+selection" }, "start_pos": 699, "start_aa": "Asn", "end_pos": 699, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn699", "evidence": [ { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CRZ", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRZ" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CS0", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS0" }, { "id": "6CRW|C|699", "database": "", "url": "" }, { "id": "6CRZ|C|699", "database": "", "url": "" }, { "id": "6CS0|C|699", "database": "", "url": "" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS1&bu=0&command=select+.A:699;+center+selection;+zoom+selection" }, "start_pos": 699, "start_aa": "Asn", "end_pos": 699, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn699", "evidence": [ { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1|A|699", "database": "", "url": "" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.A:699;+center+selection;+zoom+selection" }, "start_pos": 699, "start_aa": "Asn", "end_pos": 699, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn699", "evidence": [ { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CRW|A|699", "database": "", "url": "" }, { "id": "6CS1|B|699", "database": "", "url": "" }, { "id": "6CS2|C|699", "database": "", "url": "" }, { "id": "6CS2|A|699", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:699;+center+selection;+zoom+selection" }, "start_pos": 699, "start_aa": "Asn", "end_pos": 699, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn699", "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "6M3W", "database": "PDB", "url": "https://www.rcsb.org/structure/6M3W" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7AKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7AKJ" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "5X58|C|699", "database": "", "url": "" }, { "id": "5X58|B|699", "database": "", "url": "" }, { "id": "5X58|A|699", "database": "", "url": "" }, { "id": "6M3W|C|699", "database": "", "url": "" }, { "id": "6M3W|B|699", "database": "", "url": "" }, { "id": "6M3W|A|699", "database": "", "url": "" }, { "id": "7AKJ|C|699", "database": "", "url": "" }, { "id": "7AKJ|B|699", "database": "", "url": "" }, { "id": "7AKJ|A|699", "database": "", "url": "" }, { "id": "7SG4|C|699", "database": "", "url": "" }, { "id": "7SG4|B|699", "database": "", "url": "" }, { "id": "7SG4|A|699", "database": "", "url": "" }, { "id": "7ZH2|C|699", "database": "", "url": "" }, { "id": "7ZH2|B|699", "database": "", "url": "" }, { "id": "7ZH2|A|699", "database": "", "url": "" }, { "id": "7ZH5|B|699", "database": "", "url": "" }, { "id": "7ZH5|C|699", "database": "", "url": "" }, { "id": "7ZH5|A|699", "database": "", "url": "" }, { "id": "8H0Y|C|699", "database": "", "url": "" }, { "id": "8H0Y|B|699", "database": "", "url": "" }, { "id": "8H0Y|A|699", "database": "", "url": "" }, { "id": "8H0Z|C|699", "database": "", "url": "" }, { "id": "8H0Z|B|699", "database": "", "url": "" }, { "id": "8H0Z|A|699", "database": "", "url": "" }, { "id": "8H10|C|699", "database": "", "url": "" }, { "id": "8H10|B|699", "database": "", "url": "" }, { "id": "8H10|A|699", "database": "", "url": "" }, { "id": "8H11|C|699", "database": "", "url": "" }, { "id": "8H11|B|699", "database": "", "url": "" }, { "id": "8H11|A|699", "database": "", "url": "" }, { "id": "8H12|C|699", "database": "", "url": "" }, { "id": "8H12|B|699", "database": "", "url": "" }, { "id": "8H12|A|699", "database": "", "url": "" }, { "id": "8H13|C|699", "database": "", "url": "" }, { "id": "8H13|B|699", "database": "", "url": "" }, { "id": "8H13|A|699", "database": "", "url": "" }, { "id": "8H14|C|699", "database": "", "url": "" }, { "id": "8H14|B|699", "database": "", "url": "" }, { "id": "8H14|A|699", "database": "", "url": "" }, { "id": "8H15|C|699", "database": "", "url": "" }, { "id": "8H15|B|699", "database": "", "url": "" }, { "id": "8H15|A|699", "database": "", "url": "" }, { "id": "8H16|C|699", "database": "", "url": "" }, { "id": "8H16|B|699", "database": "", "url": "" }, { "id": "8H16|A|699", "database": "", "url": "" }, { "id": "8H0X|C|699", "database": "", "url": "" }, { "id": "8H0X|B|699", "database": "", "url": "" }, { "id": "8H0X|A|699", "database": "", "url": "" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G93579XB", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6NB6&bu=0&command=select+.C:73;+center+selection;+zoom+selection" }, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB6|C|73", "database": "", "url": "" }, { "id": "6NB6|A|73", "database": "", "url": "" }, { "id": "6NB7|C|73", "database": "", "url": "" }, { "id": "6NB7|A|73", "database": "", "url": "" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CS1&bu=0&command=select+.A:783;+center+selection;+zoom+selection" }, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB6" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6NB7", "database": "PDB", "url": "https://www.rcsb.org/structure/6NB7" }, { "id": "6CS1|A|783", "database": "", "url": "" }, { "id": "6NB6|C|783", "database": "", "url": "" }, { "id": "6NB6|B|783", "database": "", "url": "" }, { "id": "6NB6|A|783", "database": "", "url": "" }, { "id": "6NB7|C|783", "database": "", "url": "" }, { "id": "6NB7|B|783", "database": "", "url": "" }, { "id": "6NB7|A|783", "database": "", "url": "" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G57317CE", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "SN-LC", "icn3d_view": {}, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6CRW&bu=0&command=select+.C:783;+center+selection;+zoom+selection" }, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CRW", "database": "PDB", "url": "https://www.rcsb.org/structure/6CRW" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS1", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS1" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CS2", "database": "PDB", "url": "https://www.rcsb.org/structure/6CS2" }, { "id": "6CRW|C|783", "database": "", "url": "" }, { "id": "6CRW|B|783", "database": "", "url": "" }, { "id": "6CS1|B|783", "database": "", "url": "" }, { "id": "6CS2|C|783", "database": "", "url": "" }, { "id": "6CS2|B|783", "database": "", "url": "" }, { "id": "6CS2|A|783", "database": "", "url": "" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "SN-AC", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5X58&bu=0&command=select+.C:783;+center+selection;+zoom+selection" }, "start_pos": 783, "start_aa": "Asn", "end_pos": 783, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn783", "evidence": [ { "id": "33064451", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33064451" }, { "id": "GLY_000628", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000628" }, { "id": "10.1021/acs.analchem.0c03301", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594#ptm_processing" }, { "id": "MF_04099", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/MF_04099" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "5X58", "database": "PDB", "url": "https://www.rcsb.org/structure/5X58" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7SG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SG4" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH2", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH2" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "7ZH5", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH5" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Y" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0Z" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H10", "database": "PDB", "url": "https://www.rcsb.org/structure/8H10" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H11", "database": "PDB", "url": "https://www.rcsb.org/structure/8H11" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H12", "database": "PDB", "url": "https://www.rcsb.org/structure/8H12" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H13", "database": "PDB", "url": "https://www.rcsb.org/structure/8H13" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H14", "database": "PDB", "url": "https://www.rcsb.org/structure/8H14" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H15", "database": "PDB", "url": "https://www.rcsb.org/structure/8H15" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8H16", "database": "PDB", "url": "https://www.rcsb.org/structure/8H16" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8JAG", "database": "PDB", "url": "https://www.rcsb.org/structure/8JAG" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "8H0X", "database": "PDB", "url": "https://www.rcsb.org/structure/8H0X" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "7ZH1", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZH1" }, { "id": "5X58|C|783", "database": "", "url": "" }, { "id": "5X58|B|783", "database": "", "url": "" }, { "id": "5X58|A|783", "database": "", "url": "" }, { "id": "7SG4|C|783", "database": "", "url": "" }, { "id": "7SG4|B|783", "database": "", "url": "" }, { "id": "7SG4|A|783", "database": "", "url": "" }, { "id": "7ZH2|C|783", "database": "", "url": "" }, { "id": "7ZH2|B|783", "database": "", "url": "" }, { "id": "7ZH2|A|783", "database": "", "url": "" }, { "id": "7ZH5|B|783", "database": "", "url": "" }, { "id": "7ZH5|C|783", "database": "", "url": "" }, { "id": "7ZH5|A|783", "database": "", "url": "" }, { "id": "8H0Y|C|783", "database": "", "url": "" }, { "id": "8H0Y|B|783", "database": "", "url": "" }, { "id": "8H0Y|A|783", "database": "", "url": "" }, { "id": "8H0Z|C|783", "database": "", "url": "" }, { "id": "8H0Z|B|783", "database": "", "url": "" }, { "id": "8H0Z|A|783", "database": "", "url": "" }, { "id": "8H10|C|783", "database": "", "url": "" }, { "id": "8H10|B|783", "database": "", "url": "" }, { "id": "8H10|A|783", "database": "", "url": "" }, { "id": "8H11|C|783", "database": "", "url": "" }, { "id": "8H11|B|783", "database": "", "url": "" }, { "id": "8H11|A|783", "database": "", "url": "" }, { "id": "8H12|C|783", "database": "", "url": "" }, { "id": "8H12|B|783", "database": "", "url": "" }, { "id": "8H12|A|783", "database": "", "url": "" }, { "id": "8H13|C|783", "database": "", "url": "" }, { "id": "8H13|B|783", "database": "", "url": "" }, { "id": "8H13|A|783", "database": "", "url": "" }, { "id": "8H14|C|783", "database": "", "url": "" }, { "id": "8H14|B|783", "database": "", "url": "" }, { "id": "8H14|A|783", "database": "", "url": "" }, { "id": "8H15|C|783", "database": "", "url": "" }, { "id": "8H15|B|783", "database": "", "url": "" }, { "id": "8H15|A|783", "database": "", "url": "" }, { "id": "8H16|C|783", "database": "", "url": "" }, { "id": "8H16|B|783", "database": "", "url": "" }, { "id": "8H16|A|783", "database": "", "url": "" }, { "id": "8JAG|A|783", "database": "", "url": "" }, { "id": "8H0X|C|783", "database": "", "url": "" }, { "id": "8H0X|B|783", "database": "", "url": "" }, { "id": "8H0X|A|783", "database": "", "url": "" }, { "id": "7ZH1|C|783", "database": "", "url": "" }, { "id": "7ZH1|B|783", "database": "", "url": "" }, { "id": "7ZH1|A|783", "database": "", "url": "" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Comprehensive Analysis of the Glycan Complement of SARS-CoV-2 Spike Proteins Using Signature Ions-Triggered Electron-Transfer/Higher-Energy Collisional Dissociation (EThcD) Mass Spectrometry", "journal": "Anal. Chem.", "date": "2020", "authors": "Wang D., Baudys J., Bundy J.L., Solano M., Keppel T., Barr J.R.", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000628", "url": "http://data.glygen.org/GLY_000628" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ] }, { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "Molecular modelling of S1 and S2 subunits of SARS coronavirus spike glycoprotein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Spiga Ottavia, Bernini Andrea, Ciutti Arianna, Chiellini Stefano, Menciassi Nicola, Finetti Francesca, Causarono Vincenza, Anselmi Francesca, Prischi Filippo, Niccolai Neri", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "14511651", "url": "https://glygen.org/publication/PubMed/14511651" } ] }, { "title": "Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus.", "journal": "Nature", "date": "2003", "authors": "Li W, Moore MJ, Vasilieva N, Sui J, Wong SK, Berne MA, Somasundaran M, Sullivan JL, Luzuriaga K, Greenough TC, Choe H, Farzan M", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "14647384", "url": "https://glygen.org/publication/PubMed/14647384" } ] }, { "title": "A 193-amino acid fragment of the SARS coronavirus S protein efficiently binds angiotensin-converting enzyme 2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wong SK, Li W, Moore MJ, Choe H, Farzan M", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "14670965", "url": "https://glygen.org/publication/PubMed/14670965" } ] }, { "title": "A novel severe acute respiratory syndrome coronavirus protein, U274, is transported to the cell surface and undergoes endocytosis.", "journal": "J. Virol.", "date": "2004", "authors": "Tan Yee-Joo, Teng Eileen, Shen Shuo, Tan Timothy H P, Goh Phuay-Yee, Fielding Burtram C, Ooi Eng-Eong, Tan Hwee-Cheng, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15194747", "url": "https://glygen.org/publication/PubMed/15194747" } ] }, { "title": "Oligomerization of the SARS-CoV S glycoprotein: dimerization of the N-terminus and trimerization of the ectodomain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2004", "authors": "Xiao Xiaodong, Feng Yang, Chakraborti Samitabh, Dimitrov Dimiter S", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15313178", "url": "https://glygen.org/publication/PubMed/15313178" } ] }, { "title": "Crystal structure of severe acute respiratory syndrome coronavirus spike protein fusion core.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Xu Yanhui, Lou Zhiyong, Liu Yiwei, Pang Hai, Tien Po, Gao George F, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15345712", "url": "https://glygen.org/publication/PubMed/15345712" } ] }, { "title": "The spike protein of severe acute respiratory syndrome (SARS) is cleaved in virus infected Vero-E6 cells.", "journal": "Cell Res.", "date": "2004", "authors": "Wu Xiao Dong, Shang Bo, Yang Rui Fu, Yu Hao, Ma Zhi Hai, Shen Xu, Ji Yong Yong, Lin Ying, Wu Ya Di, Lin Guo Mei, Tian Lin, Gan Xiao Qing, Yang Sheng, Jiang Wei Hong, Dai Er Hei, Wang Xiao Yi, Jiang Hua Liang, Xie You Hua, Zhu Xue Liang, Pei Gang, Li Lin, Wu Jia Rui, Sun Bing", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15450134", "url": "https://glygen.org/publication/PubMed/15450134" } ] }, { "title": "CD209L (L-SIGN) is a receptor for severe acute respiratory syndrome coronavirus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004-11-02", "authors": "Jeffers Scott A, Tusell Sonia M, Gillim-Ross Laura, Hemmila Erin M, Achenbach Jenna E, Babcock Gregory J, Thomas William D, Thackray Larissa B, Young Mark D, Mason Robert J, Ambrosino Donna M, Wentworth David E, Demartini James C, Holmes Kathryn V", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15496474", "url": "https://glygen.org/publication/PubMed/15496474" } ] }, { "title": "Characterization of the heptad repeat regions, HR1 and HR2, and design of a fusion core structure model of the spike protein from severe acute respiratory syndrome (SARS) coronavirus.", "journal": "Biochemistry", "date": "2004", "authors": "Xu Yanhui, Zhu Jieqing, Liu Yiwei, Lou Zhiyong, Yuan Fang, Liu Yueyong, Cole David K, Ni Ling, Su Nan, Qin Lan, Li Xu, Bai Zhihong, Bell John I, Pang Hai, Tien Po, Gao George F, Rao Zihe", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15518555", "url": "https://glygen.org/publication/PubMed/15518555" } ] }, { "title": "Structure of a proteolytically resistant core from the severe acute respiratory syndrome coronavirus S2 fusion protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Supekar Vinit M, Bruckmann Chiara, Ingallinella Paolo, Bianchi Elisabetta, Pessi Antonello, Carf\u00ed Andrea", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15604146", "url": "https://glygen.org/publication/PubMed/15604146" } ] }, { "title": "Cross-host evolution of severe acute respiratory syndrome coronavirus in palm civet and human.