[ { "uniprot_canonical_ac": "B8XCM7-1", "uniprot_ac": "B8XCM7", "uniprot_id": "B8XCM7_9MONO", "mass": { "chemical_mass": 82905.0, "monoisotopic_mass": 82905.0 }, "refseq": { "ac": "YP_003815432", "name": "nucleoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815432" }, "gene_names": [ { "name": "NP", "type": "recommended", "evidence": [ { "id": "B8XCM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ] } ], "protein_names": [ { "name": "Nucleoprotein", "type": "recommended", "evidence": [ { "id": "B8XCM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM7/entry#names_and_taxonomy" } ] }, { "name": "Nucleocapsid protein", "type": "synonym", "evidence": [ { "id": "B8XCM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM7/entry#names_and_taxonomy" } ] }, { "name": "nucleoprotein", "type": "synonym", "evidence": [ { "id": "YP_003815432", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815432" } ] } ], "function": [ { "annotation": "Oligomerizes into helical capsid to encapsidate the viral genome, protecting it from nucleases and the cellular innate immune response. VP35 binds to and stabilizes monomeric NP, keeping it soluble. Upon virus replication, NP is recruited to bind cooperatively viral genomic RNA and VP35 is released. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. The nucleocapsid is helical with a pitch of 10.81 NP per turn and a diameter of about 22nm. Each NP binds to six nucleotides of viral genomic RNA, three being exposed to the solvant and three hidden into the nucleocapsid. Also recruits host PPP2R5C phosphatase to dephosphorylate VP30 and thereby promote viral transcription. Upon virion assembly and budding, NP binds to VP24 and possibly host STAU1.", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7#function" }, { "database": "UniProtKB", "id": "ARBA00059530", "url": "https://www.uniprot.org/uniprotkb/ARBA00059530#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "NP", "url": "https://www.uniprot.org/uniprotkb/B8XCM7", "locus": {} } ], "crossref": [ { "id": "9487269", "url": "https://www.ncbi.nlm.nih.gov/gene/9487269", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5DSD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5DSD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5VKD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5VKD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR008609", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008609", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00005dsd", "url": "https://www.rcsb.org/structure/pdb_00005dsd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005vkd", "url": "https://www.rcsb.org/structure/pdb_00005vkd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DSD", "url": "https://www.rcsb.org/structure/5DSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VKD", "url": "https://www.rcsb.org/structure/5VKD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05505", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05505", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815432", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815432", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCM7-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPRPIRTWMMHNTSEVEADYHKILTAGLSVQQGIVRQRIIPVYQISNLEEVCQLIIQAFEAGVDFQDSADSFLLMLCLHHAYQGDYKQFLESNAVKYLEGHGFRFEMKKKEGVKRLEELLPAASSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTSWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTEHGVRLHPLARTAKVKNEVSSFKAALASLAQHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQKYAESRELDHLGLDDQEKKILKDFHQKKNEISFQQTTAMVTLRKERLAKLTEAITSTSILKTGRRYDDDNDIPFPGPINDNENSGQNDDDPTDSQDTTIPDVIIDPNDGGYNNYSDYANDAASAPDDLVLFDLEDEDDADNPAQNTPEKNDRPATTKLRNGQDQDGNQGETASPRVAPNQYRDKPMPQVQDRSENHDQTLQTQSRVLTPISEEADPSDHNDGDNESIPPLESDDEGSTDTTAAETKPATAPPAPVYRSISVDDSVPSENIPAQSNQTNNEDNVRNNAQSEQSIAEMYQHILKTQGPFDAILYYHMMKEEPIIFSTSDGKEYTYPDSLEDEYPPWLSEKEAMNEDNRFITMDGQQFYWPVMNHRNKFMAILQHHR", "length": 739, "header": "tr|B8XCM7-1|B8XCM7_9MONO Isoform 1 of Nucleoprotein OS=Bundibugyo virus OX=565995 GN=NP PE=1 SV=1 CANONICAL=B8XCM7-1" }, "isoforms": [ { "isoform_ac": "B8XCM7-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM7/entry#B8XCM7-1", "sequence": { "sequence": "MDPRPIRTWMMHNTSEVEADYHKILTAGLSVQQGIVRQRIIPVYQISNLEEVCQLIIQAFEAGVDFQDSADSFLLMLCLHHAYQGDYKQFLESNAVKYLEGHGFRFEMKKKEGVKRLEELLPAASSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTSWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTEHGVRLHPLARTAKVKNEVSSFKAALASLAQHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQKYAESRELDHLGLDDQEKKILKDFHQKKNEISFQQTTAMVTLRKERLAKLTEAITSTSILKTGRRYDDDNDIPFPGPINDNENSGQNDDDPTDSQDTTIPDVIIDPNDGGYNNYSDYANDAASAPDDLVLFDLEDEDDADNPAQNTPEKNDRPATTKLRNGQDQDGNQGETASPRVAPNQYRDKPMPQVQDRSENHDQTLQTQSRVLTPISEEADPSDHNDGDNESIPPLESDDEGSTDTTAAETKPATAPPAPVYRSISVDDSVPSENIPAQSNQTNNEDNVRNNAQSEQSIAEMYQHILKTQGPFDAILYYHMMKEEPIIFSTSDGKEYTYPDSLEDEYPPWLSEKEAMNEDNRFITMDGQQFYWPVMNHRNKFMAILQHHR", "length": 739, "header": "tr|B8XCM7-1|B8XCM7_9MONO Isoform 1 of Nucleoprotein OS=Bundibugyo virus OX=565995 GN=NP PE=1 SV=1 CANONICAL=B8XCM7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular architecture of the nucleoprotein C-terminal domain from the Ebola and Marburg viruses.", "journal": "Acta Crystallogr. D Struct. Biol.", "date": "2016", "authors": "Derewenda Z.S., Derewenda U., Engel D.A., Handing K.B., Utepbergenov D., Ellena J.F., Baker L.E.", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "reference": [ { "type": "PubMed", "id": "26894534", "url": "https://glygen.org/publication/PubMed/26894534" } ] }, { "title": "The structure of the C-terminal domain of the nucleoprotein from the Bundibugyo strain of the Ebola virus in complex with a pan-specific synthetic Fab.", "journal": "Acta Crystallogr. D Struct. Biol.", "date": "2018", "authors": "Kossiakoff A.A., Davydova E., Derewenda Z.S., Miyake T., Derewenda U., Engel D.A., Jaskolowski M., Radwanska M.J.", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "reference": [ { "type": "PubMed", "id": "29968677", "url": "https://glygen.org/publication/PubMed/29968677" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "viral RNA genome packaging", "id": "GO:0019074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019074", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" }, { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" }, { "name": "helical viral capsid", "id": "GO:0019029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019029", "evidence": [ { "database": "UniProtKB", "id": "B8XCM7", "url": "https://www.uniprot.org/uniprotkb/B8XCM7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 468, "end_pos": 470, "annotation": "n_glycosylation_sequon" }, { "start_pos": 579, "end_pos": 581, "annotation": "n_glycosylation_sequon" }, { "start_pos": 630, "end_pos": 632, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 13, "end_pos": 15 }, { "start_pos": 301, "end_pos": 303 }, { "start_pos": 468, "end_pos": 470 }, { "start_pos": 579, "end_pos": 