{ "glytoucan_ac": "G39188ZX", "species": [ { "taxid": 3702, "name": "Arabidopsis thaliana", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "9952469", "url": "https://glygen.org/publication/PubMed/9952469" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" }, { "taxid": 9913, "name": "Bos taurus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "GlyConnect", "id": "2453", "url": "https://glyconnect.expasy.org/browser/structures/2453" }, { "database": "PubMed", "id": "11838679", "url": "https://glygen.org/publication/PubMed/11838679" }, { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "PubMed", "id": "24549892", "url": "https://glygen.org/publication/PubMed/24549892" }, { "database": "PubMed", "id": "7682847", "url": "https://glygen.org/publication/PubMed/7682847" }, { "database": "PubMed", "id": "7954510", "url": "https://glygen.org/publication/PubMed/7954510" }, { "database": "PubMed", "id": "9254046", "url": "https://glygen.org/publication/PubMed/9254046" }, { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "GlyConnect", "id": "2453", "url": "https://glyconnect.expasy.org/browser/structures/2453" }, { "database": "PubMed", "id": "10833030", "url": "https://glygen.org/publication/PubMed/10833030" }, { "database": "PubMed", "id": "1841682", "url": "https://glygen.org/publication/PubMed/1841682" }, { "database": "PubMed", "id": "19270371", "url": "https://glygen.org/publication/PubMed/19270371" }, { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "PubMed", "id": "33737529", "url": "https://glygen.org/publication/PubMed/33737529" }, { "database": "PubMed", "id": "6731806", "url": "https://glygen.org/publication/PubMed/6731806" }, { "database": "PubMed", "id": "7733678", "url": "https://glygen.org/publication/PubMed/7733678" }, { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 7227, "name": "Drosophila melanogaster", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "11382750", "url": "https://glygen.org/publication/PubMed/11382750" }, { "database": "PubMed", "id": "16339150", "url": "https://glygen.org/publication/PubMed/16339150" }, { "database": "PubMed", "id": "16897177", "url": "https://glygen.org/publication/PubMed/16897177" }, { "database": "PubMed", "id": "17264077", "url": "https://glygen.org/publication/PubMed/17264077" }, { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" }, { "taxid": 10029, "name": "Cricetulus griseus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" }, { "database": "Subsumption", "id": "G44865OQ", "url": "https://www.glygen.org/glycan/G44865OQ" } ], "common_name": "Chinese hamster", "glygen_name": "Hamster", "reference_species": "Cricetulus griseus [10029]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" }, { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "PubMed", "id": "10814696", "url": "https://glygen.org/publication/PubMed/10814696" }, { "database": "PubMed", "id": "10816579", "url": "https://glygen.org/publication/PubMed/10816579" }, { "database": "PubMed", "id": "10871054", "url": "https://glygen.org/publication/PubMed/10871054" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "10988252", "url": "https://glygen.org/publication/PubMed/10988252" }, { "database": "PubMed", "id": "11179968", "url": "https://glygen.org/publication/PubMed/11179968" }, { "database": "PubMed", "id": "11231274", "url": "https://glygen.org/publication/PubMed/11231274" }, { "database": "PubMed", "id": "11278492", "url": "https://glygen.org/publication/PubMed/11278492" }, { "database": "PubMed", "id": "11469797", "url": "https://glygen.org/publication/PubMed/11469797" }, { "database": "PubMed", "id": "11588155", "url": "https://glygen.org/publication/PubMed/11588155" }, { "database": "PubMed", "id": "15557177", "url": "https://glygen.org/publication/PubMed/15557177" }, { "database": "PubMed", "id": "1577715", "url": "https://glygen.org/publication/PubMed/1577715" }, { "database": "PubMed", "id": "15955802", "url": "https://glygen.org/publication/PubMed/15955802" }, { "database": "PubMed", "id": "1637829", "url": "https://glygen.org/publication/PubMed/1637829" }, { "database": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" }, { "database": "PubMed", "id": "20030399", "url": "https://glygen.org/publication/PubMed/20030399" }, { "database": "PubMed", "id": "2040275", "url": "https://glygen.org/publication/PubMed/2040275" }, { "database": "PubMed", "id": "20578731", "url": "https://glygen.org/publication/PubMed/20578731" }, { "database": "PubMed", "id": "2059624", "url": "https://glygen.org/publication/PubMed/2059624" }, { "database": "PubMed", "id": "2136357", "url": "https://glygen.org/publication/PubMed/2136357" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" }, { "database": "PubMed", "id": "24308486", "url": "https://glygen.org/publication/PubMed/24308486" }, { "database": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" }, { "database": "PubMed", "id": "24698316", "url": "https://glygen.org/publication/PubMed/24698316" }, { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "24884609", "url": "https://glygen.org/publication/PubMed/24884609" }, { "database": "PubMed", "id": "25004930", "url": "https://glygen.org/publication/PubMed/25004930" }, { "database": "PubMed", "id": "2513186", "url": "https://glygen.org/publication/PubMed/2513186" }, { "database": "PubMed", "id": "25345863", "url": "https://glygen.org/publication/PubMed/25345863" }, { "database": "PubMed", "id": "25685702", "url": "https://glygen.org/publication/PubMed/25685702" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "25824821", "url": "https://glygen.org/publication/PubMed/25824821" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29792883", "url": "https://glygen.org/publication/PubMed/29792883" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "30242110", "url": "https://glygen.org/publication/PubMed/30242110" }, { "database": "PubMed", "id": "30582698", "url": "https://glygen.org/publication/PubMed/30582698" }, { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "PubMed", "id": "31889402", "url": "https://glygen.org/publication/PubMed/31889402" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "32310329", "url": "https://glygen.org/publication/PubMed/32310329" }, { "database": "PubMed", "id": "32639750", "url": "https://glygen.org/publication/PubMed/32639750" }, { "database": "PubMed", "id": "32643525", "url": "https://glygen.org/publication/PubMed/32643525" }, { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "PubMed", "id": "33135055", "url": "https://glygen.org/publication/PubMed/33135055" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" }, { "database": "PubMed", "id": "33383989", "url": "https://glygen.org/publication/PubMed/33383989" }, { "database": "PubMed", "id": "33889819", "url": "https://glygen.org/publication/PubMed/33889819" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" }, { "database": "PubMed", "id": "34834161", "url": "https://glygen.org/publication/PubMed/34834161" }, { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "PubMed", "id": "39988192", "url": "https://glygen.org/publication/PubMed/39988192" }, { "database": "PubMed", "id": "4043085", "url": "https://glygen.org/publication/PubMed/4043085" }, { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "PubMed", "id": "4361830", "url": "https://glygen.org/publication/PubMed/4361830" }, { "database": "PubMed", "id": "7780197", "url": "https://glygen.org/publication/PubMed/7780197" }, { "database": "PubMed", "id": "7785764", "url": "https://glygen.org/publication/PubMed/7785764" }, { "database": "PubMed", "id": "8038170", "url": "https://glygen.org/publication/PubMed/8038170" }, { "database": "PubMed", "id": "8251489", "url": "https://glygen.org/publication/PubMed/8251489" }, { "database": "PubMed", "id": "8344278", "url": "https://glygen.org/publication/PubMed/8344278" }, { "database": "PubMed", "id": "8620897", "url": "https://glygen.org/publication/PubMed/8620897" }, { "database": "PubMed", "id": "8943402", "url": "https://glygen.org/publication/PubMed/8943402" }, { "database": "PubMed", "id": "8969451", "url": "https://glygen.org/publication/PubMed/8969451" }, { "database": "PubMed", "id": "9884403", "url": "https://glygen.org/publication/PubMed/9884403" }, { "database": "GlyGen", "id": "GLY_001408", "url": "https://data.glygen.org/GLY_001408" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" }, { "database": "Subsumption", "id": "G44865OQ", "url": "https://www.glygen.org/glycan/G44865OQ" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "10406848", "url": "https://glygen.org/publication/PubMed/10406848" }, { "database": "PubMed", "id": "10713085", "url": "https://glygen.org/publication/PubMed/10713085" }, { "database": "PubMed", "id": "11258925", "url": "https://glygen.org/publication/PubMed/11258925" }, { "database": "PubMed", "id": "14623278", "url": "https://glygen.org/publication/PubMed/14623278" }, { "database": "PubMed", "id": "1922104", "url": "https://glygen.org/publication/PubMed/1922104" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" }, { "database": "PubMed", "id": "7906504", "url": "https://glygen.org/publication/PubMed/7906504" }, { "database": "PubMed", "id": "8563146", "url": "https://glygen.org/publication/PubMed/8563146" }, { "database": "PubMed", "id": "9083032", "url": "https://glygen.org/publication/PubMed/9083032" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" }, { "database": "Subsumption", "id": "G63024BG", "url": "https://www.glygen.org/glycan/G63024BG" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "2090659", "url": "https://glygen.org/publication/PubMed/2090659" }, { "database": "PubMed", "id": "8274017", "url": "https://glygen.org/publication/PubMed/8274017" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 10114, "name": "Rattus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G19747OA", "url": "https://www.glygen.org/glycan/G19747OA" } ], "common_name": "Rattus", "glygen_name": "Rattus", "reference_species": "Rattus [10114]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" }, { "database": "PubMed", "id": "10704528", "url": "https://glygen.org/publication/PubMed/10704528" }, { "database": "PubMed", "id": "33242084", "url": "https://glygen.org/publication/PubMed/33242084" }, { "database": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" }, { "database": "PubMed", "id": "8612632", "url": "https://glygen.org/publication/PubMed/8612632" }, { "database": "PubMed", "id": "9490042", "url": "https://glygen.org/publication/PubMed/9490042" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "PubMed", "id": "34369795", "url": "https://glygen.org/publication/PubMed/34369795" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" }, { "taxid": 44689, "name": "Dictyostelium discoideum", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G63024BG", "url": "https://www.glygen.org/glycan/G63024BG" } ], "common_name": "Social amoeba", "glygen_name": "Cellular slime mold", "reference_species": "Dictyostelium discoideum [44689]" }, { "taxid": 4932, "name": "Saccharomyces cerevisiae", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/compositions/603" }, { "database": "PubMed", "id": "8505334", "url": "https://glygen.org/publication/PubMed/8505334" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae [4932]" } ], "mass": 1396.49, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "High mannose", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Monoantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Truncated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 2, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "166", "site_seq": "HLLEnSTASVSEAERK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "HLLEnSTASVSEAER", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "HLLENSTASVSEAER", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "629", "site_seq": "AInDTAAR", "site_lbl": "Asn629", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02487-1", "start_pos": 629, "end_pos": 629, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1171", "url": "https://glyconnect.expasy.org/browser/proteins/1171" } ], "protein_name": "Desmocollin-2", "gene_name": "DSC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 901, "chemical_mass": 99962.0 } ] }, { "start_pos": "629", "site_seq": "N", "site_lbl": "Asn629", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02487-1", "start_pos": 629, "end_pos": 629, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1171", "url": "https://glyconnect.expasy.org/browser/proteins/1171" } ], "protein_name": "Desmocollin-2", "gene_name": "DSC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 901, "chemical_mass": 99962.0 } ] }, { "start_pos": "629", "site_seq": "AINDTAAR", "site_lbl": "Asn629", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02487-1", "start_pos": 629, "end_pos": 629, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1171", "url": "https://glyconnect.expasy.org/browser/proteins/1171" } ], "protein_name": "Desmocollin-2", "gene_name": "DSC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 901, "chemical_mass": 99962.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "", "site_lbl": "N82", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "452", "site_seq": "LVQLFPnDTSLK", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12797-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1018", "url": "https://glyconnect.expasy.org/browser/proteins/1018" } ], "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 758, "chemical_mass": 85863.0 } ] }, { "start_pos": "452", "site_seq": "N", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12797-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1018", "url": "https://glyconnect.expasy.org/browser/proteins/1018" } ], "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 758, "chemical_mass": 85863.0 } ] }, { "start_pos": "452", "site_seq": "LVQLFPnDTSLKNDLGVGYLLIGDNDNAK", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12797-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1018", "url": "https://glyconnect.expasy.org/browser/proteins/1018" } ], "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 758, "chemical_mass": 85863.0 } ] }, { "start_pos": "452", "site_seq": "LVQLFPNDTSLK", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12797-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1018", "url": "https://glyconnect.expasy.org/browser/proteins/1018" } ], "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 758, "chemical_mass": 85863.0 } ] }, { "start_pos": "452", "site_seq": "", "site_lbl": "N452", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "8", "chr_pos": "61562827", "evidence": [ { "id": "Q12797", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q12797" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->HDT).", "chr_id": "8", "chr_pos": "61562827", "evidence": [ { "id": "rs758171923", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758171923" }, { "id": "rs758171923", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758171923" }, { "id": "rs758171923", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758171923" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "8", "chr_pos": "61562826", "evidence": [ { "id": "rs144001445", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144001445" }, { "id": "rs144001445", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144001445#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12797-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1018", "url": "https://glyconnect.expasy.org/browser/proteins/1018" } ], "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 758, "chemical_mass": 85863.