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Song Huai-Dong, Tu Chang-Chun, Zhang Guo-Wei, Wang Sheng-Yue, Zheng Kui, Lei Lian-Cheng, Chen Qiu-Xia, Gao Yu-Wei, Zhou Hui-Qiong, Xiang Hua, Zheng Hua-Jun, Chern Shur-Wern Wang, Cheng Feng, Pan Chun-Ming, Xuan Hua, Chen Sai-Juan, Luo Hui-Ming, Zhou Duan-Hua, Liu Yu-Fei, He Jian-Feng, Qin Peng-Zhe, Li Ling-Hui, Ren Yu-Qi, Liang Wen-Jia, Yu Ye-Dong, Anderson Larry, Wang Ming, Xu Rui-Heng, Wu Xin-Wei, Zheng Huan-Ying, Chen Jin-Ding, Liang Guodong, Gao Yang, Liao Ming, Fang Ling, Jiang Li-Yun, Li Hui, Chen Fang, Di Biao, He Li-Juan, Lin Jin-Yan, Tong Suxiang, Kong Xiangang, Du Lin, Hao Pei, Tang Hua, Bernini Andrea, Yu Xiao-Jing, Spiga Ottavia, Guo Zong-Ming, Pan Hai-Yan, He Wei-Zhong, Manuguerra Jean-Claude, Fontanet Arnaud, Danchin Antoine, Niccolai Neri, Li Yi-Xue, Wu Chung-I, Zhao Guo-Ping", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15695582", "url": "https://glygen.org/publication/PubMed/15695582" } ] }, { "title": "Receptor and viral determinants of SARS-coronavirus adaptation to human ACE2.", "journal": "The EMBO journal", "date": "2005", "authors": "Li W, Zhang C, Sui J, Kuhn JH, Moore MJ, Luo S, Wong SK, Huang IC, Xu K, Vasilieva N, Murakami A, He Y, Marasco WA, Guan Y, Choe H, Farzan M", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15791205", "url": "https://glygen.org/publication/PubMed/15791205" } ] }, { "title": "Differential maturation and subcellular localization of severe acute respiratory syndrome coronavirus surface proteins S, M and E.", "journal": "J. Gen. Virol.", "date": "2005", "authors": "Nal B\u00e9atrice, Chan Cheman, Kien Francois, Siu Lewis, Tse Jane, Chu Kid, Kam Jason, Staropoli Isabelle, Crescenzo-Chaigne Bernadette, Escriou Nicolas, van der Werf Sylvie, Yuen Kwok-Yung, Altmeyer Ralf", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15831954", "url": "https://glygen.org/publication/PubMed/15831954" } ] }, { "title": "Identification and characterization of the putative fusion peptide of the severe acute respiratory syndrome-associated coronavirus spike protein.", "journal": "J. Virol.", "date": "2005", "authors": "Sainz Bruno, Rausch Joshua M, Gallaher William R, Garry Robert F, Wimley William C", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "15890958", "url": "https://glygen.org/publication/PubMed/15890958" } ] }, { "title": "Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Simmons Graham, Gosalia Dhaval N, Rennekamp Andrew J, Reeves Jacqueline D, Diamond Scott L, Bates Paul", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "16081529", "url": "https://glygen.org/publication/PubMed/16081529" } ] }, { "title": "Structure of SARS coronavirus spike receptor-binding domain complexed with receptor.", "journal": "Science", "date": "2005", "authors": "Li F, Li W, Farzan M, Harrison SC", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "16166518", "url": "https://glygen.org/publication/PubMed/16166518" } ] }, { "title": "Furin cleavage of the SARS coronavirus spike glycoprotein enhances cell-cell fusion but does not affect virion entry.", "journal": "Virology", "date": "2006", "authors": "Follis KE, York J, Nunberg JH", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "16519916", "url": "https://glygen.org/publication/PubMed/16519916" } ] }, { "title": "Structures and polymorphic interactions of two heptad-repeat regions of the SARS virus S2 protein.", "journal": "Structure", "date": "2006", "authors": "Deng Yiqun, Liu Jie, Zheng Qi, Yong Wei, Lu Min", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "16698550", "url": "https://glygen.org/publication/PubMed/16698550" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 7a accessory protein is a viral structural protein.", "journal": "J. Virol.", "date": "2006", "authors": "Huang Cheng, Ito Naoto, Tseng Chien-Te K, Makino Shinji", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "16840309", "url": "https://glygen.org/publication/PubMed/16840309" } ] }, { "title": "Palmitoylation of the cysteine-rich endodomain of the SARS-coronavirus spike glycoprotein is important for spike-mediated cell fusion.", "journal": "Virology", "date": "2007", "authors": "Petit CM, Chouljenko VN, Iyer A, Colgrove R, Farzan M, Knipe DM, Kousoulas KG", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "17134730", "url": "https://glygen.org/publication/PubMed/17134730" } ] }, { "title": "The cytoplasmic tail of the severe acute respiratory syndrome coronavirus spike protein contains a novel endoplasmic reticulum retrieval signal that binds COPI and promotes interaction with membrane protein.", "journal": "Journal of virology", "date": "2007", "authors": "McBride CE, Li J, Machamer CE", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "17166901", "url": "https://glygen.org/publication/PubMed/17166901" } ] }, { "title": "Activation of the SARS coronavirus spike protein via sequential proteolytic cleavage at two distinct sites.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Belouzard S, Chu VC, Whittaker GR", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "19321428", "url": "https://glygen.org/publication/PubMed/19321428" } ] }, { "title": "The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis.", "journal": "Mol. Biol. Cell", "date": "2010", "authors": "Teoh KT, Siu YL, Chan WL, Schluter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "20861307", "url": "https://glygen.org/publication/PubMed/20861307" } ] }, { "title": "The SARS-CoV fusion peptide forms an extended bipartite fusion platform that perturbs membrane order in a calcium-dependent manner.", "journal": "J. Mol. Biol.", "date": "2017", "authors": "Lai Alex L, Millet Jean K, Daniel Susan, Freed Jack H, Whittaker Gary R", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "29056462", "url": "https://glygen.org/publication/PubMed/29056462" } ] }, { "title": "Severe acute respiratory syndrome coronavirus spike protein counteracts BST2-mediated restriction of virus-like particle release.", "journal": "Journal of medical virology", "date": "2019", "authors": "Wang SM, Huang KJ, Wang CT", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "reference": [ { "type": "PubMed", "id": "31199522", "url": "https://glygen.org/publication/PubMed/31199522" } ] }, { "title": "Comprehensive Analysis of the Glycan Complement of SARS-CoV-2 Spike Proteins Using Signature Ions-Triggered Electron-Transfer/Higher-Energy Collisional Dissociation (EThcD) Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2020", "authors": "Wang D, Baudys J, Bundy JL, Solano M, Keppel T, Barr JR", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000628", "url": "http://data.glygen.org/GLY_000628" } ], "reference": [ { "type": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC2-1", "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT", "length": 1273 }, "evidence": [ { "id": "UniRef50_P0DTC2", "url": "https://www.uniprot.org/uniref/UniRef50_P0DTC2", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "viral envelope", "id": "GO:0019031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019031", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0044173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044173", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "host cell surface receptor binding", "id": "GO:0046789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046789", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "positive regulation of viral entry into host cell", "id": "GO:0046598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046598", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "receptor-mediated virion attachment to host cell", "id": "GO:0046813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046813", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "membrane fusion", "id": "GO:0061025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061025", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "fusion of virus membrane with host plasma membrane", "id": "GO:0019064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019064", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "symbiont-mediated-mediated suppression of host tetherin activity", "id": "GO:0039587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039587", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "endocytosis involved in viral entry into host cell", "id": "GO:0075509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075509", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "fusion of virus membrane with host endosome membrane", "id": "GO:0039654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039654", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1056, "end_pos": 1058, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1080, "end_pos": 1082, "annotation": "n_glycosylation_sequon" }, { "start_pos": 109, "end_pos": 111, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1116, "end_pos": 1118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1140, "end_pos": 1142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1155, "end_pos": 1157, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1176, "end_pos": 1178, "annotation": "n_glycosylation_sequon" }, { "start_pos": 118, "end_pos": 120, "annotation": "n_glycosylation_sequon" }, { "start_pos": 119, "end_pos": 121, "annotation": "n_glycosylation_sequon" }, { "start_pos": 158, "end_pos": 160, "annotation": "n_glycosylation_sequon" }, { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" }, { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" }, { "start_pos": 318, "end_pos": 320, "annotation": "n_glycosylation_sequon" }, { "start_pos": 330, "end_pos": 332, "annotation": "n_glycosylation_sequon" }, { "start_pos": 357, "end_pos": 359, "annotation": "n_glycosylation_sequon" }, { "start_pos": 589, "end_pos": 591, "annotation": "n_glycosylation_sequon" }, { "start_pos": 602, "end_pos": 604, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" }, { "start_pos": 691, "end_pos": 693, "annotation": "n_glycosylation_sequon" }, { "start_pos": 699, "end_pos": 701, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" }, { "start_pos": 783, "end_pos": 785, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "The cytoplasmic Cys-rich domain is palmitoylated. Spike glycoprotein is digested by cathepsin CTSL within endosomes.", "evidence": [ { "database": "UniProtKB", "id": "P59594", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "database": "PubMed", "id": "17134730", "url": "https://glygen.org/publication/PubMed/17134730" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "id": "PRU01269", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01269" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "BetaCoV S1-CTD", "eco_id": "ECO_0000255", "start_pos": 321, "end_pos": 513, "start_aa": "Asn", "end_aa": "Pro", "glycosite_overlap": "Asn330,Asn357" }, { "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "id": "PRU01270", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01270" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "BetaCoV S1-NTD", "eco_id": "ECO_0000255", "start_pos": 14, "end_pos": 290, "start_aa": "Ser", "end_aa": "Val", "glycosite_overlap": "Asn109,Asn65,Asn119,Asn158,Asn227,Asn269,Asn29,Asn73,Asn118" }, { "evidence": [ { "id": "P59594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59594" }, { "id": "MF_04099", "database": "HAMAP", "url": "https://hamap.expasy.org/signature/MF_04099" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "KxHxx", "eco_id": "ECO_0000255", "start_pos": 1251, "end_pos": 1255, "start_aa": "Lys", "end_aa": "Thr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [ 29, 65, 73, 109, 118, 119, 158, 227, 269, 318, 330, 357, 589, 602, 691, 699, 783, 1056, 1080, 1116, 1140, 1155, 1176 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1056, "end_pos": 1058 }, { "start_pos": 1080, "end_pos": 1082 }, { "start_pos": 109, "end_pos": 111 }, { "start_pos": 1116, "end_pos": 1118 }, { "start_pos": 1140, "end_pos": 1142 }, { "start_pos": 1155, "end_pos": 1157 }, { "start_pos": 1176, "end_pos": 1178 }, { "start_pos": 118, "end_pos": 120 }, { "start_pos": 119, "end_pos": 121 }, { "start_pos": 158, "end_pos": 160 }, { "start_pos": 227, "end_pos": 229 }, { "start_pos": 269, "end_pos": 271 }, { "start_pos": 29, "end_pos": 31 }, { "start_pos": 318, "end_pos": 320 }, { "start_pos": 330, "end_pos": 332 }, { "start_pos": 357, "end_pos": 359 }, { "start_pos": 589, "end_pos": 591 }, { "start_pos": 602, "end_pos": 604 }, { "start_pos": 65, "end_pos": 67 }, { "start_pos": 691, "end_pos": 693 }, { "start_pos": 699, "end_pos": 701 }, { "start_pos": 73, "end_pos": 75 }, { "start_pos": 783, "end_pos": 785 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 140 }, { "field": "total_sites", "count": 23 }, { "field": "n_linked_sites", "count": 23 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 18 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 23 }, { "field": "exact_n_linked;o_linked_sites", "count": 18 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 18 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_n_linked_sites", "count": 23 }, { "field": "exact_n_linked_glycan_sites", "count": 18 }, { "field": "exact_n_linked_glycans", "count": 11 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 22 }, { "field": "n_linked_sites", "count": 22 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 22 }, { "field": "exact_n_linked_sites", "count": 22 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 117 }, { "field": "total_sites", "count": 22 }, { "field": "n_linked_sites", "count": 18 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 18 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 22 }, { "field": "exact_n_linked;o_linked_sites", "count": 18 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 18 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_n_linked_sites", "count": 18 }, { "field": "exact_n_linked_glycan_sites", "count": 18 }, { "field": "exact_n_linked_glycans", "count": 11 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59595-1", "uniprot_ac": "P59595", "uniprot_id": "NCAP_SARS", "mass": { "chemical_mass": 46025.0, "monoisotopic_mass": 46025.0 }, "refseq": {}, "gene_names": [ { "name": "N", "type": "recommended", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595" } ] }, { "name": "9a", "type": "synonym", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595" } ] } ], "protein_names": [ { "name": "Nucleoprotein", "type": "recommended", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595/entry#names_and_taxonomy" } ] }, { "name": "NC", "type": "synonym", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595/entry#names_and_taxonomy" } ] }, { "name": "Nucleocapsid protein", "type": "synonym", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595/entry#names_and_taxonomy" } ] }, { "name": "Protein N", "type": "synonym", "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication (PubMed:17210170). May modulate transforming growth factor-beta signaling by binding host SMAD3 (PubMed:18055455).", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595#function" }, { "database": "PubMed", "id": "18055455", "url": "https://glygen.org/publication/PubMed/18055455" }, { "database": "PubMed", "id": "17210170", "url": "https://glygen.org/publication/PubMed/17210170" }, { "database": "HAMAP", "id": "MF_04096", "url": "https://hamap.expasy.org/signature/MF_04096" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 257, "end_pos": 262, "sequence_org": "KKPRQK", "sequence_mut": "GGPRQG", "comment": "Loss of cleavage by host CASP6.", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "database": "PubMed", "id": "18155731", "url": "https://glygen.org/publication/PubMed/18155731" } ] }, { "start_pos": 400, "end_pos": 403, "sequence_org": "DMDD", "sequence_mut": "EMDE", "comment": "Loss of cleavage by host CASP6.", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "database": "PubMed", "id": "18155731", "url": "https://glygen.org/publication/PubMed/18155731" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "N", "url": "https://www.uniprot.org/uniprotkb/P59595", "locus": {} } ], "crossref": [ { "id": "1SSK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1SSK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1X7Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1X7Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2CJR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2CJR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2GIB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2GIB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2JW8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2JW8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OFZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OFZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OG3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OG3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3I6L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3I6L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IEX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IEX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LG0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LG0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59595", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59595*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001218", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001218", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037195", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037195", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043505", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043505", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044344", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044344", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001ssk", "url": "https://www.rcsb.org/structure/pdb_00001ssk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001x7q", "url": "https://www.rcsb.org/structure/pdb_00001x7q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002cjr", "url": "https://www.rcsb.org/structure/pdb_00002cjr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002gib", "url": "https://www.rcsb.org/structure/pdb_00002gib", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002jw8", "url": "https://www.rcsb.org/structure/pdb_00002jw8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ofz", "url": "https://www.rcsb.org/structure/pdb_00002ofz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002og3", "url": "https://www.rcsb.org/structure/pdb_00002og3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003i6l", "url": "https://www.rcsb.org/structure/pdb_00003i6l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006iex", "url": "https://www.rcsb.org/structure/pdb_00006iex", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lg0", "url": "https://www.rcsb.org/structure/pdb_00007lg0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SSK", "url": "https://www.rcsb.org/structure/1SSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1X7Q", "url": "https://www.rcsb.org/structure/1X7Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2CJR", "url": "https://www.rcsb.org/structure/2CJR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GIB", "url": "https://www.rcsb.org/structure/2GIB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JW8", "url": "https://www.rcsb.org/structure/2JW8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OFZ", "url": "https://www.rcsb.org/structure/2OFZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OG3", "url": "https://www.rcsb.org/structure/2OG3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I6L", "url": "https://www.rcsb.org/structure/3I6L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IEX", "url": "https://www.rcsb.org/structure/6IEX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LG0", "url": "https://www.rcsb.org/structure/7LG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00937", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00937", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59595-1", "url": "https://www.uniprot.org/uniprotkb/P59595-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA", "length": 422, "header": "sp|P59595-1|NCAP_SARS Isoform 1 of Nucleoprotein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=N PE=1 SV=1 CANONICAL=P59595-1" }, "isoforms": [ { "isoform_ac": "P59595-1", "url": "https://www.uniprot.org/uniprotkb/P59595/entry#P59595-1", "sequence": { "sequence": "MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA", "length": 422, "header": "sp|P59595-1|NCAP_SARS Isoform 1 of Nucleoprotein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=N PE=1 SV=1 CANONICAL=P59595-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "site_lbl": "Ser177" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus genotype and its characterization.", "journal": "Chin. Med. J.", "date": "2003", "authors": "Li Lanjuan, Wang Zhigang, Lu Yiyu, Bao Qiyu, Chen Suhong, Wu Nanping, Cheng Suyun, Weng Jingqing, Zhang Yanjun, Yan Juying, Mei Lingling, Wang Xiaomeng, Zhu Hanping, Yu Yingpu, Zhang Minli, Li Minhong, Yao Jun, Lu Qunying, Yao Pingping, Bo Xiaochen, Wo Jianer, Wang Shengqi, Hu Songnian", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "14527350", "url": "https://glygen.org/publication/PubMed/14527350" } ] }, { "title": "Structure of the N-terminal RNA-binding domain of the SARS CoV nucleocapsid protein.", "journal": "Biochemistry", "date": "2004", "authors": "Huang Qiulong, Yu Liping, Petros Andrew M, Gunasekera Angelo, Liu Zhihong, Xu Nan, Hajduk Philip, Mack Jamey, Fesik Stephen W, Olejniczak Edward T", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "15147189", "url": "https://glygen.org/publication/PubMed/15147189" } ] }, { "title": "Characterization of protein-protein interactions between the nucleocapsid protein and membrane protein of the SARS coronavirus.", "journal": "Virus Res.", "date": "2004", "authors": "He Runtao, Leeson Andrew, Ballantine Melissa, Andonov Anton, Baker Lindsay, Dobie Frederick, Li Yan, Bastien Nathalie, Feldmann Heinz, Strocher Ute, Theriault Steven, Cutts Todd, Cao Jingxin, Booth Timothy F, Plummer Frank A, Tyler Shaun, Li Xuguang", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "15351485", "url": "https://glygen.org/publication/PubMed/15351485" } ] }, { "title": "Function of HAb18G/CD147 in invasion of host cells by severe acute respiratory syndrome coronavirus.", "journal": "J. Infect. Dis.", "date": "2005", "authors": "Chen Zhinan, Mi Li, Xu Jing, Yu Jiyun, Wang Xianhui, Jiang Jianli, Xing Jinliang, Shang Peng, Qian Airong, Li Yu, Shaw Peter X, Wang Jianwei, Duan Shumin, Ding Jin, Fan Chunmei, Zhang Yang, Yang Yong, Yu Xiaoling, Feng Qiang, Li Biehu, Yao Xiying, Zhang Zheng, Li Ling, Xue Xiaoping, Zhu Ping", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "15688292", "url": "https://glygen.org/publication/PubMed/15688292" } ] }, { "title": "The nucleocapsid protein of SARS coronavirus has a high binding affinity to the human cellular heterogeneous nuclear ribonucleoprotein A1.", "journal": "FEBS Lett.", "date": "2005", "authors": "Luo H, Chen Q, Chen J, Chen K, Shen X, Jiang H", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "15862300", "url": "https://glygen.org/publication/PubMed/15862300" } ] }, { "title": "High-resolution structure of HLA-A*1101 in complex with SARS nucleocapsid peptide.", "journal": "Acta Crystallogr. D", "date": "2005", "authors": "Blicher Thomas, Kastrup Jette Sandholm, Buus S\u00f8ren, Gajhede Michael", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "16041067", "url": "https://glygen.org/publication/PubMed/16041067" } ] }, { "title": "Crystal structure of the severe acute respiratory syndrome (SARS) coronavirus nucleocapsid protein dimerization domain reveals evolutionary linkage between corona- and arteriviridae.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Yu I-Mei, Oldham Michael L, Zhang Jingqiang, Chen Jue", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "16627473", "url": "https://glygen.org/publication/PubMed/16627473" } ] }, { "title": "The intracellular sites of early replication and budding of SARS-coronavirus.", "journal": "Virology", "date": "2007-05-10", "authors": "Stertz Silke, Reichelt Mike, Spiegel Martin, Kuri Thomas, Mart\u00ednez-Sobrido Luis, Garc\u00eda-Sastre Adolfo, Weber Friedemann, Kochs Georg", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "17210170", "url": "https://glygen.org/publication/PubMed/17210170" } ] }, { "title": "Ribonucleocapsid formation of severe acute respiratory syndrome coronavirus through molecular action of the N-terminal domain of N protein.", "journal": "J. Virol.", "date": "2007", "authors": "Saikatendu Kumar Singh, Joseph Jeremiah S, Subramanian Vanitha, Neuman Benjamin W, Buchmeier Michael J, Stevens Raymond C, Kuhn Peter", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "17229691", "url": "https://glygen.org/publication/PubMed/17229691" } ] }, { "title": "Structure of the SARS coronavirus nucleocapsid protein RNA-binding dimerization domain suggests a mechanism for helical packaging of viral RNA.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Chen Chun-Yuan, Chang Chung-Ke, Chang Yi-Wei, Sue Shih-Che, Bai Hsin-I, Riang Lilianty, Hsiao Chwan-Deng, Huang Tai-Huang", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "17379242", "url": "https://glygen.org/publication/PubMed/17379242" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus nucleocapsid protein interacts with Smad3 and modulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao X, Nicholls JM, Chen YG", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "18055455", "url": "https://glygen.org/publication/PubMed/18055455" } ] }, { "title": "Cell type-specific cleavage of nucleocapsid protein by effector caspases during SARS coronavirus infection.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Diemer C, Schneider M, Seebach J, Quaas J, Frosner G, Schatzl HM, Gilch S", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "18155731", "url": "https://glygen.org/publication/PubMed/18155731" } ] }, { "title": "Solution structure of the c-terminal dimerization domain of SARS coronavirus nucleocapsid protein solved by the SAIL-NMR method.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Takeda Mitsuhiro, Chang Chung-ke, Ikeya Teppei, G\u00fcntert Peter, Chang Yuan-hsiang, Hsu Yen-lan, Huang Tai-huang, Kainosho Masatsune", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "18561946", "url": "https://glygen.org/publication/PubMed/18561946" } ] }, { "title": "Glycogen synthase kinase-3 regulates the phosphorylation of severe acute respiratory syndrome coronavirus nucleocapsid protein and viral replication.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wu CH, Yeh SH, Tsay YG, Shieh YH, Kao CL, Chen YS, Wang SH, Kuo TJ, Chen DS, Chen PJ", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "19106108", "url": "https://glygen.org/publication/PubMed/19106108" } ] }, { "title": "Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein.", "journal": "J. Virol.", "date": "2010", "authors": "Liu Jun, Wu Peng, Gao Feng, Qi Jianxun, Kawana-Tachikawa Ai, Xie Jing, Vavricka Christopher J, Iwamoto Aikichi, Li Taisheng, Gao George F", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "20844028", "url": "https://glygen.org/publication/PubMed/20844028" } ] }, { "title": "SARS-CoV envelope protein palmitoylation or nucleocapid association is not required for promoting virus-like particle production.", "journal": "Journal of biomedical science", "date": "2014", "authors": "Tseng YT, Wang SM, Huang KJ, Wang CT", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "24766657", "url": "https://glygen.org/publication/PubMed/24766657" } ] }, { "title": "The coronavirus nucleocapsid protein is ADP-ribosylated.", "journal": "Virology", "date": "2018", "authors": "Grunewald ME, Fehr AR, Athmer J, Perlman S", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "29199039", "url": "https://glygen.org/publication/PubMed/29199039" } ] }, { "title": "SR/RS Motifs as Critical Determinants of Coronavirus Life Cycle.", "journal": "Frontiers in molecular biosciences", "date": "2020", "authors": "Nikolakaki Eleni, Giannakouros Thomas", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "32974389", "url": "https://glygen.org/publication/PubMed/32974389" } ] }, { "title": "Coronaviruses exploit a host cysteine-aspartic protease for replication.", "journal": "Nature", "date": "2022", "authors": "Chu H, Hou Y, Yang D, Wen L, Shuai H, Yoon C, Shi J, Chai Y, Yuen TT, Hu B, Li C, Zhao X, Wang Y, Huang X, Lee KS, Luo C, Cai JP, Poon VK, Chan CC, Zhang AJ, Yuan S, Sit KY, Foo DC, Au WK, Wong KK, Zhou J, Kok KH, Jin DY, Chan JF, Yuen KY", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "reference": [ { "type": "PubMed", "id": "35922005", "url": "https://glygen.org/publication/PubMed/35922005" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC9-1", "protein_name": "Nucleoprotein", "gene_name": "N", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA", "length": 419 }, "evidence": [ { "id": "UniRef90_P0DTC9", "url": "https://www.uniprot.org/uniref/UniRef90_P0DTC9", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "viral RNA genome packaging", "id": "GO:0019074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019074", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "host cell nucleus", "id": "GO:0042025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042025", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "viral capsid", "id": "GO:0019028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019028", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "host cell perinuclear region of cytoplasm", "id": "GO:0044220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044220", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum-Golgi intermediate compartment", "id": "GO:0044172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044172", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "host cell Golgi apparatus", "id": "GO:0044177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044177", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 197, "end_pos": 199, "annotation": "n_glycosylation_sequon" }, { "start_pos": 270, "end_pos": 272, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "ADP-ribosylated. The ADP-ribosylation is retained in the virion during infection.", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "database": "PubMed", "id": "29199039", "url": "https://glygen.org/publication/PubMed/29199039" } ] }, { "annotation": "Phosphorylated on serine and threonine residues (PubMed:19106108). Phosphorylated by host GSK3A and GSK3B. Phosphorylation allows recruitment of host RNA helicase DDX1 which facilitates template readthrough and enables longer subgenomic mRNA synthesis. This promotes the solubility of homodimers that would otherwise aggregate (PubMed:32974389). Host phosphatase would dephosphorylate the protein during assembly at M bound membranes (PubMed:32974389).", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "database": "PubMed", "id": "19106108", "url": "https://glygen.org/publication/PubMed/19106108" }, { "database": "PubMed", "id": "32974389", "url": "https://glygen.org/publication/PubMed/32974389" }, { "database": "PubMed", "id": "24766657", "url": "https://glygen.org/publication/PubMed/24766657" } ] }, { "annotation": "Proteolytically cleaved by host CASP6. The cleavage leads to two fragments and facilitates viral replication by inhibiting host IFN signaling. The two fragments may interact with IRF3 inhibiting its nuclear translocation after activation and reduce the expression of IFNB and IFN-stimulated genes.", "evidence": [ { "database": "UniProtKB", "id": "P59595", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "database": "PubMed", "id": "35922005", "url": "https://glygen.org/publication/PubMed/35922005" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "id": "PRU01277", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01277" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV N CTD", "eco_id": "ECO_0000255", "start_pos": 248, "end_pos": 365, "start_aa": "Thr", "end_aa": "Pro", "glycosite_overlap": "" }, { "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "id": "PRU01276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01276" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV N NTD", "eco_id": "ECO_0000255", "start_pos": 49, "end_pos": 176, "start_aa": "Asn", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "P59595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59595" }, { "id": "18155731", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18155731" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Nuclear localization signal", "eco_id": "ECO_0000269", "start_pos": 257, "end_pos": 265, "start_aa": "Lys", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 177 ], "sequon_annotation_sites": [ { "start_pos": 197, "end_pos": 199 }, { "start_pos": 270, "end_pos": 272 }, { "start_pos": 48, "end_pos": 50 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59596-1", "uniprot_ac": "P59596", "uniprot_id": "VME1_SARS", "mass": { "chemical_mass": 25061.0, "monoisotopic_mass": 25061.0 }, "refseq": {}, "gene_names": [ { "name": "M", "type": "recommended", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596" } ] }, { "name": "5", "type": "synonym", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596" } ] } ], "protein_names": [ { "name": "Membrane protein", "type": "recommended", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#names_and_taxonomy" } ] }, { "name": "E1 glycoprotein", "type": "synonym", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#names_and_taxonomy" } ] }, { "name": "M protein", "type": "synonym", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#names_and_taxonomy" } ] }, { "name": "Matrix glycoprotein", "type": "synonym", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#names_and_taxonomy" } ] }, { "name": "Membrane glycoprotein", "type": "synonym", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596#function" }, { "database": "UniProtKB", "id": "PRU01275", "url": "https://www.uniprot.org/uniprotkb/PRU01275#function" }, { "database": "HAMAP", "id": "MF_04202", "url": "https://hamap.expasy.org/signature/MF_04202" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "M", "url": "https://www.uniprot.org/uniprotkb/P59596", "locus": {} } ], "crossref": [ { "id": "3I6G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3I6G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3I6K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3I6K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3TO2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3TO2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9NZ4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9NZ4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59596", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59596*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002574", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002574", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044361", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044361", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00003i6g", "url": "https://www.rcsb.org/structure/pdb_00003i6g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003i6k", "url": "https://www.rcsb.org/structure/pdb_00003i6k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003to2", "url": "https://www.rcsb.org/structure/pdb_00003to2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009nz4", "url": "https://www.rcsb.org/structure/pdb_00009nz4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I6G", "url": "https://www.rcsb.org/structure/3I6G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I6K", "url": "https://www.rcsb.org/structure/3I6K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TO2", "url": "https://www.rcsb.org/structure/3TO2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9NZ4", "url": "https://www.rcsb.org/structure/9NZ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01635", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01635", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59596-1", "url": "https://www.uniprot.org/uniprotkb/P59596-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ", "length": 221, "header": "sp|P59596-1|VME1_SARS Isoform 1 of Membrane protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=M PE=1 SV=1 CANONICAL=P59596-1" }, "isoforms": [ { "isoform_ac": "P59596-1", "url": "https://www.uniprot.org/uniprotkb/P59596/entry#P59596-1", "sequence": { "sequence": "MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ", "length": 221, "header": "sp|P59596-1|VME1_SARS Isoform 1 of Membrane protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=M PE=1 SV=1 CANONICAL=P59596-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 4, "start_aa": "Asn", "end_pos": 4, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4", "evidence": [ { "id": "P59596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59596#ptm_processing" }, { "id": "19534833", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19534833" }, { "id": "GLY_000612", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000612" }, { "id": "GLY_000612", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000612" }, { "id": "16442106", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16442106" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "A novel severe acute respiratory syndrome coronavirus protein, U274, is transported to the cell surface and undergoes endocytosis.", "journal": "J. Virol.", "date": "2004", "authors": "Tan Yee-Joo, Teng Eileen, Shen Shuo, Tan Timothy H P, Goh Phuay-Yee, Fielding Burtram C, Ooi Eng-Eong, Tan Hwee-Cheng, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "15194747", "url": "https://glygen.org/publication/PubMed/15194747" } ] }, { "title": "Subcellular localization and membrane association of SARS-CoV 3a protein.", "journal": "Virus Res.", "date": "2005", "authors": "Yuan Xiaoling, Li Jianyong, Shan Yajun, Yang Zhen, Zhao Zhenhu, Chen Bo, Yao Zhenyu, Dong Bo, Wang Shengqi, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "15763150", "url": "https://glygen.org/publication/PubMed/15763150" } ] }, { "title": "Characterization of severe acute respiratory syndrome coronavirus membrane protein.", "journal": "FEBS letters", "date": "2006", "authors": "Voss D, Kern A, Traggiai E, Eickmann M, Stadler K, Lanzavecchia A, Becker S", "evidence": [ { "database": "GlyGen", "id": "GLY_000612", "url": "https://data.glygen.org/GLY_000612" } ], "reference": [ { "type": "PubMed", "id": "16442106", "url": "https://glygen.org/publication/PubMed/16442106" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein 7a interacts with hSGT.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Fielding Burtram C, Gunalan Vithiagaran, Tan Timothy H P, Chou Chih-Fong, Shen Shuo, Khan Sehaam, Lim Seng Gee, Hong Wanjin, Tan Yee-Joo", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "16580632", "url": "https://glygen.org/publication/PubMed/16580632" } ] }, { "title": "Studies on membrane topology, N-glycosylation and functionality of SARS-CoV membrane protein.", "journal": "Virology journal", "date": "2009", "authors": "Voss D, Pfefferle S, Drosten C, Stevermann L, Traggiai E, Lanzavecchia A, Becker S", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596#ptm_processing" }, { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "reference": [ { "type": "PubMed", "id": "19534833", "url": "https://glygen.org/publication/PubMed/19534833" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC5-1", "protein_name": "Membrane protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ", "length": 222 }, "evidence": [ { "id": "GLY_000258", "url": "https://data.glygen.org/GLY_000258", "database": "GlyGen" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" }, { "name": "viral envelope", "id": "GO:0019031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019031", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" }, { "name": "host cell Golgi membrane", "id": "GO:0044178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044178", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" }, { "name": "structural constituent of virion", "id": "GO:0039660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039660", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "symbiont-mediated perturbation of host defense response", "id": "GO:0052031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052031", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated at N-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P59596", "url": "https://www.uniprot.org/uniprotkb/P59596" }, { "database": "PubMed", "id": "19534833", "url": "https://glygen.org/publication/PubMed/19534833" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.glygen", "label": "GlyGen Homologs" } ], "sequence_features": { "n_linked_sites": [ 4 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 4, "end_pos": 6 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59632-1", "uniprot_ac": "P59632", "uniprot_id": "AP3A_SARS", "mass": { "chemical_mass": 30903.0, "monoisotopic_mass": 30903.0 }, "refseq": {}, "gene_names": [ { "name": "3a", "type": "synonym", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632" } ] } ], "protein_names": [ { "name": "ORF3a protein", "type": "recommended", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 3a", "type": "synonym", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#names_and_taxonomy" } ] }, { "name": "Protein 3a", "type": "synonym", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#names_and_taxonomy" } ] }, { "name": "Protein U274", "type": "synonym", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#names_and_taxonomy" } ] }, { "name": "Protein X1", "type": "synonym", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Forms homotetrameric potassium sensitive ion channels (viroporin) and may modulate virus release. Up-regulates expression of fibrinogen subunits FGA, FGB and FGG in host lung epithelial cells. Induces apoptosis in cell culture. Down-regulates the type 1 interferon receptor by inducing serine phosphorylation within the IFN alpha-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632#function" }, { "database": "PubMed", "id": "20020050", "url": "https://glygen.org/publication/PubMed/20020050" }, { "database": "PubMed", "id": "15958670", "url": "https://glygen.org/publication/PubMed/15958670" }, { "database": "PubMed", "id": "16014971", "url": "https://glygen.org/publication/PubMed/16014971" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 117, "end_pos": 117, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 121, "end_pos": 121, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 127, "end_pos": 127, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 130, "end_pos": 130, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 133, "end_pos": 133, "sequence_org": "C", "sequence_mut": "A", "comment": "Almost complete loss of polymerization ability.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 148, "end_pos": 148, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 157, "end_pos": 157, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "start_pos": 27, "end_pos": 27, "sequence_org": "S", "sequence_mut": "G", "comment": "Complete loss of O-glycosylation; when associated with A-28; A-32 and A-34.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "start_pos": 28, "end_pos": 28, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of O-glycosylation; when associated with A-27; A-32 and A-34.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of O-glycosylation; when associated with A-27; A-28 and A-34.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "start_pos": 34, "end_pos": 34, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of O-glycosylation; when associated with A-27; A-28 and A-32.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "start_pos": 81, "end_pos": 81, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P59632", "locus": {} } ], "crossref": [ { "id": "8EQS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8EQS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59632", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59632*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR024407", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024407", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046445", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046445", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046446", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046446", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00008eqs", "url": "https://www.rcsb.org/structure/pdb_00008eqs", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EQS", "url": "https://www.rcsb.org/structure/8EQS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF11289", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11289", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59632-1", "url": "https://www.uniprot.org/uniprotkb/P59632-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL", "length": 274, "header": "sp|P59632-1|AP3A_SARS Isoform 1 of ORF3a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59632-1" }, "isoforms": [ { "isoform_ac": "P59632-1", "url": "https://www.uniprot.org/uniprotkb/P59632/entry#P59632-1", "sequence": { "sequence": "MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL", "length": 274, "header": "sp|P59632-1|AP3A_SARS Isoform 1 of ORF3a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59632-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 28, "start_aa": "Thr", "end_pos": 28, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr28", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632#ptm_processing" }, { "id": "16474139", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632#ptm_processing" }, { "id": "16474139", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 34, "start_aa": "Thr", "end_pos": 34, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr34", "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Identification of a novel protein 3a from severe acute respiratory syndrome coronavirus.", "journal": "FEBS Lett.", "date": "2004", "authors": "Yu Chia-Jung, Chen Yee-Chun, Hsiao Cheng-Hsiang, Kuo Tse-Chun, Chang Shin C, Lu Chun-Yi, Wei Wen-Chin, Lee Chia-Huei, Huang Li-Min, Chang Ming-Fu, Ho Hong-Nerng, Lee Fang-Jen S", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15135062", "url": "https://glygen.org/publication/PubMed/15135062" } ] }, { "title": "A novel severe acute respiratory syndrome coronavirus protein, U274, is transported to the cell surface and undergoes endocytosis.", "journal": "J. Virol.", "date": "2004", "authors": "Tan Yee-Joo, Teng Eileen, Shen Shuo, Tan Timothy H P, Goh Phuay-Yee, Fielding Burtram C, Ooi Eng-Eong, Tan Hwee-Cheng, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15194747", "url": "https://glygen.org/publication/PubMed/15194747" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 3a protein is a viral structural protein.", "journal": "J. Virol.", "date": "2005", "authors": "Ito Naoto, Mossel Eric C, Narayanan Krishna, Popov Vsevolod L, Huang Cheng, Inoue Taisuke, Peters Clarence J, Makino Shinji", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15709039", "url": "https://glygen.org/publication/PubMed/15709039" } ] }, { "title": "Subcellular localization and membrane association of SARS-CoV 3a protein.", "journal": "Virus Res.", "date": "2005", "authors": "Yuan Xiaoling, Li Jianyong, Shan Yajun, Yang Zhen, Zhao Zhenhu, Chen Bo, Yao Zhenyu, Dong Bo, Wang Shengqi, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15763150", "url": "https://glygen.org/publication/PubMed/15763150" } ] }, { "title": "The severe acute respiratory syndrome coronavirus 3a is a novel structural protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Shen Shuo, Lin Pi-Shiu, Chao Yu-Chan, Zhang Aihua, Yang Xiaoming, Lim Seng Gee, Hong Wanjin, Tan Yee-Joo", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15781262", "url": "https://glygen.org/publication/PubMed/15781262" } ] }, { "title": "The 3a protein of severe acute respiratory syndrome-associated coronavirus induces apoptosis in Vero E6 cells.", "journal": "The Journal of general virology", "date": "2005-07", "authors": "Law Patrick T W, Wong Chi-Hang, Au Thomas C C, Chuck Chi-Pang, Kong Siu-Kai, Chan Paul K S, To Ka-Fai, Lo Anthony W I, Chan Judy Y W, Suen Yick-Keung, Chan H Y Edwin, Fung Kwok-Pui, Waye Mary M Y, Sung Joseph J Y, Lo Y M Dennis, Tsui Stephen K W", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "15958670", "url": "https://glygen.org/publication/PubMed/15958670" } ] }, { "title": "The severe acute respiratory syndrome coronavirus 3a protein up-regulates expression of fibrinogen in lung epithelial cells.", "journal": "Journal of virology", "date": "2005-08", "authors": "Tan Yee-Joo, Tham Puay-Yoke, Chan Daphne Z L, Chou Chih-Fong, Shen Shuo, Fielding Burtram C, Tan Timothy H P, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "16014971", "url": "https://glygen.org/publication/PubMed/16014971" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 3a protein is released in membranous structures from 3a protein-expressing cells and infected cells.", "journal": "J. Virol.", "date": "2006", "authors": "Huang Cheng, Narayanan Krishna, Ito Naoto, Peters C J, Makino Shinji", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "16352545", "url": "https://glygen.org/publication/PubMed/16352545" } ] }, { "title": "Glycosylation of the severe acute respiratory syndrome coronavirus triple-spanning membrane proteins 3a and M.", "journal": "Journal of virology", "date": "2006", "authors": "Oostra M, de Haan CA, de Groot RJ, Rottier PJ", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632#ptm_processing" }, { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus 3a protein forms an ion channel and modulates virus release.