581 }, { "start_pos": 630, "end_pos": 632 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "B8XCM8-1", "uniprot_ac": "B8XCM8", "uniprot_id": "B8XCM8_9MONO", "mass": { "chemical_mass": 37400.0, "monoisotopic_mass": 37400.0 }, "refseq": { "ac": "YP_003815433", "name": "polymerase complex protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815433" }, "gene_names": [ { "name": "VP35", "type": "recommended", "evidence": [ { "id": "B8XCM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ] } ], "protein_names": [ { "name": "Polymerase cofactor VP35", "type": "recommended", "evidence": [ { "id": "B8XCM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM8/entry#names_and_taxonomy" } ] }, { "name": "polymerase complex protein", "type": "synonym", "evidence": [ { "id": "YP_003815433", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815433" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "VP35", "url": "https://www.uniprot.org/uniprotkb/B8XCM8", "locus": {} } ], "crossref": [ { "id": "9487263", "url": "https://www.ncbi.nlm.nih.gov/gene/9487263", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002953", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002953", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043060", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043060", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043061", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043061", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF02097", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02097", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815433", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815433", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCM8-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSNRARVTYNPPPTTTGTRSCGPELSGWISEQLMTGKIPITDIFNEIETLPSISPSIHSKIKTPSVQTRSVQTQTDPNCNHDFAEVVKMLTSLTLVVQKQTLATESLEQRITDLEGSLKPVSEITKIVSALNRSCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGRPPPGPSLYEEDAIRTKIGKQGDMVPKEVQEAFRNLDSTALLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDNSSLDVIHAEFQASLAEGDSPQCALIQITKRIPIFQDAAPPVIHIRSRGDIPKACQKSLRPVPPSPKIDRGWVCIFQLQDGKTLGLKI", "length": 341, "header": "tr|B8XCM8-1|B8XCM8_9MONO Isoform 1 of Polymerase cofactor VP35 OS=Bundibugyo virus OX=565995 GN=VP35 PE=3 SV=1 CANONICAL=B8XCM8-1" }, "isoforms": [ { "isoform_ac": "B8XCM8-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM8/entry#B8XCM8-1", "sequence": { "sequence": "MTSNRARVTYNPPPTTTGTRSCGPELSGWISEQLMTGKIPITDIFNEIETLPSISPSIHSKIKTPSVQTRSVQTQTDPNCNHDFAEVVKMLTSLTLVVQKQTLATESLEQRITDLEGSLKPVSEITKIVSALNRSCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGRPPPGPSLYEEDAIRTKIGKQGDMVPKEVQEAFRNLDSTALLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDNSSLDVIHAEFQASLAEGDSPQCALIQITKRIPIFQDAAPPVIHIRSRGDIPKACQKSLRPVPPSPKIDRGWVCIFQLQDGKTLGLKI", "length": 341, "header": "tr|B8XCM8-1|B8XCM8_9MONO Isoform 1 of Polymerase cofactor VP35 OS=Bundibugyo virus OX=565995 GN=VP35 PE=3 SV=1 CANONICAL=B8XCM8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host toll-like receptor signaling pathway", "id": "GO:0039722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039722", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of TBK1 activity", "id": "GO:0039723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039723", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF7 activity", "id": "GO:0039557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039557", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IKBKE activity", "id": "GO:0039724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039724", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "virion component", "id": "GO:0044423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044423", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "B8XCM8", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 133, "end_pos": 135, "annotation": "n_glycosylation_sequon" }, { "start_pos": 254, "end_pos": 256, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "B8XCM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM8" }, { "id": "PS51735", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51735" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "VP35 IID", "eco_id": "ECO_0000259", "start_pos": 216, "end_pos": 341, "start_aa": "Gly", "end_aa": "Ile", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 133, "end_pos": 135 }, { "start_pos": 254, "end_pos": 256 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "B8XCM9-1", "uniprot_ac": "B8XCM9", "uniprot_id": "B8XCM9_9MONO", "mass": { "chemical_mass": 35458.0, "monoisotopic_mass": 35458.0 }, "refseq": { "ac": "YP_003815434", "name": "matrix protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815434" }, "gene_names": [ { "name": "VP40", "type": "recommended", "evidence": [ { "id": "B8XCM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ] } ], "protein_names": [ { "name": "Matrix protein VP40", "type": "recommended", "evidence": [ { "id": "B8XCM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM9/entry#names_and_taxonomy" } ] }, { "name": "Membrane-associated protein VP40", "type": "synonym", "evidence": [ { "id": "B8XCM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCM9/entry#names_and_taxonomy" } ] }, { "name": "matrix protein", "type": "synonym", "evidence": [ { "id": "YP_003815434", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815434" } ] } ], "function": [ { "annotation": "Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9#function" }, { "database": "UniProtKB", "id": "ARBA00045627", "url": "https://www.uniprot.org/uniprotkb/ARBA00045627#function" } ] }, { "annotation": "Plays an essential role virus particle assembly and budding. Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway.", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9#function" }, { "database": "UniProtKB", "id": "PIRNR018327", "url": "https://www.uniprot.org/uniprotkb/PIRNR018327#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "VP40", "url": "https://www.uniprot.org/uniprotkb/B8XCM9", "locus": {} } ], "crossref": [ { "id": "9487264", "url": "https://www.ncbi.nlm.nih.gov/gene/9487264", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008986", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008986", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035092", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035092", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF07447", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07447", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815434", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815434", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCM9-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRRAILPTAPPEYIEAVYPMRTVSTSINSTASGPNFPAPDVMMSDTPSNSLRPIADDNIDHPSHTPTSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKTSNPLVRINRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGPTGILRPGISFHPKLRPILLPGKTGKRGSSSDLTSPDKIQAIMNFLQDLKLVPIDPAKNIMGIEVPELLVHRLTGKKITTKNGQPIIPILLPKYIGMDPISQGDLTMVITQDCDTCHSPASLPPVSEK", "length": 