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "NVTWKLGSR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "75566708", "evidence": [ { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "11", "chr_pos": "75566707_75566708insCG", "evidence": [ { "id": "rs1420882595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420882595" }, { "id": "rs1420882595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420882595" }, { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "11", "chr_pos": "75566707", "evidence": [ { "id": "rs1942086877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942086877" }, { "id": "rs1942086877", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1942086877" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "11", "chr_pos": "75566724", "evidence": [ { "id": "rs772088561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772088561#frequency_tab" }, { "id": "rs772088561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772088561" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "75566723", "evidence": [ { "id": "rs1313938366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313938366" }, { "id": "rs1313938366", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1313938366#frequency_tab" }, { "id": "rs1313938366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313938366" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37268159", "url": "https://glygen.org/publication/PubMed/37268159" }, { "database": "TableMaker", "id": "TP6640575", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "9254046", "url": "https://glygen.org/publication/PubMed/9254046" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "387", "site_seq": "N", "site_lbl": "Asn387", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 387, "end_pos": 387, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "495", "site_seq": "N", "site_lbl": "Asn495", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 495, "end_pos": 495, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "564", "site_seq": "N", "site_lbl": "Asn564", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 564, "end_pos": 564, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "9254046", "url": "https://glygen.org/publication/PubMed/9254046" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "60", "site_seq": "N", "site_lbl": "Asn60", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P61823-1", "start_pos": 60, "end_pos": 60, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7954510", "url": "https://glygen.org/publication/PubMed/7954510" }, { "database": "GlyConnect", "id": "529", "url": "https://glyconnect.expasy.org/browser/proteins/529" }, { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" } ], "protein_name": "Ribonuclease pancreatic", "gene_name": "RNASE1", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 150, "chemical_mass": 16461.0 } ] }, { "start_pos": "1527", "site_seq": "N", "site_lbl": "Asn1527", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F1MWM0-1", "start_pos": 1527, "end_pos": 1527, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24549892", "url": "https://glygen.org/publication/PubMed/24549892" }, { "database": "GlyConnect", "id": "812", "url": "https://glyconnect.expasy.org/browser/proteins/812" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "ABCA4", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 2281, "chemical_mass": 257376.0 } ] }, { "start_pos": "1586", "site_seq": "N", "site_lbl": "Asn1586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F1MWM0-1", "start_pos": 1586, "end_pos": 1586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24549892", "url": "https://glygen.org/publication/PubMed/24549892" }, { "database": "GlyConnect", "id": "812", "url": "https://glyconnect.expasy.org/browser/proteins/812" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "ABCA4", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 2281, "chemical_mass": 257376.0 } ] }, { "start_pos": "1660", "site_seq": "N", "site_lbl": "Asn1660", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F1MWM0-1", "start_pos": 1660, "end_pos": 1660, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24549892", "url": "https://glygen.org/publication/PubMed/24549892" }, { "database": "GlyConnect", "id": "812", "url": "https://glyconnect.expasy.org/browser/proteins/812" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "ABCA4", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 2281, "chemical_mass": 257376.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F1MWM0-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24549892", "url": "https://glygen.org/publication/PubMed/24549892" }, { "database": "GlyConnect", "id": "812", "url": "https://glyconnect.expasy.org/browser/proteins/812" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "ABCA4", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 2281, "chemical_mass": 257376.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01012-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "GlyConnect", "id": "475", "url": "https://glyconnect.expasy.org/browser/proteins/475" } ], "protein_name": "Ovalbumin", "gene_name": "SERPINB14", "tax_id": 9031, "tax_name": "Gallus gallus", "tax_common_name": "Chicken", "length": 386, "chemical_mass": 42881.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "9884403", "url": "https://glygen.org/publication/PubMed/9884403" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "20348477", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" }, { "id": "rs778754785", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778754785" }, { "id": "rs778754785", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778754785" }, { "id": "rs778754785", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778754785#frequency_tab" }, { "id": "rs778754785", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778754785" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "20348478", "evidence": [ { "id": "rs982409965", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs982409965" }, { "id": "rs982409965", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs982409965" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "9884403", "url": "https://glygen.org/publication/PubMed/9884403" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "727", "site_seq": "QNNGAFnETLFR", "site_lbl": "Asn727", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 727, "end_pos": 727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7780197", "url": "https://glygen.org/publication/PubMed/7780197" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "727", "site_seq": "N", "site_lbl": "Asn727", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 727, "end_pos": 727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7780197", "url": "https://glygen.org/publication/PubMed/7780197" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "727", "site_seq": "", "site_lbl": "N727", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "3", "chr_pos": "196052046", "evidence": [ { "id": "rs1716353578", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1716353578" }, { "id": "rs1716353578", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1716353578#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 727, "end_pos": 727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7780197", "url": "https://glygen.org/publication/PubMed/7780197" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGnVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" }, { "database": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "N", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" }, { "database": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGNVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" }, { "database": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "1574", "site_seq": "N", "site_lbl": "Asn1574", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 1574, "end_pos": 1574, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "627", "url": "https://glyconnect.expasy.org/browser/proteins/627" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "1574", "site_seq": "", "site_lbl": "N1574", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "12", "chr_pos": "6018697", "evidence": [ { "id": "rs775720629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775720629" }, { "id": "rs775720629", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775720629" }, { "id": "rs775720629", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775720629" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 1574, "end_pos": 1574, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "627", "url": "https://glyconnect.expasy.org/browser/proteins/627" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60486-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "725", "url": "https://glyconnect.expasy.org/browser/proteins/725" } ], "protein_name": "Plexin-C1", "gene_name": "PLXNC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1568, "chemical_mass": 175742.0 } ] }, { "start_pos": "1009", "site_seq": "N", "site_lbl": "Asn1009", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 1009, "end_pos": 1009, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "223", "site_seq": "FnHTQTIQQK", "site_lbl": "Asn223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 223, "end_pos": 223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "223", "site_seq": "N", "site_lbl": "Asn223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 223, "end_pos": 223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "223", "site_seq": "FNHTQTIQQK", "site_lbl": "Asn223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 223, "end_pos": 223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "1009", "site_seq": "", "site_lbl": "N1009", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "7", "chr_pos": "108176554", "evidence": [ { "id": "rs1264749447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1264749447" }, { "id": "rs1264749447", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1264749447#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 1009, "end_pos": 1009, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "223", "site_seq": "", "site_lbl": "N223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->HHT).", "chr_id": "7", "chr_pos": "108226262", "evidence": [ { "id": "rs2093428153", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093428153" }, { "id": "rs2093428153", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2093428153" }, { "id": "rs2093428153", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2093428153" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->IHT).", "chr_id": "7", "chr_pos": "108226261", "evidence": [ { "id": "rs2093427902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093427902" }, { "id": "rs2093427902", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2093427902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 223, "end_pos": 223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "821", "url": "https://glyconnect.expasy.org/browser/proteins/821" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "209", "site_seq": "N", "site_lbl": "Asn209", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "46", "site_seq": "N", "site_lbl": "Asn46", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "209", "site_seq": "", "site_lbl": "N209", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "14", "chr_pos": "105855504", "evidence": [ { "id": "P01871", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01871" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "14", "chr_pos": "105855504", "evidence": [ { "id": "P01871", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01871" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->YAS).", "chr_id": "14", "chr_pos": "105855504", "evidence": [ { "id": "rs1258657913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1258657913" }, { "id": "rs1258657913", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1258657913#frequency_tab" }, { "id": "rs1258657913", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1258657913" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "105855049", "evidence": [ { "id": "rs1555378058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555378058" }, { "id": "rs1555378058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555378058" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "14", "chr_pos": "105855048", "evidence": [ { "id": "rs1248268985", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248268985" }, { "id": "rs1248268985", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1248268985#frequency_tab" }, { "id": "rs1248268985", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248268985" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "46", "site_seq": "", "site_lbl": "N46", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "14", "chr_pos": "105856083", "evidence": [ { "id": "rs1229938382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229938382" }, { "id": "rs1229938382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1229938382#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01854-2", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24308486", "url": "https://glygen.org/publication/PubMed/24308486" }, { "database": "GlyConnect", "id": "765", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "database": "PubMed", "id": "25824821", "url": "https://glygen.org/publication/PubMed/25824821" } ], "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 546, "chemical_mass": 59539.