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Lu W, Zheng BJ, Xu K, Schwarz W, Du L, Wong CK, Chen J, Duan S, Deubel V, Sun B", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "16894145", "url": "https://glygen.org/publication/PubMed/16894145" } ] }, { "title": "The SARS Coronavirus 3a protein causes endoplasmic reticulum stress and induces ligand-independent downregulation of the type 1 interferon receptor.", "journal": "PloS one", "date": "2009-12-17", "authors": "Minakshi Rinki, Padhan Kartika, Rani Manjusha, Khan Nabab, Ahmad Faizan, Jameel Shahid", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "reference": [ { "type": "PubMed", "id": "20020050", "url": "https://glygen.org/publication/PubMed/20020050" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC3-1", "protein_name": "ORF3a protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL", "length": 275 }, "evidence": [ { "id": "UniRef50_P59632", "url": "https://www.uniprot.org/uniref/UniRef50_P59632", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "monoatomic ion channel activity", "id": "GO:0005216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005216", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "host cell Golgi membrane", "id": "GO:0044178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044178", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" }, { "name": "symbiont-mediated activation of host inflammasome-mediated signal transduction", "id": "GO:0141079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0141079", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" }, { "start_pos": 22, "end_pos": 24, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Exists in both O-glycosylated and non-glycosylated forms. The glycosylated form is associated with the virion.", "evidence": [ { "database": "UniProtKB", "id": "P59632", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "database": "PubMed", "id": "16474139", "url": "https://glygen.org/publication/PubMed/16474139" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "id": "PRU01312", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01312" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV 3a-like viroporin CD", "eco_id": "ECO_0000255", "start_pos": 145, "end_pos": 237, "start_aa": "Tyr", "end_aa": "Val", "glycosite_overlap": "" }, { "evidence": [ { "id": "P59632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59632" }, { "id": "PRU01311", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01311" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "CoV 3a-like viroporin TM", "eco_id": "ECO_0000255", "start_pos": 33, "end_pos": 141, "start_aa": "Ala", "end_aa": "Tyr", "glycosite_overlap": "Thr34" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 27, 28, 32, 34 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 227, "end_pos": 229 }, { "start_pos": 22, "end_pos": 24 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59633-1", "uniprot_ac": "P59633", "uniprot_id": "NS3B_SARS", "mass": { "chemical_mass": 17750.0, "monoisotopic_mass": 17750.0 }, "refseq": {}, "gene_names": [ { "name": "3b", "type": "synonym", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633" } ] } ], "protein_names": [ { "name": "ORF3b protein", "type": "recommended", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 3b", "type": "synonym", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 3b", "type": "synonym", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#names_and_taxonomy" } ] }, { "name": "Protein X2", "type": "synonym", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#names_and_taxonomy" } ] }, { "name": "ns3b", "type": "synonym", "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Induces host cell G0/G1 arrest and apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633#function" }, { "database": "PubMed", "id": "16107218", "url": "https://glygen.org/publication/PubMed/16107218" }, { "database": "PubMed", "id": "16682811", "url": "https://glygen.org/publication/PubMed/16682811" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P59633", "locus": {} } ], "crossref": [ { "id": "P59633", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59633*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR022117", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022117", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF12383", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12383", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59633-1", "url": "https://www.uniprot.org/uniprotkb/P59633-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQVR", "length": 154, "header": "sp|P59633-1|NS3B_SARS Isoform 1 of ORF3b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59633-1" }, "isoforms": [ { "isoform_ac": "P59633-1", "url": "https://www.uniprot.org/uniprotkb/P59633/entry#P59633-1", "sequence": { "sequence": "MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQVR", "length": 154, "header": "sp|P59633-1|NS3B_SARS Isoform 1 of ORF3b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59633-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Nucleolar localization of non-structural protein 3b, a protein specifically encoded by the severe acute respiratory syndrome coronavirus.", "journal": "Virus Res.", "date": "2005", "authors": "Yuan Xiaoling, Yao Zhenyu, Shan Yajun, Chen Bo, Yang Zhen, Wu Jie, Zhao Zhenhu, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "16046244", "url": "https://glygen.org/publication/PubMed/16046244" } ] }, { "title": "G0/G1 arrest and apoptosis induced by SARS-CoV 3b protein in transfected cells.", "journal": "Virology journal", "date": "2005-08-17", "authors": "Yuan Xiaoling, Shan Yajun, Zhao Zhenhu, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "16107218", "url": "https://glygen.org/publication/PubMed/16107218" } ] }, { "title": "Mitochondrial location of severe acute respiratory syndrome coronavirus 3b protein.", "journal": "Molecules and cells", "date": "2006-04-30", "authors": "Yuan Xiaoling, Shan Yajun, Yao Zhenyu, Li Jianyong, Zhao Zhenhu, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "16682811", "url": "https://glygen.org/publication/PubMed/16682811" } ] }, { "title": "SARS coronavirus 3b accessory protein modulates transcriptional activity of RUNX1b.", "journal": "PLoS ONE", "date": "2012", "authors": "Varshney B, Agnihothram S, Tan YJ, Baric R, Lal SK", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "reference": [ { "type": "PubMed", "id": "22253733", "url": "https://glygen.org/publication/PubMed/22253733" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "regulation of cytokine production", "id": "GO:0001817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001817", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host cell cycle G0/G1 transition checkpoint", "id": "GO:0039646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039646", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host apoptosis", "id": "GO:0052150", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052150", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host cell cycle progression", "id": "GO:0044071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044071", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "host cell mitochondrion", "id": "GO:0033650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033650", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" }, { "name": "host cell nucleolus", "id": "GO:0044196", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044196", "evidence": [ { "database": "UniProtKB", "id": "P59633", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59633" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Bipartite nuclear localization signal", "eco_id": "ECO_0000255", "start_pos": 135, "end_pos": 153, "start_aa": "Lys", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59634-1", "uniprot_ac": "P59634", "uniprot_id": "NS6_SARS", "mass": { "chemical_mass": 7527.0, "monoisotopic_mass": 7527.0 }, "refseq": {}, "gene_names": [ { "name": "6", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634" } ] } ], "protein_names": [ { "name": "ORF6 protein", "type": "recommended", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 6", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 6", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] }, { "name": "ORF6", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] }, { "name": "Protein X3", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] }, { "name": "ns6", "type": "synonym", "evidence": [ { "id": "P59634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Disrupts bidirectional nucleocytoplasmic transport by interacting with host RAE1-NUP98 complex (PubMed:33849972). Disrupts cell nuclear import complex formation also by tethering karyopherin alpha 2 and karyopherin beta 1 to the membrane (PubMed:17596301). Retention of import factors at the ER/Golgi membrane leads to a loss of transport into the nucleus (PubMed:17596301). Thereby prevents STAT1 nuclear translocation in response to interferon signaling, thus blocking the expression of interferon stimulated genes (ISGs) that display multiple antiviral activities (PubMed:17596301).", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634#function" }, { "database": "PubMed", "id": "17596301", "url": "https://glygen.org/publication/PubMed/17596301" }, { "database": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 49, "end_pos": 52, "sequence_org": "YSEL", "sequence_mut": "AAAA", "comment": "No effect in the suppression of nuclear gene expression.", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" }, { "database": "PubMed", "id": "22026976", "url": "https://glygen.org/publication/PubMed/22026976" } ] }, { "start_pos": 53, "end_pos": 56, "sequence_org": "DDEE", "sequence_mut": "AAAA", "comment": "Reduction in the suppression of nuclear gene expression.", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" }, { "database": "PubMed", "id": "22026976", "url": "https://glygen.org/publication/PubMed/22026976" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "M", "sequence_mut": "A", "comment": "Decreases down-regulation of protein expression of newly transcribed genes in the host cell. Complete loss of RAE1 binding.", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" }, { "database": "PubMed", "id": "35096974", "url": "https://glygen.org/publication/PubMed/35096974" }, { "database": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "start_pos": 62, "end_pos": 63, "sequence_org": "YP", "sequence_mut": "", "comment": "Decreases down-regulation of protein expression of newly transcribed genes in the host cell.", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" }, { "database": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P59634", "locus": {} } ], "crossref": [ { "id": "7F90", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7F90&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7VPG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7VPG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59634", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59634*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR022736", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022736", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00007f90", "url": "https://www.rcsb.org/structure/pdb_00007f90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007vpg", "url": "https://www.rcsb.org/structure/pdb_00007vpg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F90", "url": "https://www.rcsb.org/structure/7F90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VPG", "url": "https://www.rcsb.org/structure/7VPG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF12133", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12133", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59634-1", "url": "https://www.uniprot.org/uniprotkb/P59634-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP", "length": 63, "header": "sp|P59634-1|NS6_SARS Isoform 1 of ORF6 protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59634-1" }, "isoforms": [ { "isoform_ac": "P59634-1", "url": "https://www.uniprot.org/uniprotkb/P59634/entry#P59634-1", "sequence": { "sequence": "MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP", "length": 63, "header": "sp|P59634-1|NS6_SARS Isoform 1 of ORF6 protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59634-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "A severe acute respiratory syndrome-associated coronavirus-specific protein enhances virulence of an attenuated murine coronavirus.", "journal": "J. Virol.", "date": "2005", "authors": "Pewe Lecia, Zhou Haixia, Netland Jason, Tangudu Chandra, Olivares Heidi, Shi Lei, Look Dwight, Gallagher Thomas, Perlman Stanley", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "16103185", "url": "https://glygen.org/publication/PubMed/16103185" } ] }, { "title": "The putative protein 6 of the severe acute respiratory syndrome-associated coronavirus: expression and functional characterization.", "journal": "FEBS Lett.", "date": "2005", "authors": "Geng Hua, Liu Yuet-Man, Chan Wai-Sing, Lo Anthony Wing-Ip, Au Deborah Mun-Yee, Waye Mary Miu-Yee, Ho Yuan-Yuan", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "16310783", "url": "https://glygen.org/publication/PubMed/16310783" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein 6 accelerates murine coronavirus infections.", "journal": "J. Virol.", "date": "2007", "authors": "Tangudu Chandra, Olivares Heidi, Netland Jason, Perlman Stanley, Gallagher Thomas", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "17108045", "url": "https://glygen.org/publication/PubMed/17108045" } ] }, { "title": "The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein.", "journal": "Virology", "date": "2007", "authors": "Kumar Purnima, Gunalan Vithiagaran, Liu Boping, Chow Vincent T K, Druce Julian, Birch Chris, Catton Mike, Fielding Burtram C, Tan Yee-Joo, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "17532020", "url": "https://glygen.org/publication/PubMed/17532020" } ] }, { "title": "Severe acute respiratory syndrome coronavirus ORF6 antagonizes STAT1 function by sequestering nuclear import factors on the rough endoplasmic reticulum/Golgi membrane.", "journal": "Journal of virology", "date": "2007", "authors": "Frieman M, Yount B, Heise M, Kopecky-Bromberg SA, Palese P, Baric RS", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "17596301", "url": "https://glygen.org/publication/PubMed/17596301" } ] }, { "title": "A putative diacidic motif in the SARS-CoV ORF6 protein influences its subcellular localization and suppression of expression of co-transfected expression