326, "header": "tr|B8XCM9-1|B8XCM9_9MONO Isoform 1 of Matrix protein VP40 OS=Bundibugyo virus OX=565995 GN=VP40 PE=3 SV=1 CANONICAL=B8XCM9-1" }, "isoforms": [ { "isoform_ac": "B8XCM9-1", "url": "https://www.uniprot.org/uniprotkb/B8XCM9/entry#B8XCM9-1", "sequence": { "sequence": "MRRAILPTAPPEYIEAVYPMRTVSTSINSTASGPNFPAPDVMMSDTPSNSLRPIADDNIDHPSHTPTSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKTSNPLVRINRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGPTGILRPGISFHPKLRPILLPGKTGKRGSSSDLTSPDKIQAIMNFLQDLKLVPIDPAKNIMGIEVPELLVHRLTGKKITTKNGQPIIPILLPKYIGMDPISQGDLTMVITQDCDTCHSPASLPPVSEK", "length": 326, "header": "tr|B8XCM9-1|B8XCM9_9MONO Isoform 1 of Matrix protein VP40 OS=Bundibugyo virus OX=565995 GN=VP40 PE=3 SV=1 CANONICAL=B8XCM9-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 8, "start_aa": "Thr", "end_pos": 8, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr8", "evidence": [ { "id": "GLY_001544", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "viral budding via host ESCRT complex", "id": "GO:0039702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039702", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "structural constituent of virion", "id": "GO:0039660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039660", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "host cell endomembrane system", "id": "GO:0033645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033645", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" }, { "name": "host cell late endosome membrane", "id": "GO:0044185", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044185", "evidence": [ { "database": "UniProtKB", "id": "B8XCM9", "url": "https://www.uniprot.org/uniprotkb/B8XCM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 28, "end_pos": 30, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 8 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 28, "end_pos": 30 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "B8XCN0-1", "uniprot_ac": "B8XCN0", "uniprot_id": "B8XCN0_9MONO", "mass": { "chemical_mass": 75689.0, "monoisotopic_mass": 75689.0 }, "refseq": { "ac": "YP_003815435", "name": "spike glycoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815435" }, "gene_names": [ { "name": "GP", "type": "recommended", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ] } ], "protein_names": [ { "name": "Envelope glycoprotein", "type": "recommended", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0/entry#names_and_taxonomy" } ] }, { "name": "GP1,2", "type": "synonym", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0/entry#names_and_taxonomy" } ] }, { "name": "spike glycoprotein", "type": "synonym", "evidence": [ { "id": "YP_003815435", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815435" } ] } ], "function": [ { "annotation": "Acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide.", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0#function" }, { "database": "UniProtKB", "id": "ARBA00060272", "url": "https://www.uniprot.org/uniprotkb/ARBA00060272#function" } ] }, { "annotation": "Functions as a decoy for anti-GP1,2 antibodies thereby contributing to viral immune evasion. Interacts and activates host macrophages and dendritic cells inducing up-regulation of cytokine transcription. This effect is mediated throught activation of host TLR4.", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0#function" }, { "database": "UniProtKB", "id": "ARBA00058844", "url": "https://www.uniprot.org/uniprotkb/ARBA00058844#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "GP", "url": "https://www.uniprot.org/uniprotkb/B8XCN0", "locus": {} } ], "crossref": [ { "id": "9487265", "url": "https://www.ncbi.nlm.nih.gov/gene/9487265", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6DZM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6DZM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EA5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EA5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6N7J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6N7J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KEW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KEW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KFE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KFE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "500035", "url": "https://www.iedb.org/epitope/500035", "database": "IEDB", "categories": [ "Other" ] }, { "id": "502007", "url": "https://www.iedb.org/epitope/502007", "database": "IEDB", "categories": [ "Other" ] }, { "id": "502927", "url": "https://www.iedb.org/epitope/502927", "database": "IEDB", "categories": [ "Other" ] }, { "id": "IPR002561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR054584", "url": "https://www.ebi.ac.uk/interpro/entry/IPR054584", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00006dzm", "url": "https://www.rcsb.org/structure/pdb_00006dzm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ea5", "url": "https://www.rcsb.org/structure/pdb_00006ea5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006n7j", "url": "https://www.rcsb.org/structure/pdb_00006n7j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kew", "url": "https://www.rcsb.org/structure/pdb_00007kew", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kfe", "url": "https://www.rcsb.org/structure/pdb_00007kfe", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DZM", "url": "https://www.rcsb.org/structure/6DZM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EA5", "url": "https://www.rcsb.org/structure/6EA5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6N7J", "url": "https://www.rcsb.org/structure/6N7J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KEW", "url": "https://www.rcsb.org/structure/7KEW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KFE", "url": "https://www.rcsb.org/structure/7KFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01611", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF22307", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF22307", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815435", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815435", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCN0-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTSGILQLPRERFRKTSFFVWVIILFHKVFPIPLGVVHNNTLQVSDIDKLVCRDKLSSTSQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLDIKKADGSECLPEAPEGVRGFPRCRYVHKVSGTGPCPEGYAFHKEGAFFLYDRLASTIIYRSTTFSEGVVAFLILPETKKDFFQSPPLHEPANMTTDPSSYYHTVTLNYVADNFGTNMTNFLFQVDHLTYVQLEPRFTPQFLVQLNETIYTNGRRSNTTGTLIWKVNPTVDTGVGEWAFWENKKNFTKTLSSEELSVIFVPRAQDPGSNQKTKVTPTSFANNQTSKNHEDLVPEDPASVVQVRDLQRENTVPTPPPDTVPTTLIPDTMEEQTTSHYEPPNISRNHQERNNTAHPETLANNPPDNTTPSTPPQDGERTSSHTTPSPRPVPTSTIHPTTRETHIPTTMTTSHDTDSNRPNPIDISESTEPGPLTNTTRGAANLLTGSRRTRREITLRTQAKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGIMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFIDKPLPDQTDNDNWWTGWRQWVPAGIGITGVIIAVIALLCICKFLL", "length": 