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24884609", "url": "https://glygen.org/publication/PubMed/24884609" }, { "database": "GlyConnect", "id": "711", "url": "https://glyconnect.expasy.org/browser/proteins/711" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24884609", "url": "https://glygen.org/publication/PubMed/24884609" }, { "database": "GlyConnect", "id": "711", "url": "https://glyconnect.expasy.org/browser/proteins/711" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24884609", "url": "https://glygen.org/publication/PubMed/24884609" }, { "database": "GlyConnect", "id": "711", "url": "https://glyconnect.expasy.org/browser/proteins/711" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "3", "chr_pos": "52829129", "evidence": [ { "id": "rs1700528685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1700528685" }, { "id": "rs1700528685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1700528685#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24884609", "url": "https://glygen.org/publication/PubMed/24884609" }, { "database": "GlyConnect", "id": "711", "url": "https://glyconnect.expasy.org/browser/proteins/711" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "157", "site_seq": "NLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "44", "site_seq": "ALALPEICTQCPGSVQNLSK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "N157", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "27215735", "evidence": [ { "id": "rs369720973", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369720973" }, { "id": "rs369720973", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369720973" }, { "id": "rs369720973", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369720973#frequency_tab" }, { "id": "rs369720973", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369720973" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "27215736", "evidence": [ { "id": "rs780822904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780822904" }, { "id": "rs780822904", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780822904" }, { "id": "rs780822904", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780822904#frequency_tab" }, { "id": "rs780822904", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780822904" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "44", "site_seq": "", "site_lbl": "N44", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "2", "chr_pos": "27213208", "evidence": [ { "id": "rs761133724", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761133724" }, { "id": "rs761133724", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761133724" }, { "id": "rs761133724", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761133724" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->TLS).", "chr_id": "2", "chr_pos": "27213208", "evidence": [ { "id": "Q6UW56", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6UW56" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW56-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1000", "url": "https://glyconnect.expasy.org/browser/proteins/1000" } ], "protein_name": "All-trans retinoic acid-induced differentiation factor", "gene_name": "ATRAID", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 229, "chemical_mass": 24747.0 } ] }, { "start_pos": "1020", "site_seq": "N", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "867", "site_seq": "N", "site_lbl": "Asn867", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 867, "end_pos": 867, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "867", "site_seq": "THHWNITAVKLGHINFTISTK", "site_lbl": "Asn867", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 867, "end_pos": 867, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "1020", "site_seq": "", "site_lbl": "N1020", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "8857539", "evidence": [ { "id": "rs1020098673", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1020098673" }, { "id": "rs1020098673", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1020098673#frequency_tab" }, { "id": "rs1020098673", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1020098673" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "12", "chr_pos": "8857540", "evidence": [ { "id": "rs2539277050", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2539277050" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "867", "site_seq": "", "site_lbl": "N867", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "12", "chr_pos": "8854136", "evidence": [ { "id": "rs779461973", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779461973" }, { "id": "rs779461973", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779461973" }, { "id": "rs779461973", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779461973" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "12", "chr_pos": "8854138", "evidence": [ { "id": "A8K2U0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/A8K2U0" }, { "id": "rs371274266", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371274266" }, { "id": "rs371274266", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371274266" }, { "id": "rs371274266", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371274266#frequency_tab" }, { "id": "rs371274266", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371274266" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A8K2U0-1", "start_pos": 867, "end_pos": 867, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1003", "url": "https://glyconnect.expasy.org/browser/proteins/1003" } ], "protein_name": "Alpha-2-macroglobulin-like protein 1", "gene_name": "A2ML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1454, "chemical_mass": 161107.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1004", "url": "https://glyconnect.expasy.org/browser/proteins/1004" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1004", "url": "https://glyconnect.expasy.org/browser/proteins/1004" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1004", "url": "https://glyconnect.expasy.org/browser/proteins/1004" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1004", "url": "https://glyconnect.expasy.org/browser/proteins/1004" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "192", "site_seq": "HMSLALNR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "192", "site_seq": "HMSLALnR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86SJ2-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1007", "url": "https://glyconnect.expasy.org/browser/proteins/1007" } ], "protein_name": "Amphoterin-induced protein 2", "gene_name": "AMIGO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 57934.0 } ] }, { "start_pos": "288", "site_seq": "", "site_lbl": "N288", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "12", "chr_pos": "47078140", "evidence": [ { "id": "rs752950227", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752950227" }, { "id": "rs752950227", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752950227" }, { "id": "rs752950227", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752950227#frequency_tab" }, { "id": "rs752950227", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752950227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86SJ2-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1007", "url": "https://glyconnect.expasy.org/browser/proteins/1007" } ], "protein_name": "Amphoterin-induced protein 2", "gene_name": "AMIGO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 57934.0 } ] }, { "start_pos": "188", "site_seq": "CTLIDALnVTR", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "188", "site_seq": "CTLIDALNVTR", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "366", "site_seq": "GHTNGTKPLDGFDVWK", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "366", "site_seq": "N", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "426", "site_seq": "N", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "426", "site_seq": "NSMAPAKDDSSLPEYSAFnTSVHAAIR", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "426", "site_seq": "DDSSLPEYSAFNTSVHAAIR", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "366", "site_seq": "", "site_lbl": "N366", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "5", "chr_pos": "78885630", "evidence": [ { "id": "rs776690571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776690571" }, { "id": "rs776690571", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776690571" }, { "id": "rs776690571", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776690571#frequency_tab" }, { "id": "rs776690571", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776690571" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15848-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1016", "url": "https://glyconnect.expasy.org/browser/proteins/1016" } ], "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59687.0 } ] }, { "start_pos": "439", "site_seq": "TQnFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1026", "url": "https://glyconnect.expasy.org/browser/proteins/1026" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1026", "url": "https://glyconnect.expasy.org/browser/proteins/1026" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "TQNFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1026", "url": "https://glyconnect.expasy.org/browser/proteins/1026" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "", "site_lbl": "N439", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "NC_000019.10", "chr_pos": "44818862", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1026", "url": "https://glyconnect.expasy.org/browser/proteins/1026" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "160", "site_seq": "ILLTCSLnDSATEVTGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "160", "site_seq": "ILLTCSLNDSATEVTGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "ALMnGSESR", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "ALMNGSESR", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on the interaction with P.falciparum RH5; when associated with D-268 and D-302.", "evidence": [ { "database": "UniProtKB", "id": "P35613", "url": "https://www.uniprot.org/uniprotkb/P35613" }, { "database": "PubMed", "id": "22080952", "url": "https://glygen.org/publication/PubMed/22080952" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on the interaction with P.falciparum RH5; when associated with D-160 and D-302.", "evidence": [ { "database": "UniProtKB", "id": "P35613", "url": "https://www.uniprot.org/uniprotkb/P35613" }, { "database": "PubMed", "id": "22080952", "url": "https://glygen.org/publication/PubMed/22080952" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1027", "url": "https://glyconnect.expasy.org/browser/proteins/1027" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "464", "site_seq": "NNVITLnITGK", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1036", "url": "https://glyconnect.expasy.org/browser/proteins/1036" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1036", "url": "https://glyconnect.expasy.org/browser/proteins/1036" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "NNVITLNITGK", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1036", "url": "https://glyconnect.expasy.org/browser/proteins/1036" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "", "site_lbl": "N464", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "33016797", "evidence": [ { "id": "P16278", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16278" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1036", "url": "https://glyconnect.expasy.org/browser/proteins/1036" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "631", "site_seq": "IAnETR", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1037", "url": "https://glyconnect.expasy.org/browser/proteins/1037" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "631", "site_seq": "N", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1037", "url": "https://glyconnect.expasy.org/browser/proteins/1037" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "631", "site_seq": "IANETRYPHSVAK", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1037", "url": "https://glyconnect.expasy.org/browser/proteins/1037" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "631", "site_seq": "IAnETRYPHSVAK", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1037", "url": "https://glyconnect.expasy.org/browser/proteins/1037" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "631", "site_seq": "", "site_lbl": "N631", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "65960962", "evidence": [ { "id": "rs752576315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752576315" }, { "id": "rs752576315", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752576315" }, { "id": "rs752576315", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752576315" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "65960961", "evidence": [ { "id": "rs780999350", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780999350" }, { "id": "rs780999350", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780999350" }, { "id": "rs780999350", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780999350#frequency_tab" }, { "id": "rs780999350", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780999350" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1037", "url": "https://glyconnect.expasy.org/browser/proteins/1037" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "157", "site_seq": "SAEGTFFInK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1038", "url": "https://glyconnect.expasy.org/browser/proteins/1038" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1038", "url": "https://glyconnect.expasy.org/browser/proteins/1038" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "SAEGTFFINKTEIEDFPR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1038", "url": "https://glyconnect.expasy.org/browser/proteins/1038" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No change of the catalytic activity associated with the alpha-chain. No catalytic activity associated with the alpha-chain; when associated with Q-115 and Q-295.", "evidence": [ { "database": "UniProtKB", "id": "P06865", "url": "https://www.uniprot.org/uniprotkb/P06865" }, { "database": "PubMed", "id": "1533633", "url": "https://glygen.org/publication/PubMed/1533633" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1038", "url": "https://glyconnect.expasy.org/browser/proteins/1038" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "327", "site_seq": "LDSFGPINPTLnTTYSFLTTFFK", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "84", "site_seq": "MTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74721158", "evidence": [ { "id": "rs1749848813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1749848813" }, { "id": "rs1749848813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1749848813#frequency_tab" }, { "id": "rs1749848813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1749848813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74721159", "evidence": [ { "id": "rs763927371", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763927371" }, { "id": "rs763927371", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763927371" }, { "id": "rs763927371", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763927371#frequency_tab" }, { "id": "rs763927371", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763927371" } ], "disease": [ { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74685510", "evidence": [ { "id": "rs897304925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897304925" }, { "id": "rs897304925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897304925" } ], "disease": [ { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74685511", "evidence": [ { "id": "rs200209801", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200209801" }, { "id": "rs200209801", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200209801" }, { "id": "rs200209801", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200209801" }, { "id": "rs200209801", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200209801#frequency_tab" }, { "id": "rs200209801", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200209801" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74685512", "evidence": [ { "id": "rs1748844455", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1748844455" }, { "id": "rs1748844455", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1748844455" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74685511", "evidence": [ { "id": "rs200209801", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200209801" }, { "id": "rs200209801", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200209801" }, { "id": "rs200209801", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200209801" }, { "id": "rs200209801", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200209801#frequency_tab" }, { "id": "rs200209801", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200209801" } ], "disease": [ { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1039", "url": "https://glyconnect.expasy.org/browser/proteins/1039" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "349", "site_seq": "N", "site_lbl": "Asn349", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 349, "end_pos": 349, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1043", "url": "https://glyconnect.expasy.org/browser/proteins/1043" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "349", "site_seq": "NPVGLIGAEnATGETDPSHSK", "site_lbl": "Asn349", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 349, "end_pos": 349, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1043", "url": "https://glyconnect.expasy.org/browser/proteins/1043" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "349", "site_seq": "NPVGLIGAENATGETDPSHSK", "site_lbl": "Asn349", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 