constructs.", "journal": "BMC research notes", "date": "2011", "authors": "Gunalan V, Mirazimi A, Tan YJ", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "22026976", "url": "https://glygen.org/publication/PubMed/22026976" } ] }, { "title": "Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo.", "journal": "Virus Res.", "date": "2012", "authors": "Calvo Enrique, DeDiego Marta L, Garc\u00eda Pilar, L\u00f3pez Juan A, P\u00e9rez-Bre\u00f1a Pilar, Falc\u00f3n Ana", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "22820404", "url": "https://glygen.org/publication/PubMed/22820404" } ] }, { "title": "SARS-CoV-2 ORF6 Disrupts Bidirectional Nucleocytoplasmic Transport through Interactions with Rae1 and Nup98.", "journal": "mBio", "date": "2021", "authors": "Addetia A, Lieberman NAP, Phung Q, Hsiang TY, Xie H, Roychoudhury P, Shrestha L, Loprieno MA, Huang ML, Gale M Jr, Jerome KR, Greninger AL", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "title": "Molecular Mechanism of SARS-CoVs Orf6 Targeting the Rae1-Nup98 Complex to Compete With mRNA Nuclear Export.", "journal": "Frontiers in molecular biosciences", "date": "2021", "authors": "Li T, Wen Y, Guo H, Yang T, Yang H, Ji X", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "reference": [ { "type": "PubMed", "id": "35096974", "url": "https://glygen.org/publication/PubMed/35096974" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC6-1", "protein_name": "ORF6 protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID", "length": 61 }, "evidence": [ { "id": "UniRef50_P0DTC6", "url": "https://www.uniprot.org/uniref/UniRef50_P0DTC6", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity", "id": "GO:0039563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039563", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "host cell Golgi membrane", "id": "GO:0044178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044178", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum membrane", "id": "GO:0044167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044167", "evidence": [ { "database": "UniProtKB", "id": "P59634", "url": "https://www.uniprot.org/uniprotkb/P59634" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 48, "end_pos": 50 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59635-1", "uniprot_ac": "P59635", "uniprot_id": "NS7A_SARS", "mass": { "chemical_mass": 13941.0, "monoisotopic_mass": 13941.0 }, "refseq": {}, "gene_names": [ { "name": "7a", "type": "synonym", "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635" } ] } ], "protein_names": [ { "name": "ORF7a protein", "type": "recommended", "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 7a", "type": "synonym", "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635/entry#names_and_taxonomy" } ] }, { "name": "Protein U122", "type": "synonym", "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635/entry#names_and_taxonomy" } ] }, { "name": "Protein X4", "type": "synonym", "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Plays a role as antagonist of host tetherin (BST2), disrupting its antiviral effect. Acts by binding to BST2 thereby interfering with its glycosylation. May suppress small interfering RNA (siRNA). May bind to host ITGAL, thereby playing a role in attachment or modulation of leukocytes.", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635#function" }, { "database": "PubMed", "id": "26378163", "url": "https://glygen.org/publication/PubMed/26378163" }, { "database": "PubMed", "id": "18020948", "url": "https://glygen.org/publication/PubMed/18020948" }, { "database": "PubMed", "id": "20631126", "url": "https://glygen.org/publication/PubMed/20631126" }, { "database": "PubMed", "id": "15564512", "url": "https://glygen.org/publication/PubMed/15564512" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 118, "end_pos": 120, "sequence_org": "KRK", "sequence_mut": "ERE", "comment": "Induces rapid exit from the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" }, { "database": "PubMed", "id": "15220404", "url": "https://glygen.org/publication/PubMed/15220404" } ] }, { "start_pos": 14, "end_pos": 18, "sequence_org": "SCELY", "sequence_mut": "LLLLL", "comment": "Complete loss of signal sequence cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" }, { "database": "PubMed", "id": "15220404", "url": "https://glygen.org/publication/PubMed/15220404" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P59635", "locus": {} } ], "crossref": [ { "id": "1XAK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1XAK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1YO4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1YO4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59635", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59635*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR014888", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014888", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036495", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036495", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001xak", "url": "https://www.rcsb.org/structure/pdb_00001xak", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001yo4", "url": "https://www.rcsb.org/structure/pdb_00001yo4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XAK", "url": "https://www.rcsb.org/structure/1XAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YO4", "url": "https://www.rcsb.org/structure/1YO4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08779", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08779", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59635-1", "url": "https://www.uniprot.org/uniprotkb/P59635-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE", "length": 122, "header": "sp|P59635-1|NS7A_SARS Isoform 1 of ORF7a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59635-1" }, "isoforms": [ { "isoform_ac": "P59635-1", "url": "https://www.uniprot.org/uniprotkb/P59635/entry#P59635-1", "sequence": { "sequence": "MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE", "length": 122, "header": "sp|P59635-1|NS7A_SARS Isoform 1 of ORF7a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59635-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "A novel severe acute respiratory syndrome coronavirus protein, U274, is transported to the cell surface and undergoes endocytosis.", "journal": "J. Virol.", "date": "2004", "authors": "Tan Yee-Joo, Teng Eileen, Shen Shuo, Tan Timothy H P, Goh Phuay-Yee, Fielding Burtram C, Ooi Eng-Eong, Tan Hwee-Cheng, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "15194747", "url": "https://glygen.org/publication/PubMed/15194747" } ] }, { "title": "Characterization of a unique group-specific protein (U122) of the severe acute respiratory syndrome coronavirus.", "journal": "Journal of virology", "date": "2004", "authors": "Fielding BC, Tan YJ, Shuo S, Tan TH, Ooi EE, Lim SG, Hong W, Goh PY", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "15220404", "url": "https://glygen.org/publication/PubMed/15220404" } ] }, { "title": "Overexpression of 7a, a protein specifically encoded by the severe acute respiratory syndrome coronavirus, induces apoptosis via a caspase-dependent pathway.", "journal": "Journal of virology", "date": "2004-12", "authors": "Tan Yee-Joo, Fielding Burtram C, Goh Phuay-Yee, Shen Shuo, Tan Timothy H P, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "15564512", "url": "https://glygen.org/publication/PubMed/15564512" } ] }, { "title": "Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein.", "journal": "Structure", "date": "2005", "authors": "Nelson Christopher A, Pekosz Andrew, Lee Chung A, Diamond Michael S, Fremont Daved H", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "15642263", "url": "https://glygen.org/publication/PubMed/15642263" } ] }, { "title": "Solution structure of the X4 protein coded by the SARS related coronavirus reveals an immunoglobulin like fold and suggests a binding activity to integrin I domains.", "journal": "J. Biomed. Sci.", "date": "2006", "authors": "H\u00e4nel Karen, Stangler Thomas, Stoldt Matthias, Willbold Dieter", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "16328780", "url": "https://glygen.org/publication/PubMed/16328780" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein 7a interacts with hSGT.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Fielding Burtram C, Gunalan Vithiagaran, Tan Timothy H P, Chou Chih-Fong, Shen Shuo, Khan Sehaam, Lim Seng Gee, Hong Wanjin, Tan Yee-Joo", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "16580632", "url": "https://glygen.org/publication/PubMed/16580632" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 7a accessory protein is a viral structural protein.", "journal": "J. Virol.", "date": "2006", "authors": "Huang Cheng, Ito Naoto, Tseng Chien-Te K, Makino Shinji", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "16840309", "url": "https://glygen.org/publication/PubMed/16840309" } ] }, { "title": "Structure, expression, and intracellular localization of the SARS-CoV accessory proteins 7a and 7b.", "journal": "Adv. Exp. Med. Biol.", "date": "2006", "authors": "Pekosz Andrew, Schaecher Scott R, Diamond Michael S, Fremont Daved H, Sims Amy C, Baric Ralph S", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "17037516", "url": "https://glygen.org/publication/PubMed/17037516" } ] }, { "title": "SARS-CoV accessory protein 7a directly interacts with human LFA-1.", "journal": "Biological chemistry", "date": "2007-12", "authors": "H\u00e4nel Karen, Willbold Dieter", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "18020948", "url": "https://glygen.org/publication/PubMed/18020948" } ] }, { "title": "The 7a accessory protein of severe acute respiratory syndrome coronavirus acts as an RNA silencing suppressor.", "journal": "Journal of virology", "date": "2010-10", "authors": "Karjee Sumona, Minhas Ankita, Sood Vikas, Ponia Sanket S, Banerjea Akhil C, Chow Vincent T K, Mukherjee Sunil K, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "20631126", "url": "https://glygen.org/publication/PubMed/20631126" } ] }, { "title": "Severe Acute Respiratory Syndrome Coronavirus ORF7a Inhibits Bone Marrow Stromal Antigen 2 Virion Tethering through a Novel Mechanism of Glycosylation Interference.", "journal": "Journal of virology", "date": "2015", "authors": "Taylor JK, Coleman CM, Postel S, Sisk JM, Bernbaum JG, Venkataraman T, Sundberg EJ, Frieman MB", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "reference": [ { "type": "PubMed", "id": "26378163", "url": "https://glygen.org/publication/PubMed/26378163" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC7-1", "protein_name": "ORF7a protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE", "length": 121 }, "evidence": [ { "id": "UniRef50_P0DTC7", "url": "https://www.uniprot.org/uniref/UniRef50_P0DTC7", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0044173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044173", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "host cell Golgi membrane", "id": "GO:0044178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044178", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum", "id": "GO:0044165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044165", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum membrane", "id": "GO:0044167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044167", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "host cell Golgi apparatus", "id": "GO:0044177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044177", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "symbiont-mediated-mediated suppression of host tetherin activity", "id": "GO:0039587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039587", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host cell cycle G0/G1 transition checkpoint", "id": "GO:0039646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039646", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "symbiont-mediated activation of host apoptosis", "id": "GO:0052151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052151", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host cell cycle progression", "id": "GO:0044071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044071", "evidence": [ { "database": "UniProtKB", "id": "P59635", "url": "https://www.uniprot.org/uniprotkb/P59635" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59635" }, { "id": "PRU01267", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01267" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "X4e", "eco_id": "ECO_0000255", "start_pos": 16, "end_pos": 81, "start_aa": "Glu", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59636-1", "uniprot_ac": "P59636", "uniprot_id": "ORF9B_SARS", "mass": { "chemical_mass": 10802.0, "monoisotopic_mass": 10802.0 }, "refseq": {}, "gene_names": [ { "name": "9b", "type": "synonym", "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636" } ] } ], "protein_names": [ { "name": "ORF9b protein", "type": "recommended", "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 9b", "type": "synonym", "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636/entry#names_and_taxonomy" } ] }, { "name": "ORF-9b", "type": "synonym", "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636/entry#names_and_taxonomy" } ] }, { "name": "Protein 9b", "type": "synonym", "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Plays a role in the inhibition of host innate immune response by targeting the mitochondrial-associated adapter MAVS. Mechanistically, usurps the E3 ligase ITCH to trigger the degradation of MAVS, TRAF3, and TRAF6. In addition, causes mitochondrial elongation by triggering ubiquitination and proteasomal degradation of dynamin-like protein 1/DNM1L.", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636#function" }, { "database": "PubMed", "id": "25135833", "url": "https://glygen.org/publication/PubMed/25135833" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/P59636", "locus": {} } ], "crossref": [ { "id": "2CME", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2CME&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59636", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59636*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018542", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018542", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037223", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037223", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00002cme", "url": "https://www.rcsb.org/structure/pdb_00002cme", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2CME", "url": "https://www.rcsb.org/structure/2CME", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF09399", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF09399", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59636-1", "url": "https://www.uniprot.org/uniprotkb/P59636-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK", "length": 98, "header": "sp|P59636-1|ORF9B_SARS Isoform 1 of ORF9b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59636-1" }, "isoforms": [ { "isoform_ac": "P59636-1", "url": "https://www.uniprot.org/uniprotkb/P59636/entry#P59636-1", "sequence": { "sequence": "MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK", "length": 98, "header": "sp|P59636-1|ORF9B_SARS Isoform 1 of ORF9b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=P59636-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus genotype and its characterization.", "journal": "Chin. Med. J.", "date": "2003", "authors": "Li Lanjuan, Wang Zhigang, Lu Yiyu, Bao Qiyu, Chen Suhong, Wu Nanping, Cheng Suyun, Weng Jingqing, Zhang Yanjun, Yan Juying, Mei Lingling, Wang Xiaomeng, Zhu Hanping, Yu Yingpu, Zhang Minli, Li Minhong, Yao Jun, Lu Qunying, Yao Pingping, Bo Xiaochen, Wo Jianer, Wang Shengqi, Hu Songnian", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "14527350", "url": "https://glygen.org/publication/PubMed/14527350" } ] }, { "title": "The crystal structure of ORF-9b, a lipid binding protein from the SARS coronavirus.", "journal": "Structure", "date": "2006", "authors": "Meier Christoph, Aricescu A Radu, Assenberg