676, "header": "tr|B8XCN0-1|B8XCN0_9MONO Isoform 1 of Envelope glycoprotein OS=Bundibugyo virus OX=565995 GN=GP PE=1 SV=1 CANONICAL=B8XCN0-1" }, "isoforms": [ { "isoform_ac": "B8XCN0-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN0/entry#B8XCN0-1", "sequence": { "sequence": "MVTSGILQLPRERFRKTSFFVWVIILFHKVFPIPLGVVHNNTLQVSDIDKLVCRDKLSSTSQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLDIKKADGSECLPEAPEGVRGFPRCRYVHKVSGTGPCPEGYAFHKEGAFFLYDRLASTIIYRSTTFSEGVVAFLILPETKKDFFQSPPLHEPANMTTDPSSYYHTVTLNYVADNFGTNMTNFLFQVDHLTYVQLEPRFTPQFLVQLNETIYTNGRRSNTTGTLIWKVNPTVDTGVGEWAFWENKKNFTKTLSSEELSVIFVPRAQDPGSNQKTKVTPTSFANNQTSKNHEDLVPEDPASVVQVRDLQRENTVPTPPPDTVPTTLIPDTMEEQTTSHYEPPNISRNHQERNNTAHPETLANNPPDNTTPSTPPQDGERTSSHTTPSPRPVPTSTIHPTTRETHIPTTMTTSHDTDSNRPNPIDISESTEPGPLTNTTRGAANLLTGSRRTRREITLRTQAKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGIMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFIDKPLPDQTDNDNWWTGWRQWVPAGIGITGVIIAVIALLCICKFLL", "length": 676, "header": "tr|B8XCN0-1|B8XCN0_9MONO Isoform 1 of Envelope glycoprotein OS=Bundibugyo virus OX=565995 GN=GP PE=1 SV=1 CANONICAL=B8XCN0-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G34200SQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G49084LP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0#ptm_processing" }, { "id": "6DZM", "database": "PDB", "url": "https://www.rcsb.org/sequence/6DZM" }, { "id": "7KEW", "database": "PDB", "url": "https://www.rcsb.org/sequence/7KEW" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G33012CU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G63628AV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G71059MG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G91373PO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G98147MD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05622OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15531BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G16017RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24517ZG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G28094LG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G35331IG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G35510GA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40177UP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G56645JG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64574OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G71059MG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76592TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G80505LH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G93759JJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G98396GX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G01807FF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G04047RL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G04062KZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05034AX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11917LX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15450FJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G19972YZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24517ZG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G38025GO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G38745TE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40066BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40177UP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G45876TX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G49980AO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G56134FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64574OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79421NO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G97915FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G01807FF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57881KY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G97915FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 364, "start_aa": "Thr", "end_pos": 364, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr364", "evidence": [ { "id": "GLY_001544", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001544" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0#ptm_processing" }, { "id": "6EA5", "database": "PDB", "url": "https://www.rcsb.org/sequence/6EA5" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 484, "start_aa": "Asn", "end_pos": 484, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn484", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 484, "start_aa": "Asn", "end_pos": 484, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn484", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G00490MQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G17255FP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G71059MG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0#ptm_processing" }, { "id": "6DZM", "database": "PDB", "url": "https://www.rcsb.org/sequence/6DZM" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Glycan shield of the ebolavirus envelope glycoprotein GP.", "journal": "Communications biology", "date": "2022-08-04", "authors": "Peng Weiwei, Rayaprolu Vamseedhar, Parvate Amar D, Pronker Matti F, Hui Sean, Parekh Diptiben, Shaffer Kelly, Yu Xiaoying, Saphire Erica O, Snijder Joost", "evidence": [ { "database": "GlyTableMaker", "id": "TP3222006", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ], "reference": [ { "type": "PubMed", "id": "35927436", "url": "https://glygen.org/publication/PubMed/35927436" } ] }, { "title": "Cross-Reactive and Potent Neutralizing Antibody Responses in Human Survivors of Natural Ebolavirus Infection.", "journal": "Cell", "date": "2016-01-28", "authors": "Flyak Andrew I, Shen Xiaoli, Murin Charles D, Turner Hannah L, David Joshua A, Fusco Marnie L, Lampley Rebecca, Kose Nurgun, Ilinykh Philipp A, Kuzmina Natalia, Branchizio Andre, King Hannah, Brown Leland, Bryan Christopher, Davidson Edgar, Doranz Benjamin J, Slaughter James C, Sapparapu Gopal, Klages Curtis, Ksiazek Thomas G, Saphire Erica Ollmann, Ward Andrew B, Bukreyev Alexander, Crowe James E", "evidence": [ { "database": "IEDB", "id": "500035", "url": "https://www.iedb.org/epitope/500035" }, { "database": "IEDB", "id": "502007", "url": "https://www.iedb.org/epitope/502007" }, { "database": "IEDB", "id": "502927", "url": "https://www.iedb.org/epitope/502927" } ], "reference": [ { "type": "PubMed", "id": "26806128", "url": "https://glygen.org/publication/PubMed/26806128" } ] }, { "title": "Structural Basis of Pan-Ebolavirus Neutralization by an Antibody Targeting the Glycoprotein Fusion Loop.", "journal": "Cell Rep.", "date": "2018", "authors": "Murin Charles D, Bruhn Jessica F, Bornholdt Zachary A, Copps Jeffrey, Stanfield Robyn, Ward Andrew B", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "reference": [ { "type": "PubMed", "id": "30184505", "url": "https://glygen.org/publication/PubMed/30184505" } ] }, { "title": "Structural Basis of Pan-Ebolavirus Neutralization by a Human Antibody against a Conserved, yet Cryptic Epitope.", "journal": "MBio", "date": "2018", "authors": "West Brandyn R, Moyer Crystal L, King Liam B, Fusco Marnie L, Milligan Jacob C, Hui Sean, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "reference": [ { "type": "PubMed", "id": "30206174", "url": "https://glygen.org/publication/PubMed/30206174" } ] }, { "title": "Cross-reactive neutralizing human survivor monoclonal antibody BDBV223 targets the ebolavirus stalk.", "journal": "Nat. Commun.", "date": "2019", "authors": "Huang K., King L.B., Saphire E.O., Bukreyev A., Ilinykh P.A., Hui S., Moyer C.L., Bombardi R., Crowe J.E., Flyak A., Gilchuk P., West B.R.", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "reference": [ { "type": "PubMed", "id": "30996276", "url": "https://glygen.org/publication/PubMed/30996276" } ] }, { "title": "Convergence of a common solution for broad ebolavirus neutralization by glycan cap-directed human antibodies.", "journal": "Cell Rep.", "date": "2021", "authors": "Murin Charles D, Gilchuk Pavlo, Ilinykh Philipp A, Huang Kai, Kuzmina Natalia, Shen Xiaoli, Bruhn Jessica F, Bryan Aubrey L, Davidson Edgar, Doranz Benjamin J, Williamson Lauren E, Copps Jeffrey, Alkutkar Tanwee, Flyak Andrew I, Bukreyev Alexander, Crowe James E, Ward Andrew B", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "reference": [ { "type": "PubMed", "id": "33852862", "url": "https://glygen.org/publication/PubMed/33852862" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "viral envelope", "id": "GO:0019031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019031", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "symbiont-mediated-mediated suppression of host tetherin activity", "id": "GO:0039587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039587", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "fusion of virus membrane with host endosome membrane", "id": "GO:0039654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039654", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "clathrin-dependent endocytosis of virus by host cell", "id": "GO:0075512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075512", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "entry receptor-mediated virion attachment to host cell", "id": "GO:0098670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098670", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "B8XCN0", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" }, { "start_pos": 391, "end_pos": 393, "annotation": "n_glycosylation_sequon" }, { "start_pos": 400, "end_pos": 402, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 415, "end_pos": 417, "annotation": "n_glycosylation_sequon" }, { "start_pos": 484, "end_pos": 486, "annotation": "n_glycosylation_sequon" }, { "start_pos": 563, "end_pos": 565, "annotation": "n_glycosylation_sequon" }, { "start_pos": 618, "end_pos": 620, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" }, { "id": "PF22307", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF22307" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Envelope glycoprotein GP2-like HR1-HR2", "eco_id": "ECO_0000259", "start_pos": 515, "end_pos": 595, "start_aa": "Leu", "end_aa": "Gln", "glycosite_overlap": "Asn563" }, { "evidence": [ { "id": "B8XCN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN0" }, { "id": "PF01611", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Filoviruses glycoprotein extracellular", "eco_id": "ECO_0000259", "start_pos": 16, "end_pos": 345, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "Asn228,Asn204,Asn268,Asn333,Asn296,Asn257,Asn40" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 40, 204, 228, 257, 268, 296, 333, 400, 484, 563, 618 ], "o_linked_sites": [ 364 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 296, "end_pos": 298 }, { "start_pos": 333, "end_pos": 335 }, { "start_pos": 391, "end_pos": 393 }, { "start_pos": 400, "end_pos": 402 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 415, "end_pos": 417 }, { "start_pos": 484, "end_pos": 486 }, { "start_pos": 563, "end_pos": 565 }, { "start_pos": 618, "end_pos": 620 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 250 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 91 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 12 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "exact_n_linked_glycan_sites", "count": 10 }, { "field": "exact_n_linked_glycans", "count": 91 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 246 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 10 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 91 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_n_linked_sites", "count": 10 }, { "field": "exact_n_linked_glycan_sites", "count": 10 }, { "field": "exact_n_linked_glycans", "count": 91 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "B8XCN1-1", "uniprot_ac": "B8XCN1", "uniprot_id": "B8XCN1_9MONO", "mass": { "chemical_mass": 42471.0, "monoisotopic_mass": 42471.0 }, "refseq": { "ac": "YP_003815436", "name": "small secreted glycoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815436" }, "gene_names": [ { "name": "GP", "type": "recommended", "evidence": [ { "id": "B8XCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN1" } ] } ], "protein_names": [ { "name": "small secreted glycoprotein", "type": "synonym", "evidence": [ { "id": "YP_003815436", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815436" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCN1", "url": "https://www.uniprot.org/uniprotkb/B8XCN1" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "GP", "url": "https://www.uniprot.org/uniprotkb/B8XCN1", "locus": {} } ], "crossref": [ { "id": "9487265", "url": "https://www.ncbi.nlm.nih.gov/gene/9487265", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF01611", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815436", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815436", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCN1", "url": "https://www.uniprot.org/uniprotkb/B8XCN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCN1-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTSGILQLPRERFRKTSFFVWVIILFHKVFPIPLGVVHNNTLQVSDIDKLVCRDKLSSTSQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLDIKKADGSECLPEAPEGVRGFPRCRYVHKVSGTGPCPEGYAFHKEGAFFLYDRLASTIIYRSTTFSEGVVAFLILPETKKDFFQSPPLHEPANMTTDPSSYYHTVTLNYVADNFGTNMTNFLFQVDHLTYVQLEPRFTPQFLVQLNETIYTNGRRSNTTGTLIWKVNPTVDTGVGEWAFWENKKTSQKPFQVKSCLSYLYQEPRIQAATRRRRSLPPASPTTKPPRTTKTWFQRIPLQWFKCETSRGKTQCRPHPQTQSPQL", "length": 373, "header": "tr|B8XCN1-1|B8XCN1_9MONO Isoform 1 of Soluble secreted glycoprotein OS=Bundibugyo virus OX=565995 GN=GP PE=3 SV=1 CANONICAL=B8XCN1-1" }, "isoforms": [ { "isoform_ac": "B8XCN1-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN1/entry#B8XCN1-1", "sequence": { "sequence": "MVTSGILQLPRERFRKTSFFVWVIILFHKVFPIPLGVVHNNTLQVSDIDKLVCRDKLSSTSQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLDIKKADGSECLPEAPEGVRGFPRCRYVHKVSGTGPCPEGYAFHKEGAFFLYDRLASTIIYRSTTFSEGVVAFLILPETKKDFFQSPPLHEPANMTTDPSSYYHTVTLNYVADNFGTNMTNFLFQVDHLTYVQLEPRFTPQFLVQLNETIYTNGRRSNTTGTLIWKVNPTVDTGVGEWAFWENKKTSQKPFQVKSCLSYLYQEPRIQAATRRRRSLPPASPTTKPPRTTKTWFQRIPLQWFKCETSRGKTQCRPHPQTQSPQL", "length": 373, "header": "tr|B8XCN1-1|B8XCN1_9MONO Isoform 1 of Soluble secreted glycoprotein OS=Bundibugyo virus OX=565995 GN=GP PE=3 SV=1 CANONICAL=B8XCN1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "B8XCN1", "url": "https://www.uniprot.org/uniprotkb/B8XCN1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "B8XCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN1" }, { "id": "PF01611", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Filoviruses glycoprotein extracellular", "eco_id": "ECO_0000259", "start_pos": 16, "end_pos": 297, "start_aa": "Lys", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 40, "end_pos": 42 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "B8XCN3-1", "uniprot_ac": "B8XCN3", "uniprot_id": "B8XCN3_9MONO", "mass": { "chemical_mass": 32839.0, "monoisotopic_mass": 32839.0 }, "refseq": { "ac": "YP_003815438", "name": "minor nucleoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815438" }, "gene_names": [ { "name": "VP30", "type": "recommended", "evidence": [ { "id": "B8XCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ] } ], "protein_names": [ { "name": "Transcriptional activator VP30", "type": "recommended", "evidence": [ { "id": "B8XCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN3/entry#names_and_taxonomy" } ] }, { "name": "Minor nucleoprotein VP30", "type": "synonym", "evidence": [ { "id": "B8XCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN3/entry#names_and_taxonomy" } ] }, { "name": "minor nucleoprotein", "type": "synonym", "evidence": [ { "id": "YP_003815438", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815438" } ] } ], "function": [ { "annotation": "Multifunctional protein that acts as a viral transcriptional activator. Promotes read-through of an RNA hairpin in the NP open reading frame to enhance viral transcription. Mechanistically, nonphosphorylated VP30 hexamers form a ternary complex with the viral leader RNA. Clamps the RNA template and the complex VP35-polymerase L together, thereby increasing the polymerase affinity for the RNA template to increase transcription initiation despite the presence of RNA secondary structures. Also assists stop-start transcription at gene junctions to promote transcription of downstream genes. Interaction with NP plays a critical role in transcription initiation by recognizing the RNA stem loop. Interaction with host RBBP6 interferes with NP-VP30 interaction and inhibits viral RNA synthesis. Also acts as a suppressor of RNA silencing by interacting with host DICER1 and TARBP2/TRBP.", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3#function" }, { "database": "UniProtKB", "id": "ARBA00057192", "url": "https://www.uniprot.org/uniprotkb/ARBA00057192#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "VP30", "url": "https://www.uniprot.org/uniprotkb/B8XCN3", "locus": {} } ], "crossref": [ { "id": "9487266", "url": "https://www.ncbi.nlm.nih.gov/gene/9487266", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR014459", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014459", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF11507", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11507", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815438", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815438", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCN3-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSFHERGRSRTIRQSARDGPSHQVRTRSSSRDSHRSEYHTPRSSSQVRVPTVFHRKRTDSLTVPPAPKDICPTLRKGFLCDSNFCKKDHQLESLTDRELLLLIARKTCGSLEQQLNITAPKDTRLANPIADDFQQKDGPKITLLTLLETAEYWSKQDIKGIDDSRLRALLTLCAVMTRKFSKSQLSLLCESHLRREGLGQDQSESVLEVYQRLHSDKGGNFEAALWQQWDRQSLIMFITAFLNIALQLPCESSSVVISGLRLLVPQSEDTETSTYTETRAWSEEGGPH", "length": 289, "header": "tr|B8XCN3-1|B8XCN3_9MONO Isoform 1 of Transcriptional activator VP30 OS=Bundibugyo virus OX=565995 GN=VP30 PE=3 SV=1 CANONICAL=B8XCN3-1" }, "isoforms": [ { "isoform_ac": "B8XCN3-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN3/entry#B8XCN3-1", "sequence": { "sequence": "MDSFHERGRSRTIRQSARDGPSHQVRTRSSSRDSHRSEYHTPRSSSQVRVPTVFHRKRTDSLTVPPAPKDICPTLRKGFLCDSNFCKKDHQLESLTDRELLLLIARKTCGSLEQQLNITAPKDTRLANPIADDFQQKDGPKITLLTLLETAEYWSKQDIKGIDDSRLRALLTLCAVMTRKFSKSQLSLLCESHLRREGLGQDQSESVLEVYQRLHSDKGGNFEAALWQQWDRQSLIMFITAFLNIALQLPCESSSVVISGLRLLVPQSEDTETSTYTETRAWSEEGGPH", "length": 289, "header": "tr|B8XCN3-1|B8XCN3_9MONO Isoform 1 of Transcriptional activator VP30 OS=Bundibugyo virus OX=565995 GN=VP30 PE=3 SV=1 CANONICAL=B8XCN3-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "B8XCN3", "url": "https://www.uniprot.org/uniprotkb/B8XCN3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 117, "end_pos": 119, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 117, "end_pos": 119 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "B8XCN4-1", "uniprot_ac": "B8XCN4", "uniprot_id": "B8XCN4_9MONO", "mass": { "chemical_mass": 28164.0, "monoisotopic_mass": 28164.0 }, "refseq": { "ac": "YP_003815439", "name": "membrane-associated protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815439" }, "gene_names": [ { "name": "VP24", "type": "recommended", "evidence": [ { "id": "B8XCN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ] } ], "protein_names": [ { "name": "Membrane-associated protein VP24", "type": "recommended", "evidence": [ { "id": "B8XCN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN4/entry#names_and_taxonomy" } ] }, { "name": "membrane-associated protein", "type": "synonym", "evidence": [ { "id": "YP_003815439", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815439" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "VP24", "url": "https://www.uniprot.org/uniprotkb/B8XCN4", "locus": {} } ], "crossref": [ { "id": "9487267", "url": "https://www.ncbi.nlm.nih.gov/gene/9487267", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF06389", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06389", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815439", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815439", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCN4-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKATGRYNLVSPKKDLERGLVLSDLCTFLVDQTIQGWRVTWVGIEFDIAQKGMALLHRLKTADFAPAWSMTRNLFPHLFQNSNSTIESPLWALRVILAAGIQDQLIDQSLVEPLAGALSLVSDWLLTTNTNHFQMRTQHAKEQLSLKMLSLVRSNILKFISQLDALHVVNYNGLLSSIEIGTRNHTIIITRTNMGFLVELQEPDKSAMNQKKPGPVKFSLLHESTFKALIKKPATKMQALILEFNSSLAI", "length": 251, "header": "tr|B8XCN4-1|B8XCN4_9MONO Isoform 1 of Membrane-associated protein VP24 OS=Bundibugyo virus OX=565995 GN=VP24 PE=3 SV=1 CANONICAL=B8XCN4-1" }, "isoforms": [ { "isoform_ac": "B8XCN4-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN4/entry#B8XCN4-1", "sequence": { "sequence": "MAKATGRYNLVSPKKDLERGLVLSDLCTFLVDQTIQGWRVTWVGIEFDIAQKGMALLHRLKTADFAPAWSMTRNLFPHLFQNSNSTIESPLWALRVILAAGIQDQLIDQSLVEPLAGALSLVSDWLLTTNTNHFQMRTQHAKEQLSLKMLSLVRSNILKFISQLDALHVVNYNGLLSSIEIGTRNHTIIITRTNMGFLVELQEPDKSAMNQKKPGPVKFSLLHESTFKALIKKPATKMQALILEFNSSLAI", "length": 251, "header": "tr|B8XCN4-1|B8XCN4_9MONO Isoform 1 of Membrane-associated protein VP24 OS=Bundibugyo virus OX=565995 GN=VP24 PE=3 SV=1 CANONICAL=B8XCN4-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "viral process", "id": "GO:0016032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016032", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host defense response", "id": "GO:0052031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052031", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "B8XCN4", "url": "https://www.uniprot.org/uniprotkb/B8XCN4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 185, "end_pos": 187 }, { "start_pos": 246, "end_pos": 248 }, { "start_pos": 84, "end_pos": 86 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "B8XCN5-1", "uniprot_ac": "B8XCN5", "uniprot_id": "B8XCN5_9MONO", "mass": { "chemical_mass": 251649.0, "monoisotopic_mass": 251649.0 }, "refseq": { "ac": "YP_003815440", "name": "RNA-dependent RNA polymerase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815440" }, "gene_names": [ { "name": "L", "type": "recommended", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ] } ], "protein_names": [ { "name": "RNA-directed RNA polymerase L", "type": "recommended", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] }, { "name": "Large structural protein", "type": "synonym", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] }, { "name": "PRNTase", "type": "synonym", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] }, { "name": "Protein L", "type": "synonym", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] }, { "name": "RNA-dependent RNA polymerase", "type": "synonym", "evidence": [ { "id": "YP_003815440", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815440" } ] }, { "name": "Replicase", "type": "synonym", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] }, { "name": "Transcriptase", "type": "synonym", "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated.", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5#function" }, { "database": "UniProtKB", "id": "PIRNR037548", "url": "https://www.uniprot.org/uniprotkb/PIRNR037548#function" }, { "database": "UniProtKB", "id": "ARBA00003132", "url": "https://www.uniprot.org/uniprotkb/ARBA00003132#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bundibugyo virus", "taxid": 565995, "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "common_name": "Ebolavirus bundibugyo", "glygen_name": "Ebola (BDBV)", "reference_species": "Bundibugyo virus [565995]" } ], "gene": [ { "name": "L", "url": "https://www.uniprot.org/uniprotkb/B8XCN5", "locus": {} } ], "crossref": [ { "id": "9487268", "url": "https://www.ncbi.nlm.nih.gov/gene/9487268", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR014023", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014023", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025786", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025786", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026890", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026890", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039530", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039530", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039736", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039736", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF00946", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00946", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF14314", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14314", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF14318", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14318", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "YP_003815440", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003815440", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8XCN5-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLKNCRLPKHIYRLKFDATVTKFLSDVPIVTLPIDYLTPLLLRTLSGEGLCPVEPKCSQFLDEIVSYVLQDARFLRYYFRHVGVHDDNVGKNFEPKIKALIYDNEFLQQLFYWYDLAILTRRGRLNRGNNRSTWFANDDLIDILGYGDYIFWKIPLSLLSLNTEGIPHAAKDWYHASIFKEAVQGHTHIVSVSTADVLIMCKDIITCRFNTTLIAALANLEDSICSDYPQPETISNLYKAGDYLISILGSEGYKVIKFLEPLCLAKIQLCSNYTERKGRFLTQMHLAVNHTLEELIEGRGLKSQQDWKMREFHRILVNLKSTPQQLCELFSVQKHWGHPVLHSEKAIQKVKKHATVIKALRPVIIFETYCVFKYSIAKHYFDSQGSWYSVISDKHLTPGLHSYIKRNQFPPLPMIKDLLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVEKTCWDAVFEPNVLGYSPPNKFSTKRVPEQFLEQENFSIDSVLTYAQRLDYLLPQYRNFSFSLKEKELNVGRAFGKLPYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGENATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNLFNWMHYTIPQCYIHVSDYYNPPHGVSLENREDPPEGPSSYRGHLGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDSNEQEHSSEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNGVQLPQSLKTATRIAPLSDAIFDDLQGTLASIGTAFERSISETRHVYPCRVVAAFHTFFSVRILQYHHLGFNKGTDLGQLSLSKPLDFGTITLALAVPQVLGGLSFLNPEKCFYRNLGDPVTSGLFQLRTYLQMINMDDLFLPLIAKNPGNCSAIDFVLNPSGLNVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHSSADLEDEMVCKWLLSSTPVMSRFAADIFSRTPSGKRLQILGYLEGTRTLLASKVINNNAETPILDRLRKITLQRWSLWFSYLDHCDQVLADALIKVSCTVDLAQILREYTWAHILEGRQLIGATLPCMLEQFNVFWLKSYEQCPKCAKSRNPKGEPFVSIAIKKQVVSAWPNQSRLNWTIGDGVPYIGSRTEDKIGQPAIKPKCPSAALREAIELTSRLTWVTQGGANSDLLVKPFVEARVNLSVQEILQMTPSHYSGNIVHRYNDQYSPHSFMANRMSNSATRLVVSTNTLGEFSGGGQSARDSNIIFQNVINFSVALFDLRFRNTETSSIQHNRAHLHLSQCCTREVPAQYLTYTSTLSLDLTRYRENELIYDNNPLKGGLNCNLSFDNPLFKGQRLNIIEEDLIRFPHLSGWELAKTIIQSIISDSNNSSTDPISSGETRSFTTHFLTYPKVGLLYSFGAIVSYYLGNTIIRTKKLDLSHFMYYLTTQIHNLPHRSLRILKPTFKHVSVISRLMSIDPHFSIYIGGTAGDRGLSDATRLFLRVAISSFLQFIKKWIVEYKTAIPLWVIYPLEGQNPDPINSFLHLIIALLQNESPQNNIQFQEDRNNQQLSDNLVYMCKSTASNFFHASLAYWRSRHKGRPKNRSTEEQTVKPIPYDNFHSVKCASNPPSIPKSKSGTQGSSAFFEKLEYDKERELPTASTPAEQSKTYIKALSSRIYHGKTPSNAAKDDSTTSKGCDSKEENAVQASHRIVLPFFTLSQNDYRTPSAKKSEYITEITKLIRQLKAIPDTTVYCRFTGVVSSMHYKLDEVLWEFDSFKTAVTLAEGEGSGALLLLQKYKVRTIFFNTLATEHSIEAEIVSGTTTPRMLLPVMAKLHDDQINVILNNSASQVTDITNPAWFTDQKSRIPTQVEIMTMDAETTENINRSKLYEAIQQLIVSHIDTRVLKIVIIKVFLSDIEGLLWLNDHLAPLFGSGYLIKPITSSPKSSEWYLCLSNFLSASRRRPHQGHATCMQVIQTALRLQVQRSSYWLSHLVQYADINLHLSYVNLGFPSLEKVLYHRYNLVDSRKGPLVSILYHLTHLQAEIRELVCDYNQQRQSRTQTYHFIKTTKGRITKLVNDYLKFYLVVQALKHNCLWQEELRTLPDLINVCNRFYHIRDCSCEDRFLIQTLYLTRMQDSEAKLMERLTGFLGLYPNGINA", "length": 2210, "header": "tr|B8XCN5-1|B8XCN5_9MONO Isoform 1 of RNA-directed RNA polymerase L OS=Bundibugyo virus OX=565995 GN=L PE=4 SV=1 CANONICAL=B8XCN5-1" }, "isoforms": [ { "isoform_ac": "B8XCN5-1", "url": "https://www.uniprot.org/uniprotkb/B8XCN5/entry#B8XCN5-1", "sequence": { "sequence": "MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLKNCRLPKHIYRLKFDATVTKFLSDVPIVTLPIDYLTPLLLRTLSGEGLCPVEPKCSQFLDEIVSYVLQDARFLRYYFRHVGVHDDNVGKNFEPKIKALIYDNEFLQQLFYWYDLAILTRRGRLNRGNNRSTWFANDDLIDILGYGDYIFWKIPLSLLSLNTEGIPHAAKDWYHASIFKEAVQGHTHIVSVSTADVLIMCKDIITCRFNTTLIAALANLEDSICSDYPQPETISNLYKAGDYLISILGSEGYKVIKFLEPLCLAKIQLCSNYTERKGRFLTQMHLAVNHTLEELIEGRGLKSQQDWKMREFHRILVNLKSTPQQLCELFSVQKHWGHPVLHSEKAIQKVKKHATVIKALRPVIIFETYCVFKYSIAKHYFDSQGSWYSVISDKHLTPGLHSYIKRNQFPPLPMIKDLLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVEKTCWDAVFEPNVLGYSPPNKFSTKRVPEQFLEQENFSIDSVLTYAQRLDYLLPQYRNFSFSLKEKELNVGRAFGKLPYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGENATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNLFNWMHYTIPQCYIHVSDYYNPPHGVSLENREDPPEGPSSYRGHLGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDSNEQEHSSEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNGVQLPQSLKTATRIAPLSDAIFDDLQGTLASIGTAFERSISETRHVYPCRVVAAFHTFFSVRILQYHHLGFNKGTDLGQLSLSKPLDFGTITLALAVPQVLGGLSFLNPEKCFYRNLGDPVTSGLFQLRTYLQMINMDDLFLPLIAKNPGNCSAIDFVLNPSGLNVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHSSADLEDEMVCKWLLSSTPVMSRFAADIFSRTPSGKRLQILGYLEGTRTLLASKVINNNAETPILDRLRKITLQRWSLWFSYLDHCDQVLADALIKVSCTVDLAQILREYTWAHILEGRQLIGATLPCMLEQFNVFWLKSYEQCPKCAKSRNPKGEPFVSIAIKKQVVSAWPNQSRLNWTIGDGVPYIGSRTEDKIGQPAIKPKCPSAALREAIELTSRLTWVTQGGANSDLLVKPFVEARVNLSVQEILQMTPSHYSGNIVHRYNDQYSPHSFMANRMSNSATRLVVSTNTLGEFSGGGQSARDSNIIFQNVINFSVALFDLRFRNTETSSIQHNRAHLHLSQCCTREVPAQYLTYTSTLSLDLTRYRENELIYDNNPLKGGLNCNLSFDNPLFKGQRLNIIEEDLIRFPHLSGWELAKTIIQSIISDSNNSSTDPISSGETRSFTTHFLTYPKVGLLYSFGAIVSYYLGNTIIRTKKLDLSHFMYYLTTQIHNLPHRSLRILKPTFKHVSVISRLMSIDPHFSIYIGGTAGDRGLSDATRLFLRVAISSFLQFIKKWIVEYKTAIPLWVIYPLEGQNPDPINSFLHLIIALLQNESPQNNIQFQEDRNNQQLSDNLVYMCKSTASNFFHASLAYWRSRHKGRPKNRSTEEQTVKPIPYDNFHSVKCASNPPSIPKSKSGTQGSSAFFEKLEYDKERELPTASTPAEQSKTYIKALSSRIYHGKTPSNAAKDDSTTSKGCDSKEENAVQASHRIVLPFFTLSQNDYRTPSAKKSEYITEITKLIRQLKAIPDTTVYCRFTGVVSSMHYKLDEVLWEFDSFKTAVTLAEGEGSGALLLLQKYKVRTIFFNTLATEHSIEAEIVSGTTTPRMLLPVMAKLHDDQINVILNNSASQVTDITNPAWFTDQKSRIPTQVEIMTMDAETTENINRSKLYEAIQQLIVSHIDTRVLKIVIIKVFLSDIEGLLWLNDHLAPLFGSGYLIKPITSSPKSSEWYLCLSNFLSASRRRPHQGHATCMQVIQTALRLQVQRSSYWLSHLVQYADINLHLSYVNLGFPSLEKVLYHRYNLVDSRKGPLVSILYHLTHLQAEIRELVCDYNQQRQSRTQTYHFIKTTKGRITKLVNDYLKFYLVVQALKHNCLWQEELRTLPDLINVCNRFYHIRDCSCEDRFLIQTLYLTRMQDSEAKLMERLTGFLGLYPNGINA", "length": 2210, "header": "tr|B8XCN5-1|B8XCN5_9MONO Isoform 1 of RNA-directed RNA polymerase L OS=Bundibugyo virus OX=565995 GN=L PE=4 SV=1 CANONICAL=B8XCN5-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1537, "start_aa": "Thr", "end_pos": 1537, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1537", "evidence": [ { "id": "GLY_001544", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001544" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1711, "start_aa": "Thr", "end_pos": 1711, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1711", "evidence": [ { "id": "GLY_001544", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "RNA-directed RNA polymerase activity", "id": "GO:0003968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003968", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" }, { "name": "hydrolase activity", "id": "GO:0016787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" }, { "name": "mRNA 5'-cap (guanine-N7-)-methyltransferase activity", "id": "GO:0004482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004482", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "virion component", "id": "GO:0044423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044423", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "B8XCN5", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1179, "end_pos": 1181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1184, "end_pos": 1186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1249, "end_pos": 1251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1321, "end_pos": 1323, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1393, "end_pos": 1395, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1437, "end_pos": 1439, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1438, "end_pos": 1440, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1602, "end_pos": 1604, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1653, "end_pos": 1655, "annotation": "n_glycosylation_sequon" }, { "start_pos": 169, "end_pos": 171, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1895, "end_pos": 1897, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1935, "end_pos": 1937, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 311, "end_pos": 313, "annotation": "n_glycosylation_sequon" }, { "start_pos": 328, "end_pos": 330, "annotation": "n_glycosylation_sequon" }, { "start_pos": 525, "end_pos": 527, "annotation": "n_glycosylation_sequon" }, { "start_pos": 547, "end_pos": 549, "annotation": "n_glycosylation_sequon" }, { "start_pos": 621, "end_pos": 623, "annotation": "n_glycosylation_sequon" }, { "start_pos": 959, "end_pos": 961, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" }, { "id": "PS51590", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51590" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Mononegavirus-type SAM-dependent 2'-O-MTase", "eco_id": "ECO_0000259", "start_pos": 1805, "end_pos": 2003, "start_aa": "Arg", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "B8XCN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/B8XCN5" }, { "id": "PS50526", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50526" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp catalytic", "eco_id": "ECO_0000259", "start_pos": 625, "end_pos": 809, "start_aa": "Arg", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.7.7.48", "ec_name": "RNA(n) + a ribonucleoside 5'-triphosphate = RNA(n+1) + diphosphate.", "evidence": [ { "id": "2.7.7.48", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.48" }, { "id": "2.7.7.48", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.48" } ] }, { "ec_number": "2.7.7.88", "ec_name": "a 5'-end triphospho-adenylyl-adenylyl-cytidylyl-adenosine in mRNA + GDP + H(+) = a 5'-end (5'-triphosphoguanosine)-adenylyl-adenylyl-cytidylyl-adenosine in mRNA + diphosphate.", "evidence": [ { "id": "2.7.7.88", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.88" } ] } ], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 1537, 1711 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1179, "end_pos": 1181 }, { "start_pos": 1184, "end_pos": 1186 }, { "start_pos": 1249, "end_pos": 1251 }, { "start_pos": 1321, "end_pos": 1323 }, { "start_pos": 1393, "end_pos": 1395 }, { "start_pos": 1437, "end_pos": 1439 }, { "start_pos": 1438, "end_pos": 1440 }, { "start_pos": 1602, "end_pos": 1604 }, { "start_pos": 1653, "end_pos": 1655 }, { "start_pos": 169, "end_pos": 171 }, { "start_pos": 1895, "end_pos": 1897 }, { "start_pos": 1935, "end_pos": 1937 }, { "start_pos": 249, "end_pos": 251 }, { "start_pos": 311, "end_pos": 313 }, { "start_pos": 328, "end_pos": 330 }, { "start_pos": 525, "end_pos": 527 }, { "start_pos": 547, "end_pos": 549 }, { "start_pos": 621, "end_pos": 623 }, { "start_pos": 959, "end_pos": 961 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] } ]