349, "end_pos": 349, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1043", "url": "https://glyconnect.expasy.org/browser/proteins/1043" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "344", "site_seq": "SGTIFDNFLITNDEAYAEEFGnETWGVTK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "19", "chr_pos": "12943606", "evidence": [ { "id": "rs1477630481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477630481" }, { "id": "rs1477630481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477630481" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "19", "chr_pos": "12943607", "evidence": [ { "id": "rs755626585", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755626585#frequency_tab" }, { "id": "rs755626585", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755626585" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "626", "site_seq": "nNSNNFDLNR", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "626", "site_seq": "N", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "626", "site_seq": "NNSNNFDLNR", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "197", "site_seq": "LQLSNGnR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "378", "site_seq": "LSQGnTTLSINPVK", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "378", "site_seq": "LSQGNTTLSINPVKR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "19", "chr_pos": "42522038", "evidence": [ { "id": "rs2041763273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041763273" }, { "id": "rs2041763273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2041763273" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "19", "chr_pos": "42519060", "evidence": [ { "id": "rs200488271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200488271" }, { "id": "rs200488271", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200488271#frequency_tab" }, { "id": "rs200488271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200488271" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "19", "chr_pos": "42519061", "evidence": [ { "id": "rs1057049999", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1057049999" }, { "id": "rs1057049999", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1057049999" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13688-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1070", "url": "https://glyconnect.expasy.org/browser/proteins/1070" } ], "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 57560.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06731-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1071", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ], "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 702, "chemical_mass": 76796.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "19", "chr_pos": "41715137", "evidence": [ { "id": "rs781785530", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781785530" }, { "id": "rs781785530", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781785530" }, { "id": "rs781785530", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781785530#frequency_tab" }, { "id": "rs781785530", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781785530" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06731-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1071", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ], "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 702, "chemical_mass": 76796.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P31997-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1072", "url": "https://glyconnect.expasy.org/browser/proteins/1072" } ], "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 349, "chemical_mass": 38154.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->SRT); n-glyco-sequon-gain (NGN->NGS).", "chr_id": "19", "chr_pos": "42589570", "evidence": [ { "id": "P31997", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P31997" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "19", "chr_pos": "42589571", "evidence": [ { "id": "rs778790203", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778790203" }, { "id": "rs778790203", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778790203" }, { "id": "rs778790203", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778790203" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P31997-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1072", "url": "https://glyconnect.expasy.org/browser/proteins/1072" } ], "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 349, "chemical_mass": 38154.0 } ] }, { "start_pos": "363", "site_seq": "DTWGLSDEHFQPRPEAVQFFnVTTLQK", "site_lbl": "Asn363", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 363, "end_pos": 363, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "363", "site_seq": "N", "site_lbl": "Asn363", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 363, "end_pos": 363, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "363", "site_seq": "PEAVQFFNVTTLQK", "site_lbl": "Asn363", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 363, "end_pos": 363, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "87", "site_seq": "nCSAAPQPEPAAGLASYPELR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "87", "site_seq": "N", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "87", "site_seq": "NCSAAPQPEPAAGLASYPELR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "87", "site_seq": "", "site_lbl": "N87", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "3", "chr_pos": "33114338", "evidence": [ { "id": "rs1224133201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1224133201" }, { "id": "rs1224133201", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1224133201#frequency_tab" }, { "id": "rs1224133201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1224133201" } ], "disease": [ { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] }, { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] }, { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "3", "chr_pos": "33114337", "evidence": [ { "id": "rs1322693360", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1322693360" }, { "id": "rs1322693360", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1322693360#frequency_tab" }, { "id": "rs1322693360", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1322693360" } ], "disease": [ { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] }, { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] }, { "disease_id": "DOID:0110337", "name": "osteogenesis imperfecta type 7", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the CRTAP gene on chromosome 3p22.", "url": "http://disease-ontology.org/term/DOID:0110337", "evidence": [ { "id": "610682", "database": "MIM", "url": "https://www.omim.org/entry/610682" }, { "id": "0110337", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110337" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75718-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1074", "url": "https://glyconnect.expasy.org/browser/proteins/1074" } ], "protein_name": "Cartilage-associated protein", "gene_name": "CRTAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46562.0 } ] }, { "start_pos": "550", "site_seq": "N", "site_lbl": "Asn550", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75339-1", "start_pos": 550, "end_pos": 550, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1075", "url": "https://glyconnect.expasy.org/browser/proteins/1075" } ], "protein_name": "Cartilage intermediate layer protein 1", "gene_name": "CILP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 132565.0 } ] }, { "start_pos": "550", "site_seq": "FVnTTK", "site_lbl": "Asn550", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75339-1", "start_pos": 550, "end_pos": 550, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1075", "url": "https://glyconnect.expasy.org/browser/proteins/1075" } ], "protein_name": "Cartilage intermediate layer protein 1", "gene_name": "CILP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 132565.0 } ] }, { "start_pos": "631", "site_seq": "N", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75339-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1075", "url": "https://glyconnect.expasy.org/browser/proteins/1075" } ], "protein_name": "Cartilage intermediate layer protein 1", "gene_name": "CILP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 132565.0 } ] }, { "start_pos": "550", "site_seq": "", "site_lbl": "N550", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "15", "chr_pos": "65198637", "evidence": [ { "id": "rs2088410919", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2088410919" }, { "id": "rs2088410919", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2088410919#frequency_tab" }, { "id": "rs2088410919", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2088410919" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75339-1", "start_pos": 550, "end_pos": 550, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1075", "url": "https://glyconnect.expasy.org/browser/proteins/1075" } ], "protein_name": "Cartilage intermediate layer protein 1", "gene_name": "CILP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 132565.0 } ] }, { "start_pos": "631", "site_seq": "", "site_lbl": "N631", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "15", "chr_pos": "65198395", "evidence": [ { "id": "rs2140671894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2140671894" }, { "id": "rs2140671894", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2140671894" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "15", "chr_pos": "65198394", "evidence": [ { "id": "O75339", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75339" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75339-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1075", "url": "https://glyconnect.expasy.org/browser/proteins/1075" } ], "protein_name": "Cartilage intermediate layer protein 1", "gene_name": "CILP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 132565.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "134", "site_seq": "SSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "378", "site_seq": "VYInDSVELSQNEQK", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX1-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1080", "url": "https://glyconnect.expasy.org/browser/proteins/1080" } ], "protein_name": "Cathepsin F", "gene_name": "CTSF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 484, "chemical_mass": 53366.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX1-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1080", "url": "https://glyconnect.expasy.org/browser/proteins/1080" } ], "protein_name": "Cathepsin F", "gene_name": "CTSF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 484, "chemical_mass": 53366.0 } ] }, { "start_pos": "378", "site_seq": "AKVYINDSVELSQNEQK", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX1-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1080", "url": "https://glyconnect.expasy.org/browser/proteins/1080" } ], "protein_name": "Cathepsin F", "gene_name": "CTSF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 484, "chemical_mass": 53366.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "11", "chr_pos": "66564920", "evidence": [ { "id": "rs1857895533", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1857895533" }, { "id": "rs1857895533", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1857895533" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "11", "chr_pos": "66564919", "evidence": [ { "id": "rs148080813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148080813" }, { "id": "rs148080813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148080813" }, { "id": "rs148080813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148080813#frequency_tab" }, { "id": "rs148080813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148080813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX1-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1080", "url": "https://glyconnect.expasy.org/browser/proteins/1080" } ], "protein_name": "Cathepsin F", "gene_name": "CTSF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 484, "chemical_mass": 53366.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07711-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1081", "url": "https://glyconnect.expasy.org/browser/proteins/1081" } ], "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 37564.0 } ] }, { "start_pos": "221", "site_seq": "YSVAnDTGFVDIPK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07711-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1081", "url": "https://glyconnect.expasy.org/browser/proteins/1081" } ], "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 37564.0 } ] }, { "start_pos": "221", "site_seq": "YSVANDTGFVDIPK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07711-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1081", "url": "https://glyconnect.expasy.org/browser/proteins/1081" } ], "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 37564.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "9", "chr_pos": "87729612", "evidence": [ { "id": "rs1826176774", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1826176774" }, { "id": "rs1826176774", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1826176774" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07711-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1081", "url": "https://glyconnect.expasy.org/browser/proteins/1081" } ], "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 37564.0 } ] }, { "start_pos": "184", "site_seq": "nYTLWR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBR2-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1082", "url": "https://glyconnect.expasy.org/browser/proteins/1082" } ], "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 33868.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBR2-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1082", "url": "https://glyconnect.expasy.org/browser/proteins/1082" } ], "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 33868.0 } ] }, { "start_pos": "184", "site_seq": "ECHAIRnYTLWR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBR2-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1082", "url": "https://glyconnect.expasy.org/browser/proteins/1082" } ], "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 33868.0 } ] }, { "start_pos": "184", "site_seq": "ECHAIRNYTLWR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBR2-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1082", "url": "https://glyconnect.expasy.org/browser/proteins/1082" } ], "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 33868.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "20", "chr_pos": "58997689", "evidence": [ { "id": "rs1015074498", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1015074498" }, { "id": "rs1015074498", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1015074498#frequency_tab" }, { "id": "rs1015074498", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1015074498" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBR2-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1082", "url": "https://glyconnect.expasy.org/browser/proteins/1082" } ], "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 33868.