Rene, Aplin Robin T, Gilbert Robert J C, Grimes Jonathan M, Stuart David I", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "16843897", "url": "https://glygen.org/publication/PubMed/16843897" } ] }, { "title": "Intracellular localization of the SARS coronavirus protein 9b: evidence of active export from the nucleus.", "journal": "Virus Res.", "date": "2007", "authors": "Moshynskyy Igor, Viswanathan Sathiyanarayanan, Vasilenko Natalia, Lobanov Vladislav, Petric Martin, Babiuk Lorne A, Zakhartchouk Alexander N", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "17448558", "url": "https://glygen.org/publication/PubMed/17448558" } ] }, { "title": "Severe acute respiratory syndrome coronavirus accessory protein 9b is a virion-associated protein.", "journal": "Virology", "date": "2009", "authors": "Xu Ke, Zheng Bo-Jian, Zeng Rong, Lu Wei, Lin Yong-Ping, Xue Liang, Li Li, Yang Lei-Lei, Xu Chen, Dai Jie, Wang Fei, Li Qing, Dong Qing-Xi, Yang Rui-Fu, Wu Jia-Rui, Sun Bing", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "19394665", "url": "https://glygen.org/publication/PubMed/19394665" } ] }, { "title": "SARS-CoV 9b protein diffuses into nucleus, undergoes active Crm1 mediated nucleocytoplasmic export and triggers apoptosis when retained in the nucleus.", "journal": "PLoS ONE", "date": "2011", "authors": "Sharma Kulbhushan, \u00c5kerstr\u00f6m Sara, Sharma Anuj Kumar, Chow Vincent T K, Teow Shumein, Abrenica Bernard, Booth Stephanie A, Booth Timothy F, Mirazimi Ali, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "21637748", "url": "https://glygen.org/publication/PubMed/21637748" } ] }, { "title": "Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo.", "journal": "Virus Res.", "date": "2012", "authors": "Calvo Enrique, DeDiego Marta L, Garc\u00eda Pilar, L\u00f3pez Juan A, P\u00e9rez-Bre\u00f1a Pilar, Falc\u00f3n Ana", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "22820404", "url": "https://glygen.org/publication/PubMed/22820404" } ] }, { "title": "SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014", "authors": "Shi CS, Qi HY, Boularan C, Huang NN, Abu-Asab M, Shelhamer JH, Kehrl JH", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "reference": [ { "type": "PubMed", "id": "25135833", "url": "https://glygen.org/publication/PubMed/25135833" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTD2-1", "protein_name": "ORF9b protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK", "length": 97 }, "evidence": [ { "id": "UniRef50_P59636", "url": "https://www.uniprot.org/uniref/UniRef50_P59636", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "host cell nucleus", "id": "GO:0042025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042025", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "virion component", "id": "GO:0044423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044423", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "host cell mitochondrion", "id": "GO:0033650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033650", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "host cell cytoplasmic vesicle membrane", "id": "GO:0044162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044162", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum", "id": "GO:0044165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044165", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "negative regulation of mitochondrial fission", "id": "GO:0090258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090258", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "positive regulation of autophagosome assembly", "id": "GO:2000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000786", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "negative regulation of defense response to virus", "id": "GO:0050687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050687", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity", "id": "GO:0039545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039545", "evidence": [ { "database": "UniProtKB", "id": "P59636", "url": "https://www.uniprot.org/uniprotkb/P59636" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636" }, { "id": "PRU01268", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01268" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "9b", "eco_id": "ECO_0000255", "start_pos": 9, "end_pos": 98, "start_aa": "Val", "end_aa": "Lys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P59636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59636" }, { "id": "17448558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17448558" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Nuclear export signal", "eco_id": "ECO_0000269", "start_pos": 46, "end_pos": 54, "start_aa": "Ile", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 4, "end_pos": 6 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P59637-1", "uniprot_ac": "P59637", "uniprot_id": "VEMP_SARS", "mass": { "chemical_mass": 8361.0, "monoisotopic_mass": 8361.0 }, "refseq": {}, "gene_names": [ { "name": "E", "type": "recommended", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637" } ] }, { "name": "4", "type": "synonym", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637" } ] }, { "name": "sM", "type": "synonym", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637" } ] } ], "protein_names": [ { "name": "Envelope small membrane protein", "type": "recommended", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637/entry#names_and_taxonomy" } ] }, { "name": "E protein", "type": "synonym", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637/entry#names_and_taxonomy" } ] }, { "name": "sM protein", "type": "synonym", "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis (By similarity). Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction.", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637#function" }, { "database": "PubMed", "id": "24788150", "url": "https://glygen.org/publication/PubMed/24788150" }, { "database": "HAMAP", "id": "MF_04204", "url": "https://hamap.expasy.org/signature/MF_04204" }, { "database": "PubMed", "id": "26331680", "url": "https://glygen.org/publication/PubMed/26331680" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 73, "end_pos": 76, "sequence_org": "DLLV", "sequence_mut": "", "comment": "Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment.", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" }, { "database": "PubMed", "id": "20861307", "url": "https://glygen.org/publication/PubMed/20861307" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "E", "url": "https://www.uniprot.org/uniprotkb/P59637", "locus": {} } ], "crossref": [ { "id": "2MM4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2MM4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5X29", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5X29&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XER", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XER&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XES", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XES&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7NTJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7NTJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "P59637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59637*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003873", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003873", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043506", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043506", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044377", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044377", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00002mm4", "url": "https://www.rcsb.org/structure/pdb_00002mm4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005x29", "url": "https://www.rcsb.org/structure/pdb_00005x29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xer", "url": "https://www.rcsb.org/structure/pdb_00005xer", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xes", "url": "https://www.rcsb.org/structure/pdb_00005xes", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ntj", "url": "https://www.rcsb.org/structure/pdb_00007ntj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MM4", "url": "https://www.rcsb.org/structure/2MM4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X29", "url": "https://www.rcsb.org/structure/5X29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XER", "url": "https://www.rcsb.org/structure/5XER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XES", "url": "https://www.rcsb.org/structure/5XES", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NTJ", "url": "https://www.rcsb.org/structure/7NTJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02723", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02723", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59637-1", "url": "https://www.uniprot.org/uniprotkb/P59637-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV", "length": 76, "header": "sp|P59637-1|VEMP_SARS Isoform 1 of Envelope small membrane protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=E PE=1 SV=1 CANONICAL=P59637-1" }, "isoforms": [ { "isoform_ac": "P59637-1", "url": "https://www.uniprot.org/uniprotkb/P59637/entry#P59637-1", "sequence": { "sequence": "MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV", "length": 76, "header": "sp|P59637-1|VEMP_SARS Isoform 1 of Envelope small membrane protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN=E PE=1 SV=1 CANONICAL=P59637-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Comparative full-length genome sequence analysis of 14 SARS coronavirus isolates and common mutations associated with putative origins of infection.", "journal": "Lancet", "date": "2003", "authors": "Ruan Yi Jun, Wei Chia Lin, Ee Ai Ling, Vega Vinsensius B, Thoreau Herve, Su Se Thoe Yun, Chia Jer-Ming, Ng Patrick, Chiu Kuo Ping, Lim Landri, Zhang Tao, Peng Chan Kwai, Lin Ean Oon Lynette, Lee Ng Mah, Yee Sin Leo, Ng Lisa F P, Chee Ren Ee, Stanton Lawrence W, Long Philip M, Liu Edison T", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12781537", "url": "https://glygen.org/publication/PubMed/12781537" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Isolation and characterization of viruses related to the SARS coronavirus from animals in southern China.", "journal": "Science", "date": "2003", "authors": "Guan Y, Zheng B J, He Y Q, Liu X L, Zhuang Z X, Cheung C L, Luo S W, Li P H, Zhang L J, Guan Y J, Butt K M, Wong K L, Chan K W, Lim W, Shortridge K F, Yuen K Y, Peiris J S M, Poon L L M", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "12958366", "url": "https://glygen.org/publication/PubMed/12958366" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus genotype and its characterization.", "journal": "Chin. Med. J.", "date": "2003", "authors": "Li Lanjuan, Wang Zhigang, Lu Yiyu, Bao Qiyu, Chen Suhong, Wu Nanping, Cheng Suyun, Weng Jingqing, Zhang Yanjun, Yan Juying, Mei Lingling, Wang Xiaomeng, Zhu Hanping, Yu Yingpu, Zhang Minli, Li Minhong, Yao Jun, Lu Qunying, Yao Pingping, Bo Xiaochen, Wo Jianer, Wang Shengqi, Hu Songnian", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "14527350", "url": "https://glygen.org/publication/PubMed/14527350" } ] }, { "title": "A novel severe acute respiratory syndrome coronavirus protein, U274, is transported to the cell surface and undergoes endocytosis.", "journal": "J. Virol.", "date": "2004", "authors": "Tan Yee-Joo, Teng Eileen, Shen Shuo, Tan Timothy H P, Goh Phuay-Yee, Fielding Burtram C, Ooi Eng-Eong, Tan Hwee-Cheng, Lim Seng Gee, Hong Wanjin", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "15194747", "url": "https://glygen.org/publication/PubMed/15194747" } ] }, { "title": "Subcellular localization and membrane association of SARS-CoV 3a protein.", "journal": "Virus Res.", "date": "2005", "authors": "Yuan Xiaoling, Li Jianyong, Shan Yajun, Yang Zhen, Zhao Zhenhu, Chen Bo, Yao Zhenyu, Dong Bo, Wang Shengqi, Chen Jiapei, Cong Yuwen", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "15763150", "url": "https://glygen.org/publication/PubMed/15763150" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein 7a interacts with hSGT.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Fielding Burtram C, Gunalan Vithiagaran, Tan Timothy H P, Chou Chih-Fong, Shen Shuo, Khan Sehaam, Lim Seng Gee, Hong Wanjin, Tan Yee-Joo", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "16580632", "url": "https://glygen.org/publication/PubMed/16580632" } ] }, { "title": "Expression and membrane integration of SARS-CoV E protein and its interaction with M protein.", "journal": "Virus Genes", "date": "2009", "authors": "Chen Shih-Chi, Lo Shih-Yen, Ma Hsin-Chieh, Li Hui-Chun", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "19322648", "url": "https://glygen.org/publication/PubMed/19322648" } ] }, { "title": "The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Teoh KT, Siu YL, Chan WL, Schluter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "20861307", "url": "https://glygen.org/publication/PubMed/20861307" } ] }, { "title": "Identification of a Golgi complex-targeting signal in the cytoplasmic tail of the severe acute respiratory syndrome coronavirus envelope protein.", "journal": "J. Virol.", "date": "2011", "authors": "Cohen Jennifer R, Lin Lisa D, Machamer Carolyn E", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "21450821", "url": "https://glygen.org/publication/PubMed/21450821" } ] }, { "title": "Expression and purification of coronavirus envelope proteins using a modified beta-barrel construct.", "journal": "Protein Expr. Purif.", "date": "2012", "authors": "Parthasarathy Krupakar, Lu Huang, Surya Wahyu, Vararattanavech Ardcharaporn, Pervushin Konstantin, Torres Jaume", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "22819936", "url": "https://glygen.org/publication/PubMed/22819936" } ] }, { "title": "SARS-CoV envelope protein palmitoylation or nucleocapsid association is not required for promoting virus-like particle production.", "journal": "J. Biomed. Sci.", "date": "2014", "authors": "Tseng YT, Wang SM, Huang KJ, Wang CT", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "24766657", "url": "https://glygen.org/publication/PubMed/24766657" } ] }, { "title": "Severe acute respiratory syndrome coronavirus envelope protein ion channel activity promotes virus fitness and pathogenesis.", "journal": "PLoS pathogens", "date": "2014-05", "authors": "Nieto-Torres Jose L, DeDiego Marta L, Verdi\u00e1-B\u00e1guena Carmina, Jimenez-Guarde\u00f1o Jose M, Regla-Nava Jose A, Fernandez-Delgado Raul, Casta\u00f1o-Rodriguez Carlos, Alcaraz Antonio, Torres Jaume, Aguilella Vicente M, Enjuanes Luis", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "24788150", "url": "https://glygen.org/publication/PubMed/24788150" } ] }, { "title": "Severe acute respiratory syndrome coronavirus E protein transports calcium ions and activates the NLRP3 inflammasome.", "journal": "Virology", "date": "2015-11", "authors": "Nieto-Torres Jose L, Verdi\u00e1-B\u00e1guena Carmina, Jimenez-Guarde\u00f1o Jose M, Regla-Nava Jose A, Casta\u00f1o-Rodriguez Carlos, Fernandez-Delgado Raul, Torres Jaume, Aguilella Vicente M, Enjuanes Luis", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "reference": [ { "type": "PubMed", "id": "26331680", "url": "https://glygen.org/publication/PubMed/26331680" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTC4-1", "protein_name": "Envelope small membrane protein", "gene_name": "E", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV", "length": 75 }, "evidence": [ { "id": "UniRef90_P0DTC4", "url": "https://www.uniprot.org/uniref/UniRef90_P0DTC4", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum-Golgi intermediate compartment", "id": "GO:0044172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044172", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" }, { "name": "host cell Golgi membrane", "id": "GO:0044178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044178", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" }, { "name": "host cell Golgi