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "57", "site_seq": "RLKPLFNK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHnQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHNQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "581", "site_seq": "TnITLVCKPGDLESAPVLR", "site_lbl": "Asn581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 581, "end_pos": 581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "581", "site_seq": "N", "site_lbl": "Asn581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 581, "end_pos": 581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "581", "site_seq": "TNITLVCK", "site_lbl": "Asn581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 581, "end_pos": 581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "", "site_lbl": "N400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "6", "chr_pos": "160033094", "evidence": [ { "id": "rs546763515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546763515" }, { "id": "rs546763515", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546763515" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "6", "chr_pos": "160033095", "evidence": [ { "id": "rs560576091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs560576091" }, { "id": "rs560576091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs560576091#frequency_tab" }, { "id": "rs560576091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs560576091" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "581", "site_seq": "", "site_lbl": "N581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "6", "chr_pos": "160044634", "evidence": [ { "id": "rs756827708", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756827708" }, { "id": "rs756827708", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756827708" }, { "id": "rs756827708", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756827708#frequency_tab" }, { "id": "rs756827708", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756827708" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 581, "end_pos": 581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "", "site_lbl": "N480", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "105550191", "evidence": [ { "id": "Q13740", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13740" }, { "id": "rs1940358284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1940358284" }, { "id": "rs1940358284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1940358284#frequency_tab" }, { "id": "rs1940358284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1940358284" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "FWLPPnVTWTELEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HA82-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1106", "url": "https://glyconnect.expasy.org/browser/proteins/1106" } ], "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 394, "chemical_mass": 46399.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HA82-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1106", "url": "https://glyconnect.expasy.org/browser/proteins/1106" } ], "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 394, "chemical_mass": 46399.0 } ] }, { "start_pos": "19", "site_seq": "FWLPPnVTWTELEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HA82-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1106", "url": "https://glyconnect.expasy.org/browser/proteins/1106" } ], "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 394, "chemical_mass": 46399.0 } ] }, { "start_pos": "19", "site_seq": "", "site_lbl": "N19", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "8251132", "evidence": [ { "id": "rs1201540609", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1201540609" }, { "id": "rs1201540609", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1201540609" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HA82-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1106", "url": "https://glyconnect.expasy.org/browser/proteins/1106" } ], "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 394, "chemical_mass": 46399.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHnVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHNVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "", "site_lbl": "N18", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "2", "chr_pos": "168456500", "evidence": [ { "id": "rs1224345601", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1224345601" }, { "id": "rs1224345601", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1224345601#frequency_tab" }, { "id": "rs1224345601", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1224345601" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "168456501", "evidence": [ { "id": "rs769616429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769616429#frequency_tab" }, { "id": "rs769616429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769616429" }, { "id": "rs769616429", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs769616429" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "255", "site_seq": "NIETnYTR", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75503-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "CLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 41497.0 } ] }, { "start_pos": "255", "site_seq": "N", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75503-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "CLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 41497.0 } ] }, { "start_pos": "255", "site_seq": "NIETNYTR", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75503-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "CLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 41497.0 } ] }, { "start_pos": "255", "site_seq": "", "site_lbl": "N255", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "13", "chr_pos": "77000657", "evidence": [ { "id": "rs1566221492", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1566221492" }, { "id": "rs1566221492", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1566221492" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "13", "chr_pos": "77000656", "evidence": [ { "id": "rs929479143", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs929479143" }, { "id": "rs929479143", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs929479143#frequency_tab" }, { "id": "rs929479143", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs929479143" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "13", "chr_pos": "77000656", "evidence": [ { "id": "rs929479143", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs929479143" }, { "id": "rs929479143", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs929479143#frequency_tab" }, { "id": "rs929479143", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs929479143" }, { "id": "rs929479143", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs929479143" } ], "disease": [ { "disease_id": "DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22.", "url": "http://disease-ontology.org/term/DOID:0110728", "evidence": [ { "id": "256731", "database": "MIM", "url": "https://www.omim.org/entry/256731" }, { "id": "0110728", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110728" } ] }, { "disease_id": "DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22.", "url": "http://disease-ontology.org/term/DOID:0110728", "evidence": [ { "id": "256731", "database": "MIM", "url": "https://www.omim.org/entry/256731" }, { "id": "0110728", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110728" } ] }, { "disease_id": "DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22.", "url": "http://disease-ontology.org/term/DOID:0110728", "evidence": [ { "id": "256731", "database": "MIM", "url": "https://www.omim.org/entry/256731" }, { "id": "0110728", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110728" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->nullYT).", "chr_id": "13", "chr_pos": "77000656", "evidence": [ { "id": "rs2501155992", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2501155992" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75503-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "CLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 41497.0 } ] }, { "start_pos": "255", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the endoplasmic reticulum rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprotkb/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75503-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "CLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 41497.0 } ] }, { "start_pos": "135", "site_seq": "FAEInGSALCSYNLKPSEYTTSPK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "135", "site_seq": "FAEINGSALCSYNLK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "180", "site_seq": "CAPVnISCYAK", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "180", "site_seq": "CAPVNISCYAK", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "9", "chr_pos": "105356251", "evidence": [ { "id": "rs780705243", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780705243" }, { "id": "rs780705243", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780705243" }, { "id": "rs780705243", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780705243" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "9", "chr_pos": "105356250", "evidence": [ { "id": "Q8WWI5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8WWI5" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1110", "url": "https://glyconnect.expasy.org/browser/proteins/1110" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1116", "url": "https://glyconnect.expasy.org/browser/proteins/1116" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "295", "site_seq": "DYYPInESLASLPLR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1116", "url": "https://glyconnect.expasy.org/browser/proteins/1116" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "295", "site_seq": "DYYPINESLASLPLR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1116", "url": "https://glyconnect.expasy.org/browser/proteins/1116" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "229", "site_seq": "DLMVInR", "site_lbl": "Asn229", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 229, "end_pos": 229, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "229", "site_seq": "N", "site_lbl": "Asn229", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 229, "end_pos": 229, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "91", "site_seq": "TVNVSVPK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "91", "site_seq": "TVnVSVPK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "91", "site_seq": "", "site_lbl": "N91", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "1341852", "evidence": [ { "id": "rs1401760738", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401760738" }, { "id": "rs1401760738", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1401760738" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96KA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1117", "url": "https://glyconnect.expasy.org/browser/proteins/1117" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "CLPTM1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 538, "chemical_mass": 62229.0 } ] }, { "start_pos": "1365", "site_seq": "LMSTEASQnITYHCK", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1125", "url": "https://glyconnect.expasy.org/browser/proteins/1125" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1125", "url": "https://glyconnect.expasy.org/browser/proteins/1125" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "ASQNITYHCK", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1125", "url": "https://glyconnect.expasy.org/browser/proteins/1125" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "", "site_lbl": "N1365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "17", "chr_pos": "50185932", "evidence": [ { "id": "rs1906471089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1906471089" }, { "id": "rs1906471089", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1906471089" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1125", "url": "https://glyconnect.expasy.org/browser/proteins/1125" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1367", "site_seq": "ASQnITYHCK", "site_lbl": "Asn1367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02461-1", "start_pos": 1367, "end_pos": 1367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1127", "url": "https://glyconnect.expasy.org/browser/proteins/1127" } ], "protein_name": "Collagen alpha-1(III) chain", "gene_name": "COL3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1466, "chemical_mass": 138564.0 } ] }, { "start_pos": "1367", "site_seq": "N", "site_lbl": "Asn1367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02461-1", "start_pos": 1367, "end_pos": 1367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1127", "url": "https://glyconnect.expasy.org/browser/proteins/1127" } ], "protein_name": "Collagen alpha-1(III) chain", "gene_name": "COL3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1466, "chemical_mass": 138564.0 } ] }, { "start_pos": "1367", "site_seq": "LLSSRASQNITYHCK", "site_lbl": "Asn1367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02461-1", "start_pos": 1367, "end_pos": 1367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1127", "url": "https://glyconnect.expasy.org/browser/proteins/1127" } ], "protein_name": "Collagen alpha-1(III) chain", "gene_name": "COL3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1466, "chemical_mass": 138564.0 } ] }, { "start_pos": "1367", "site_seq": "", "site_lbl": "N1367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "2", "chr_pos": "189010736", "evidence": [ { "id": "rs746580509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580509" }, { "id": "rs746580509", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580509" }, { "id": "rs746580509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746580509" } ], "disease": [ { "disease_id": "DOID:14756", "name": "vascular type Ehlers-Danlos syndrome", "description": "An Ehlers-Danlos syndrome that has_material_basis_in heterozygous mutation in the COL3A1 gene on chromosome 2q32 and that is characterized by the association of unexpected organ fragility (arterial/bowel/gravid uterine rupture) with inconstant physical features as thin, translucent skin, easy bruising and acrogeric traits.", "url": "http://disease-ontology.org/term/DOID:14756", "evidence": [ { "id": "130050", "database": "MIM", "url": "https://www.omim.org/entry/130050" }, { "id": "14756", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14756" } ] }, { "disease_id": "DOID:14756", "name": "vascular type Ehlers-Danlos syndrome", "description": "An Ehlers-Danlos syndrome that has_material_basis_in heterozygous mutation in the COL3A1 gene on chromosome 2q32 and that is characterized by the association of unexpected organ fragility (arterial/bowel/gravid uterine rupture) with inconstant physical features as thin, translucent skin, easy bruising and acrogeric traits.", "url": "http://disease-ontology.org/term/DOID:14756", "evidence": [ { "id": "130050", "database": "MIM", "url": "https://www.omim.org/entry/130050" }, { "id": "14756", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14756" } ] }, { "disease_id": "DOID:14756", "name": "vascular type Ehlers-Danlos syndrome", "description": "An Ehlers-Danlos syndrome that has_material_basis_in heterozygous mutation in the COL3A1 gene on chromosome 2q32 and that is characterized by the association of unexpected organ fragility (arterial/bowel/gravid uterine rupture) with inconstant physical features as thin, translucent skin, easy bruising and acrogeric traits.", "url": "http://disease-ontology.org/term/DOID:14756", "evidence": [ { "id": "130050", "database": "MIM", "url": "https://www.omim.org/entry/130050" }, { "id": "14756", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14756" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02461-1", "start_pos": 1367, "end_pos": 