apparatus", "id": "GO:0044177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044177", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "disruption of plasma membrane integrity in another organism", "id": "GO:0051673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051673", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" }, { "name": "viral budding from Golgi membrane", "id": "GO:0046760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046760", "evidence": [ { "database": "UniProtKB", "id": "P59637", "url": "https://www.uniprot.org/uniprotkb/P59637" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P59637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P59637" }, { "id": "20861307", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20861307" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "PDZ-binding; required for interaction with human PALS1", "eco_id": "ECO_0000269", "start_pos": 73, "end_pos": 76, "start_aa": "Asp", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 48, "end_pos": 50 }, { "start_pos": 66, "end_pos": 68 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q7TFA0-1", "uniprot_ac": "Q7TFA0", "uniprot_id": "NS8A_SARS", "mass": { "chemical_mass": 4327.0, "monoisotopic_mass": 4327.0 }, "refseq": {}, "gene_names": [ { "name": "8a", "type": "synonym", "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" } ] } ], "protein_names": [ { "name": "ORF8a protein", "type": "recommended", "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 8a", "type": "synonym", "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0/entry#names_and_taxonomy" } ] }, { "name": "Protein non-structural 8a", "type": "synonym", "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0/entry#names_and_taxonomy" } ] }, { "name": "ns8a", "type": "synonym", "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "Q7TFA0", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0", "locus": {} } ], "crossref": [ { "id": "Q7TFA0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q7TFA0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR022722", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022722", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046444", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046444", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF12093", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12093", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "Q7TFA0", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TFA0-1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH", "length": 39, "header": "sp|Q7TFA0-1|NS8A_SARS Isoform 1 of ORF8a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=3 SV=1 CANONICAL=Q7TFA0-1" }, "isoforms": [ { "isoform_ac": "Q7TFA0-1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0/entry#Q7TFA0-1", "sequence": { "sequence": "MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH", "length": 39, "header": "sp|Q7TFA0-1|NS8A_SARS Isoform 1 of ORF8a protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=3 SV=1 CANONICAL=Q7TFA0-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA0", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA0", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA0", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] } ], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q7TFA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA0" }, { "id": "PRU01309", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01309" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "SARS ORF8 Ig-like", "eco_id": "ECO_0000255", "start_pos": 16, "end_pos": 39, "start_aa": "Ile", "end_aa": "His", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q7TFA1-1", "uniprot_ac": "Q7TFA1", "uniprot_id": "NS7B_SARS", "mass": { "chemical_mass": 5302.0, "monoisotopic_mass": 5302.0 }, "refseq": {}, "gene_names": [ { "name": "7b", "type": "synonym", "evidence": [ { "id": "Q7TFA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ] } ], "protein_names": [ { "name": "Protein non-structural 7b", "type": "recommended", "evidence": [ { "id": "Q7TFA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 7b", "type": "synonym", "evidence": [ { "id": "Q7TFA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1/entry#names_and_taxonomy" } ] }, { "name": "ns7b", "type": "synonym", "evidence": [ { "id": "Q7TFA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1", "locus": {} } ], "crossref": [ { "id": "Q7TFA1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q7TFA1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR021532", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021532", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044394", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044394", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF11395", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11395", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TFA1-1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV", "length": 44, "header": "sp|Q7TFA1-1|NS7B_SARS Isoform 1 of Protein non-structural 7b OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q7TFA1-1" }, "isoforms": [ { "isoform_ac": "Q7TFA1-1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1/entry#Q7TFA1-1", "sequence": { "sequence": "MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV", "length": 44, "header": "sp|Q7TFA1-1|NS7B_SARS Isoform 1 of Protein non-structural 7b OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q7TFA1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Mechanisms and enzymes involved in SARS coronavirus genome expression.", "journal": "J. Gen. Virol.", "date": "2003", "authors": "Thiel V, Ivanov KA, Putics A, Hertzig T, Schelle B, Bayer S, Weissbrich B, Snijder EJ, Rabenau H, Doerr HW, Gorbalenya AE, Ziebuhr J", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "reference": [ { "type": "PubMed", "id": "12917450", "url": "https://glygen.org/publication/PubMed/12917450" } ] }, { "title": "Structure, expression, and intracellular localization of the SARS-CoV accessory proteins 7a and 7b.", "journal": "Adv. Exp. Med. Biol.", "date": "2006", "authors": "Pekosz Andrew, Schaecher Scott R, Diamond Michael S, Fremont Daved H, Sims Amy C, Baric Ralph S", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "reference": [ { "type": "PubMed", "id": "17037516", "url": "https://glygen.org/publication/PubMed/17037516" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "pmid": "" }, { "name": "host cell membrane", "id": "GO:0033644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033644", "evidence": [ { "database": "UniProtKB", "id": "Q7TFA1", "url": "https://www.uniprot.org/uniprotkb/Q7TFA1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q7TLC7-1", "uniprot_ac": "Q7TLC7", "uniprot_id": "Y14_SARS", "mass": { "chemical_mass": 7852.0, "monoisotopic_mass": 7852.0 }, "refseq": {}, "gene_names": [ { "name": "ORF14", "type": "synonym", "evidence": [ { "id": "Q7TLC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7" } ] } ], "protein_names": [ { "name": "Uncharacterized protein 14", "type": "recommended", "evidence": [ { "id": "Q7TLC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "Q7TLC7", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7", "locus": {} } ], "crossref": [ { "id": "Q7TLC7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q7TLC7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR035113", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035113", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF17635", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17635", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "Q7TLC7", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TLC7-1", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAEVVKLPSRYCC", "length": 70, "header": "sp|Q7TLC7-1|Y14_SARS Isoform 1 of Uncharacterized protein 14 OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q7TLC7-1" }, "isoforms": [ { "isoform_ac": "Q7TLC7-1", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7/entry#Q7TLC7-1", "sequence": { "sequence": "MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAEVVKLPSRYCC", "length": 70, "header": "sp|Q7TLC7-1|Y14_SARS Isoform 1 of Uncharacterized protein 14 OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q7TLC7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "Q7TLC7", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P0DTD3-1", "protein_name": "Putative ORF9c protein", "gene_name": "", "tax_id": 2697049, "organism": "Severe acute respiratory syndrome coronavirus 2", "sequence": { "sequence": "MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD", "length": 73 }, "evidence": [ { "id": "UniRef50_P0DTD3", "url": "https://www.uniprot.org/uniref/UniRef50_P0DTD3", "database": "UniRef" } ], "glygen_name": "SARS-CoV-2", "common_name": "2019-nCoV" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q7TLC7", "url": "https://www.uniprot.org/uniprotkb/Q7TLC7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.uniref", "label": "UniRef Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q80H93-1", "uniprot_ac": "Q80H93", "uniprot_id": "NS8B_SARS", "mass": { "chemical_mass": 9560.0, "monoisotopic_mass": 9560.0 }, "refseq": {}, "gene_names": [ { "name": "8b", "type": "synonym", "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ] } ], "protein_names": [ { "name": "ORF8b protein", "type": "recommended", "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93/entry#names_and_taxonomy" } ] }, { "name": "Accessory protein 8b", "type": "synonym", "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93/entry#names_and_taxonomy" } ] }, { "name": "Non-structural protein 8b", "type": "synonym", "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93/entry#names_and_taxonomy" } ] }, { "name": "ns8b", "type": "synonym", "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Non-structural protein which is dispensable for virus replication in cell culture.", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93#function" } ] } ], "disease": [ { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infectious disease that results_in infection located_in respiratory tract, has_material_basis_in Severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1), a subtype of Betacoronavirus pandemicum, which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "GLY_000489", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000489" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Severe acute respiratory syndrome-related coronavirus", "taxid": 694009, "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "common_name": "SARS-CoV", "glygen_name": "HCoV-SARS", "reference_species": "Severe acute respiratory syndrome-related coronavirus [694009]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/Q80H93", "locus": {} } ], "crossref": [ { "id": "Q80H93", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q80H93*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR022722", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022722", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046444", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046444", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF12093", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12093", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80H93-1", "url": "https://www.uniprot.org/uniprotkb/Q80H93-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN", "length": 84, "header": "sp|Q80H93-1|NS8B_SARS Isoform 1 of ORF8b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q80H93-1" }, "isoforms": [ { "isoform_ac": "Q80H93-1", "url": "https://www.uniprot.org/uniprotkb/Q80H93/entry#Q80H93-1", "sequence": { "sequence": "MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN", "length": 84, "header": "sp|Q80H93-1|NS8B_SARS Isoform 1 of ORF8b protein OS=Severe acute respiratory syndrome-related coronavirus OX=694009 GN= PE=1 SV=1 CANONICAL=Q80H93-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of a novel coronavirus associated with severe acute respiratory syndrome.", "journal": "Science", "date": "2003", "authors": "Rota Paul A, Oberste M Steven, Monroe Stephan S, Nix W Allan, Campagnoli Ray, Icenogle Joseph P, Pe\u00f1aranda Silvia, Bankamp Bettina, Maher Kaija, Chen Min-Hsin, Tong Suxiong, Tamin Azaibi, Lowe Luis, Frace Michael, DeRisi Joseph L, Chen Qi, Wang David, Erdman Dean D, Peret Teresa C T, Burns Cara, Ksiazek Thomas G, Rollin Pierre E, Sanchez Anthony, Liffick Stephanie, Holloway Brian, Limor Josef, McCaustland Karen, Olsen-Rasmussen Melissa, Fouchier Ron, G\u00fcnther Stephan, Osterhaus Albert D M E, Drosten Christian, Pallansch Mark A, Anderson Larry J, Bellini William J", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "reference": [ { "type": "PubMed", "id": "12730500", "url": "https://glygen.org/publication/PubMed/12730500" } ] }, { "title": "The genome sequence of the SARS-associated coronavirus.", "journal": "Science", "date": "2003", "authors": "Marra Marco A, Jones Steven J M, Astell Caroline R, Holt Robert A, Brooks-Wilson Angela, Butterfield Yaron S N, Khattra Jaswinder, Asano Jennifer K, Barber Sarah A, Chan Susanna Y, Cloutier Alison, Coughlin Shaun M, Freeman Doug, Girn Noreen, Griffith Obi L, Leach Stephen R, Mayo Michael, McDonald Helen, Montgomery Stephen B, Pandoh Pawan K, Petrescu Anca S, Robertson A Gordon, Schein Jacqueline E, Siddiqui Asim, Smailus Duane E, Stott Jeff M, Yang George S, Plummer Francis, Andonov Anton, Artsob Harvey, Bastien Nathalie, Bernard Kathy, Booth Timothy F, Bowness Donnie, Czub Martin, Drebot Michael, Fernando Lisa, Flick Ramon, Garbutt Michael, Gray Michael, Grolla Allen, Jones Steven, Feldmann Heinz, Meyers Adrienne, Kabani Amin, Li Yan, Normand Susan, Stroher Ute, Tipples Graham A, Tyler Shaun, Vogrig Robert, Ward Diane, Watson Brynn, Brunham Robert C, Krajden Mel, Petric Martin, Skowronski Danuta M, Upton Chris, Roper Rachel L", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "reference": [ { "type": "PubMed", "id": "12730501", "url": "https://glygen.org/publication/PubMed/12730501" } ] }, { "title": "Coronavirus genomic-sequence variations and the epidemiology of the severe acute respiratory syndrome.", "journal": "N. Engl. J. Med.", "date": "2003", "authors": "Tsui Stephen K W, Chim Stephen S C, Lo Y M Dennis,", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "reference": [ { "type": "PubMed", "id": "12853594", "url": "https://glygen.org/publication/PubMed/12853594" } ] }, { "title": "The complete genome sequence of severe acute respiratory syndrome coronavirus strain HKU-39849 (HK-39).", "journal": "Exp. Biol. Med.", "date": "2003", "authors": "Zeng F Y, Chan C W M, Chan M N, Chen J D, Chow K Y C, Hon C C, Hui K H, Li J, Li V Y Y, Wang C Y, Wang P Y, Guan Y, Zheng B, Poon L L M, Chan K H, Yuen K Y, Peiris J S M, Leung F C", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "reference": [ { "type": "PubMed", "id": "12876307", "url": "https://glygen.org/publication/PubMed/12876307" } ] }, { "title": "Expression and functional characterization of the putative protein 8b of the severe acute respiratory syndrome-associated coronavirus.", "journal": "FEBS Lett.", "date": "2006", "authors": "Law Pui Ying Peggy, Liu Yuet-Man, Geng Hua, Kwan Ka Ho, Waye Mary Miu-Yee, Ho Yuan-Yuan", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "reference": [ { "type": "PubMed", "id": "16753150", "url": "https://glygen.org/publication/PubMed/16753150" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "host cell nucleus", "id": "GO:0042025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042025", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "Q80H93", "url": "https://www.uniprot.org/uniprotkb/Q80H93" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 43, "end_pos": 45, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q80H93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q80H93" }, { "id": "PRU01309", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01309" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "SARS ORF8 Ig-like", "eco_id": "ECO_0000255", "start_pos": 1, "end_pos": 82, "start_aa": "Met", "end_aa": "Arg", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 43, "end_pos": 45 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] } ]