1367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1127", "url": "https://glyconnect.expasy.org/browser/proteins/1127" } ], "protein_name": "Collagen alpha-1(III) chain", "gene_name": "COL3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1466, "chemical_mass": 138564.0 } ] }, { "start_pos": "1672", "site_seq": "VYCnFTAGGSTCVFPDK", "site_lbl": "Asn1672", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20908-1", "start_pos": 1672, "end_pos": 1672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1128", "url": "https://glyconnect.expasy.org/browser/proteins/1128" } ], "protein_name": "Collagen alpha-1(V) chain", "gene_name": "COL5A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 183560.0 } ] }, { "start_pos": "1672", "site_seq": "N", "site_lbl": "Asn1672", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20908-1", "start_pos": 1672, "end_pos": 1672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1128", "url": "https://glyconnect.expasy.org/browser/proteins/1128" } ], "protein_name": "Collagen alpha-1(V) chain", "gene_name": "COL5A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 183560.0 } ] }, { "start_pos": "1672", "site_seq": "VYCNFTAGGSTCVFPDKK", "site_lbl": "Asn1672", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20908-1", "start_pos": 1672, "end_pos": 1672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1128", "url": "https://glyconnect.expasy.org/browser/proteins/1128" } ], "protein_name": "Collagen alpha-1(V) chain", "gene_name": "COL5A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 183560.0 } ] }, { "start_pos": "1672", "site_seq": "", "site_lbl": "N1672", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "9", "chr_pos": "134825853", "evidence": [ { "id": "P20908", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20908" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "9", "chr_pos": "134825852", "evidence": [ { "id": "rs1839243054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1839243054" }, { "id": "rs1839243054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1839243054#frequency_tab" } ], "disease": [ { "disease_id": "DOID:13359", "name": "Ehlers-Danlos syndrome", "description": "A collagen disease that is characterized by extremely flexible joints, elastic skin, and excessive bruising caused by a heritable defect in collagen synthesis, which leads to marked healing difficulties. EDS has five cardinal signs, which may be present to some degree in all of the subtypes. These five cardinal signs are skin fragility, blood vessel fragility, skin hyperelasticity, joint hypermobility, and characteristic subcutaneous nodules.", "url": "http://disease-ontology.org/term/DOID:13359", "evidence": [ { "id": "13359", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13359" } ] }, { "disease_id": "DOID:13359", "name": "Ehlers-Danlos syndrome", "description": "A collagen disease that is characterized by extremely flexible joints, elastic skin, and excessive bruising caused by a heritable defect in collagen synthesis, which leads to marked healing difficulties. EDS has five cardinal signs, which may be present to some degree in all of the subtypes. These five cardinal signs are skin fragility, blood vessel fragility, skin hyperelasticity, joint hypermobility, and characteristic subcutaneous nodules.", "url": "http://disease-ontology.org/term/DOID:13359", "evidence": [ { "id": "13359", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13359" } ] }, { "disease_id": "DOID:14720", "name": "Ehlers-Danlos syndrome classic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by loose-jointedness and fragile, bruisable skin that heals with peculiar 'cigarette-paper' scars and that has_material_basis_in heterozygous mutation in the collagen alpha-1(V) gene (COL5A1) on chromosome 9q34.", "url": "http://disease-ontology.org/term/DOID:14720", "evidence": [ { "id": "14720", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14720" }, { "id": "14720", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14720" } ] }, { "disease_id": "DOID:14720", "name": "Ehlers-Danlos syndrome classic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by loose-jointedness and fragile, bruisable skin that heals with peculiar 'cigarette-paper' scars and that has_material_basis_in heterozygous mutation in the collagen alpha-1(V) gene (COL5A1) on chromosome 9q34.", "url": "http://disease-ontology.org/term/DOID:14720", "evidence": [ { "id": "14720", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14720" }, { "id": "14720", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14720" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20908-1", "start_pos": 1672, "end_pos": 1672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1128", "url": "https://glyconnect.expasy.org/browser/proteins/1128" } ], "protein_name": "Collagen alpha-1(V) chain", "gene_name": "COL5A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 183560.0 } ] }, { "start_pos": "212", "site_seq": "RnFTAADWGQSR", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "212", "site_seq": "nFTAADWGQSR", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "212", "site_seq": "NFTAADWGQSR", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "nVTAQICIDK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "N", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "NVTAQICIDKK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "", "site_lbl": "N804", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "21", "chr_pos": "46002687", "evidence": [ { "id": "rs750677189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750677189#frequency_tab" }, { "id": "rs750677189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750677189" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "1640", "site_seq": "N", "site_lbl": "Asn1640", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12107-1", "start_pos": 1640, "end_pos": 1640, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1130", "url": "https://glyconnect.expasy.org/browser/proteins/1130" } ], "protein_name": "Collagen alpha-1(XI) chain", "gene_name": "COL11A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1806, "chemical_mass": 181065.0 } ] }, { "start_pos": "1640", "site_seq": "VYCNFTSGGETCIYPDKK", "site_lbl": "Asn1640", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12107-1", "start_pos": 1640, "end_pos": 1640, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1130", "url": "https://glyconnect.expasy.org/browser/proteins/1130" } ], "protein_name": "Collagen alpha-1(XI) chain", "gene_name": "COL11A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1806, "chemical_mass": 181065.0 } ] }, { "start_pos": "1640", "site_seq": "", "site_lbl": "N1640", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "1", "chr_pos": "102883252", "evidence": [ { "id": "rs1650484067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1650484067" }, { "id": "rs1650484067", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1650484067#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "1", "chr_pos": "102883250", "evidence": [ { "id": "rs1650483497", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1650483497" }, { "id": "rs1650483497", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1650483497#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12107-1", "start_pos": 1640, "end_pos": 1640, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1130", "url": "https://glyconnect.expasy.org/browser/proteins/1130" } ], "protein_name": "Collagen alpha-1(XI) chain", "gene_name": "COL11A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1806, "chemical_mass": 181065.0 } ] }, { "start_pos": "2206", "site_seq": "N", "site_lbl": "Asn2206", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2206, "end_pos": 2206, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "MLEAYnLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "N", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "IEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2206", "site_seq": "", "site_lbl": "N2206", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "NC_000006.12", "chr_pos": "75124362", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "6", "chr_pos": "75124362", "evidence": [ { "id": "Q99715", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q99715" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2206, "end_pos": 2206, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "", "site_lbl": "N2528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "6", "chr_pos": "75115897", "evidence": [ { "id": "rs2149361441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2149361441" }, { "id": "rs2149361441", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2149361441" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "6", "chr_pos": "75115898", "evidence": [ { "id": "rs1168175119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168175119" }, { "id": "rs1168175119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168175119#frequency_tab" }, { "id": "rs1168175119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1168175119" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1267", "site_seq": "LLANYASQnITYHCK", "site_lbl": "Asn1267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08123-1", "start_pos": 1267, "end_pos": 1267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1135", "url": "https://glyconnect.expasy.org/browser/proteins/1135" } ], "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1366, "chemical_mass": 129314.0 } ] }, { "start_pos": "1267", "site_seq": "N", "site_lbl": "Asn1267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08123-1", "start_pos": 1267, "end_pos": 1267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1135", "url": "https://glyconnect.expasy.org/browser/proteins/1135" } ], "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1366, "chemical_mass": 129314.0 } ] }, { "start_pos": "1400", "site_seq": "EASQnITYICK", "site_lbl": "Asn1400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05997-1", "start_pos": 1400, "end_pos": 1400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1136", "url": "https://glyconnect.expasy.org/browser/proteins/1136" } ], "protein_name": "Collagen alpha-2(V) chain", "gene_name": "COL5A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1499, "chemical_mass": 144910.0 } ] }, { "start_pos": "1400", "site_seq": "N", "site_lbl": "Asn1400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05997-1", "start_pos": 1400, "end_pos": 1400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1136", "url": "https://glyconnect.expasy.org/browser/proteins/1136" } ], "protein_name": "Collagen alpha-2(V) chain", "gene_name": "COL5A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1499, "chemical_mass": 144910.0 } ] }, { "start_pos": "1400", "site_seq": "EASQNITYICK", "site_lbl": "Asn1400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05997-1", "start_pos": 1400, "end_pos": 1400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1136", "url": "https://glyconnect.expasy.org/browser/proteins/1136" } ], "protein_name": "Collagen alpha-2(V) chain", "gene_name": "COL5A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1499, "chemical_mass": 144910.0 } ] }, { "start_pos": "1400", "site_seq": "", "site_lbl": "N1400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "2", "chr_pos": "189035069", "evidence": [ { "id": "rs979486002", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs979486002" }, { "id": "rs979486002", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs979486002#frequency_tab" }, { "id": "rs979486002", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs979486002" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05997-1", "start_pos": 1400, "end_pos": 1400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1136", "url": "https://glyconnect.expasy.org/browser/proteins/1136" } ], "protein_name": "Collagen alpha-2(V) chain", "gene_name": "COL5A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1499, "chemical_mass": 144910.0 } ] }, { "start_pos": "140", "site_seq": "GTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALANMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "630", "site_seq": "CGALDVVFVIDSSESIGYTnFTLEK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "21", "chr_pos": "46125537", "evidence": [ { "id": "rs1322511970", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1322511970" }, { "id": "rs1322511970", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1322511970" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "2677", "site_seq": "N", "site_lbl": "Asn2677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2677, "end_pos": 2677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1139", "url": "https://glyconnect.expasy.org/browser/proteins/1139" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2677", "site_seq": "VAVVQHAPSESVDNASMPPVK", "site_lbl": "Asn2677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2677, "end_pos": 2677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1139", "url": "https://glyconnect.expasy.org/browser/proteins/1139" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2677", "site_seq": "VAVVQHAPSESVDnASMPPVK", "site_lbl": "Asn2677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2677, "end_pos": 2677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1139", "url": "https://glyconnect.expasy.org/browser/proteins/1139" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2677", "site_seq": "", "site_lbl": "N2677", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "2", "chr_pos": "237340886", "evidence": [ { "id": "rs755750913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755750913" }, { "id": "rs755750913", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755750913" }, { "id": "rs755750913", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755750913" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2677, "end_pos": 2677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1139", "url": "https://glyconnect.expasy.org/browser/proteins/1139" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "621", "site_seq": "QSVPAHFVALnGSK", "site_lbl": "Asn621", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06681-1", "start_pos": 621, "end_pos": 621, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1145", "url": "https://glyconnect.expasy.org/browser/proteins/1145" } ], "protein_name": "Complement C2", "gene_name": "C2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 752, "chemical_mass": 83268.0 } ] }, { "start_pos": "621", "site_seq": "N", "site_lbl": "Asn621", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06681-1", "start_pos": 621, "end_pos": 621, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1145", "url": "https://glyconnect.expasy.org/browser/proteins/1145" } ], "protein_name": "Complement C2", "gene_name": "C2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 752, "chemical_mass": 83268.0 } ] }, { "start_pos": "621", "site_seq": "", "site_lbl": "N621", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "6", "chr_pos": "31944185", "evidence": [ { "id": "P06681", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P06681" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06681-1", "start_pos": 621, "end_pos": 621, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1145", "url": "https://glyconnect.expasy.org/browser/proteins/1145" } ], "protein_name": "Complement C2", "gene_name": "C2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 752, "chemical_mass": 83268.0 } ] }, { "start_pos": "226", "site_seq": "N", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0C0L5-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1146", "url": "https://glyconnect.expasy.org/browser/proteins/1146" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Complement C4-B", "gene_name": "C4B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1744, "chemical_mass": 192751.0 } ] }, { "start_pos": "190", "site_seq": "nETHSICTACDESCK", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "190", "site_seq": "N", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "190", "site_seq": "NETHSICTACDESCK", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "251", "site_seq": "NAnGSYTCEECDSSCVGCTGEGPGNCK", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "251", "site_seq": "NANGSYTCEECDSSCVGCTGEGPGNCK", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "190", "site_seq": "", "site_lbl": "N190", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "22", "chr_pos": "49921738", "evidence": [ { "id": "rs201818846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201818846" }, { "id": "rs201818846", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201818846" }, { "id": "rs201818846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201818846" }, { "id": "rs201818846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201818846#frequency_tab" }, { "id": "rs201818846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201818846" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "22", "chr_pos": "49923297", "evidence": [ { "id": "rs771938750", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771938750" }, { "id": "rs771938750", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771938750" }, { "id": "rs771938750", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771938750" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "22", "chr_pos": "49923298", "evidence": [ { "id": "rs201681025", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201681025" }, { "id": "rs201681025", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201681025" }, { "id": "rs201681025", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201681025#frequency_tab" }, { "id": "rs201681025", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201681025" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXH1-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1164", "url": "https://glyconnect.expasy.org/browser/proteins/1164" } ], "protein_name": "Protein disulfide isomerase CRELD2", "gene_name": "CRELD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 353, "chemical_mass": 38192.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "276", "site_seq": "N", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "29", "site_seq": "N", "site_lbl": "Asn29", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 29, "end_pos": 29, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "29", "site_seq": "GAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQR", "site_lbl": "Asn29", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 29, "end_pos": 29, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "DVnCSVMGPQEK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "DVNCSVMGPQEKK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "29", "site_seq": "", "site_lbl": "N29", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "11", "chr_pos": "88337587", "evidence": [ { "id": "rs781093858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781093858" }, { "id": "rs781093858", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781093858" }, { "id": "rs781093858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781093858" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 29, "end_pos": 29, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "88337514", "evidence": [ { "id": "rs1857833438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1857833438" }, { "id": "rs1857833438", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1857833438#frequency_tab" }, { "id": "rs1857833438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1857833438" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "11", "chr_pos": "88337515", "evidence": [ { "id": "rs766806566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766806566" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "315", "site_seq": "ALAGLVYnASGSEHCYDIYR", "site_lbl": "Asn315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "315", "site_seq": "N", "site_lbl": "Asn315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "428", "site_seq": "RnLSASVIAVTIQGGAHHLDLR", "site_lbl": "Asn428", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 428, "end_pos": 428, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "428", "site_seq": "nLSASVIAVTIQGGAHHLDLR", "site_lbl": "Asn428", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 428, "end_pos": 428, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "428", "site_seq": "N", "site_lbl": "Asn428", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 428, "end_pos": 428, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "428", "site_seq": "RNLSASVIAVTIQGGAHHLDLR", "site_lbl": "Asn428", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 428, "end_pos": 428, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "315", "site_seq": "", "site_lbl": "N315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "9", "chr_pos": "137112218", "evidence": [ { "id": "rs1318099328", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1318099328" }, { "id": "rs1318099328", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1318099328" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHL4-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1176", "url": "https://glyconnect.expasy.org/browser/proteins/1176" } ], "protein_name": "Dipeptidyl peptidase 2", "gene_name": "DPP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 54341.0 } ] }, { "start_pos": "439", "site_seq": "nISQVLEK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1178", "url": "https://glyconnect.expasy.org/browser/proteins/1178" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1178", "url": "https://glyconnect.expasy.org/browser/proteins/1178" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "439", "site_seq": "NISQVLEK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1178", "url": "https://glyconnect.expasy.org/browser/proteins/1178" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "264", "site_seq": "nTSWDNAGFK", "site_lbl": "Asn264", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 264, "end_pos": 264, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1180", "url": "https://glyconnect.expasy.org/browser/proteins/1180" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "264", "site_seq": "N", "site_lbl": "Asn264", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 264, "end_pos": 264, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1180", "url": "https://glyconnect.expasy.org/browser/proteins/1180" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "264", "site_seq": "NTSWDNAGFK", "site_lbl": "Asn264", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 264, "end_pos": 264, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1180", "url": "https://glyconnect.expasy.org/browser/proteins/1180" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "264", "site_seq": "", "site_lbl": "N264", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "2", "chr_pos": "9523301", "evidence": [ { "id": "rs1664384098", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1664384098" }, { "id": "rs1664384098", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1664384098" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 264, "end_pos": 264, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1180", "url": "https://glyconnect.expasy.org/browser/proteins/1180" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "381", "site_seq": "NFSSCSAEDFEK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1181", "url": "https://glyconnect.expasy.org/browser/proteins/1181" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1181", "url": "https://glyconnect.expasy.org/browser/proteins/1181" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "381", "site_seq": "nFSSCSAEDFEK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1181", "url": "https://glyconnect.expasy.org/browser/proteins/1181" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "8", "chr_pos": "39041957", "evidence": [ { "id": "Q13443", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13443" }, { "id": "rs955532636", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs955532636" }, { "id": "rs955532636", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs955532636" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1181", "url": "https://glyconnect.expasy.org/browser/proteins/1181" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "299", "site_seq": "DEIGnVSTSHLLILDDSVEMEIRPR", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04843-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1186", "url": "https://glyconnect.expasy.org/browser/proteins/1186" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "RPN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 607, "chemical_mass": 68569.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04843-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1186", "url": "https://glyconnect.expasy.org/browser/proteins/1186" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "RPN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 607, "chemical_mass": 68569.0 } ] }, { "start_pos": "299", "site_seq": "DEIGNVSTSHLLILDDSVEMEIRPR", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04843-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1186", "url": "https://glyconnect.expasy.org/browser/proteins/1186" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "RPN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 607, "chemical_mass": 68569.0 } ] }, { "start_pos": "299", "site_seq": "", "site_lbl": "N299", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "128630092", "evidence": [ { "id": "rs1309225437", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1309225437" }, { "id": "rs1309225437", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1309225437" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "128630091", "evidence": [ { "id": "rs369220843", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369220843" }, { "id": "rs369220843", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369220843" }, { "id": "rs369220843", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369220843#frequency_tab" }, { "id": "rs369220843", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369220843" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04843-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1186", "url": "https://glyconnect.expasy.org/browser/proteins/1186" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "RPN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 607, "chemical_mass": 68569.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04844-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1187", "url": "https://glyconnect.expasy.org/browser/proteins/1187" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "RPN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 631, "chemical_mass": 69284.0 } ] }, { "start_pos": "106", "site_seq": "KACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETK", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04844-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1187", "url": "https://glyconnect.expasy.org/browser/proteins/1187" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "RPN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 631, "chemical_mass": 69284.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "20", "chr_pos": "37199063", "evidence": [ { "id": "rs1432272299", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1432272299" }, { "id": "rs1432272299", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1432272299#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04844-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1187", "url": "https://glyconnect.expasy.org/browser/proteins/1187" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "RPN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 631, "chemical_mass": 69284.0 } ] }, { "start_pos": "641", "site_seq": "N", "site_lbl": "Asn641", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 641, "end_pos": 641, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1189", "url": "https://glyconnect.expasy.org/browser/proteins/1189" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "641", "site_seq": "AMSSnETAAYK", "site_lbl": "Asn641", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 641, "end_pos": 641, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1189", "url": "https://glyconnect.expasy.org/browser/proteins/1189" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "641", "site_seq": "AMSSNETAAYK", "site_lbl": "Asn641", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 641, "end_pos": 641, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1189", "url": "https://glyconnect.expasy.org/browser/proteins/1189" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "641", "site_seq": "", "site_lbl": "N641", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "31625975", "evidence": [ { "id": "rs1292800840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1292800840" }, { "id": "rs1292800840", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1292800840" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 641, "end_pos": 641, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1189", "url": "https://glyconnect.expasy.org/browser/proteins/1189" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "3746", "site_seq": "LNLASNR", "site_lbl": "Asn3746", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95714-1", "start_pos": 3746, "end_pos": 3746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191" } ], "protein_name": "E3 ubiquitin-protein ligase HERC2", "gene_name": "HERC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4834, "chemical_mass": 527228.0 } ] }, { "start_pos": "3746", "site_seq": "N", "site_lbl": "Asn3746", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95714-1", "start_pos": 3746, "end_pos": 3746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191" } ], "protein_name": "E3 ubiquitin-protein ligase HERC2", "gene_name": "HERC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4834, "chemical_mass": 527228.0 } ] }, { "start_pos": "3746", "site_seq": "", "site_lbl": "N3746", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "15", "chr_pos": "28144138", "evidence": [ { "id": "rs114532098", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114532098" }, { "id": "rs114532098", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114532098" }, { "id": "rs114532098", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114532098" }, { "id": "rs114532098", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs114532098#frequency_tab" }, { "id": "rs114532098", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs114532098" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "15", "chr_pos": "28144139", "evidence": [ { "id": "rs1480398247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1480398247" }, { "id": "rs1480398247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1480398247" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95714-1", "start_pos": 3746, "end_pos": 3746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191" } ], "protein_name": "E3 ubiquitin-protein ligase HERC2", "gene_name": "HERC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4834, "chemical_mass": 527228.0 } ] }, { "start_pos": "129", "site_seq": "N", "site_lbl": "Asn129", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 129, "end_pos": 129, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "129", "site_seq": "", "site_lbl": "N129", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "9", "chr_pos": "137051511", "evidence": [ { "id": "rs1197447007", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197447007" }, { "id": "rs1197447007", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1197447007#frequency_tab" }, { "id": "rs1197447007", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1197447007" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "137051510", "evidence": [ { "id": "rs1251186982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1251186982" }, { "id": "rs1251186982", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1251186982#frequency_tab" }, { "id": "rs1251186982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1251186982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 129, "end_pos": 129, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "232", "site_seq": "GYLTSFEMFnSTYK", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1194", "url": "https://glyconnect.expasy.org/browser/proteins/1194" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1194", "url": "https://glyconnect.expasy.org/browser/proteins/1194" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "232", "site_seq": "GYLTSFEMFNSTYK", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1194", "url": "https://glyconnect.expasy.org/browser/proteins/1194" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "414", "site_seq": "CFDAMEVDALnSSHPVSTPVENPAQIR", "site_lbl": "Asn414", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZ08-1", "start_pos": 414, "end_pos": 414, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1203", "url": "https://glyconnect.expasy.org/browser/proteins/1203" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "ERAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 941, "chemical_mass": 107235.0 } ] }, { "start_pos": "414", "site_seq": "N", "site_lbl": "Asn414", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZ08-1", "start_pos": 414, "end_pos": 414, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1203", "url": "https://glyconnect.expasy.org/browser/proteins/1203" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "ERAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 941, "chemical_mass": 107235.0 } ] }, { "start_pos": "414", "site_seq": "CFDAMEVDALNSSHPVSTPVENPAQIR", "site_lbl": "Asn414", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZ08-1", "start_pos": 414, "end_pos": 414, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1203", "url": "https://glyconnect.expasy.org/browser/proteins/1203" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "ERAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 941, "chemical_mass": 107235.0 } ] }, { "start_pos": "414", "site_seq": "", "site_lbl": "N414", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "5", "chr_pos": "96792141", "evidence": [ { "id": "Q9NZ08", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NZ08" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "5", "chr_pos": "96792141", "evidence": [ { "id": "rs1326866329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326866329" }, { "id": "rs1326866329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1326866329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZ08-1", "start_pos": 414, "end_pos": 414, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1203", "url": "https://glyconnect.expasy.org/browser/proteins/1203" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "ERAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 941, "chemical_mass": 107235.0 } ] }, { "start_pos": "103", "site_seq": "IEVLVSnATQFIILHSK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "103", "site_seq": "IEVLVSNATQFIILHSK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITnATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITNATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "219", "site_seq": "AnFSIK", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "NC_000005.10", "chr_pos": "96879993", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "5", "chr_pos": "96879993", "evidence": [ { "id": "rs376750913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376750913" }, { "id": "rs376750913", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376750913" }, { "id": "rs376750913", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376750913#frequency_tab" }, { "id": "rs376750913", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376750913" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "219", "site_seq": "", "site_lbl": "N219", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "5", "chr_pos": "96883872", "evidence": [ { "id": "rs1342669372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1342669372" }, { "id": "rs1342669372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1342669372#frequency_tab" }, { "id": "rs1342669372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1342669372" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "5", "chr_pos": "96883872", "evidence": [ { "id": "rs1342669372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1342669372" }, { "id": "rs1342669372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1342669372#frequency_tab" }, { "id": "rs1342669372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1342669372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1204", "url": "https://glyconnect.expasy.org/browser/proteins/1204" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "217", "site_seq": "HNnDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "12", "chr_pos": "103934194", "evidence": [ { "id": "rs371098260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371098260#frequency_tab" }, { "id": "rs371098260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371098260" }, { "id": "rs371098260", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371098260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Does not promote or impair hyperglycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P14625", "url": "https://www.uniprot.org/uniprotkb/P14625" }, { "database": "PubMed", "id": "31296534", "url": "https://glygen.org/publication/PubMed/31296534" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "363", "site_seq": "N", "site_lbl": "Asn363", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11678-1", "start_pos": 363, "end_pos": 363, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1208", "url": "https://glyconnect.expasy.org/browser/proteins/1208" } ], "protein_name": "Eosinophil peroxidase", "gene_name": "EPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 715, "chemical_mass": 81040.0 } ] }, { "start_pos": "37", "site_seq": "YAVYWnSSNPR", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52803-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1212", "url": "https://glyconnect.expasy.org/browser/proteins/1212" } ], "protein_name": "Ephrin-A5", "gene_name": "EFNA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 228, "chemical_mass": 26297.0 } ] }, { "start_pos": "37", "site_seq": "N", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52803-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1212", "url": "https://glyconnect.expasy.org/browser/proteins/1212" } ], "protein_name": "Ephrin-A5", "gene_name": "EFNA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 228, "chemical_mass": 26297.0 } ] }, { "start_pos": "37", "site_seq": "YAVYWNSSNPR", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52803-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1212", "url": "https://glyconnect.expasy.org/browser/proteins/1212" } ], "protein_name": "Ephrin-A5", "gene_name": "EFNA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 228, "chemical_mass": 26297.0 } ] }, { "start_pos": "37", "site_seq": "", "site_lbl": "N37", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "5", "chr_pos": "107670504", "evidence": [ { "id": "P52803", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P52803" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P52803-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1212", "url": "https://glyconnect.expasy.org/browser/proteins/1212" } ], "protein_name": "Ephrin-A5", "gene_name": "EFNA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 228, "chemical_mass": 26297.0 } ] }, { "start_pos": "336", "site_seq": "ALHALnVTWR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y2E5-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1216", "url": "https://glyconnect.expasy.org/browser/proteins/1216" } ], "protein_name": "Epididymis-specific alpha-mannosidase", "gene_name": "MAN2B2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1009, "chemical_mass": 113979.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y2E5-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1216", "url": "https://glyconnect.expasy.org/browser/proteins/1216" } ], "protein_name": "Epididymis-specific alpha-mannosidase", "gene_name": "MAN2B2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1009, "chemical_mass": 113979.0 } ] }, { "start_pos": "336", "site_seq": "ALHALNVTWR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y2E5-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1216", "url": "https://glyconnect.expasy.org/browser/proteins/1216" } ], "protein_name": "Epididymis-specific alpha-mannosidase", "gene_name": "MAN2B2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1009, "chemical_mass": 113979.0 } ] }, { "start_pos": "336", "site_seq": "", "site_lbl": "N336", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "4", "chr_pos": "6594682", "evidence": [ { "id": "rs1016282113", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1016282113" }, { "id": "rs1016282113", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1016282113#frequency_tab" }, { "id": "rs1016282113", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1016282113" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y2E5-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1216", "url": "https://glyconnect.expasy.org/browser/proteins/1216" } ], "protein_name": "Epididymis-specific alpha-mannosidase", "gene_name": "MAN2B2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1009, "chemical_mass": 113979.0 } ] }, { "start_pos": "111", "site_seq": "QCnGTSMCWCVNTAGVR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "2", "chr_pos": "47373954", "evidence": [ { "id": "rs1321881720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321881720" }, { "id": "rs1321881720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1321881720#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "2", "chr_pos": "47373954", "evidence": [ { "id": "rs1321881720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321881720" }, { "id": "rs1321881720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1321881720#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "2", "chr_pos": "47373955", "evidence": [ { "id": "rs373819791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373819791#frequency_tab" }, { "id": "rs373819791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373819791" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "2", "chr_pos": "47373956", "evidence": [ { "id": "rs533825372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs533825372" }, { "id": "rs533825372", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs533825372" }, { "id": "rs533825372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs533825372" }, { "id": "rs533825372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs533825372#frequency_tab" }, { "id": "rs533825372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs533825372" }, { "id": "rs533825372", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs533825372" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "2", "chr_pos": "47373955", "evidence": [ { "id": "rs373819791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373819791#frequency_tab" }, { "id": "rs373819791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373819791" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "2", "chr_pos": "47373955", "evidence": [ { "id": "rs373819791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373819791" }, { "id": "rs373819791", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373819791#frequency_tab" }, { "id": "rs373819791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373819791" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "2", "chr_pos": "47373954", "evidence": [ { "id": "rs1321881720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321881720" }, { "id": "rs1321881720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1321881720#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Changed glycosylation pattern. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-74 and A-198.", "evidence": [ { "database": "UniProtKB", "id": "P16422", "url": "https://www.uniprot.org/uniprotkb/P16422" }, { "database": "PubMed", "id": "18508581", "url": "https://glygen.org/publication/PubMed/18508581" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75477-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1221", "url": "https://glyconnect.expasy.org/browser/proteins/1221" } ], "protein_name": "Erlin-1", "gene_name": "ERLIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 348, "chemical_mass": 39171.0 } ] }, { "start_pos": "108", "site_seq": "", "site_lbl": "N108", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "10", "chr_pos": "100176053", "evidence": [ { "id": "rs1844279023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1844279023" }, { "id": "rs1844279023", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1844279023" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "10", "chr_pos": "100176051", "evidence": [ { "id": "O75477", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75477" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "10", "chr_pos": "100176052", "evidence": [ { "id": "rs1390285465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1390285465" }, { "id": "rs1390285465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1390285465#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75477-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1221", "url": "https://glyconnect.expasy.org/browser/proteins/1221" } ], "protein_name": "Erlin-1", "gene_name": "ERLIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 348, "chemical_mass": 39171.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O94905-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1222", "url": "https://glyconnect.expasy.org/browser/proteins/1222" } ], "protein_name": "Erlin-2", "gene_name": "ERLIN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 339, "chemical_mass": 37840.0 } ] }, { "start_pos": "106", "site_seq": "NYTADYDKALIFNK", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O94905-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1222", "url": "https://glyconnect.expasy.org/browser/proteins/1222" } ], "protein_name": "Erlin-2", "gene_name": "ERLIN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 339, "chemical_mass": 37840.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O94905", "url": "https://www.uniprot.org/uniprotkb/O94905" }, { "database": "PubMed", "id": "17502376", "url": "https://glygen.org/publication/PubMed/17502376" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O94905-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1222", "url": "https://glyconnect.expasy.org/browser/proteins/1222" } ], "protein_name": "Erlin-2", "gene_name": "ERLIN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 339, "chemical_mass": 37840.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5UCC4-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1224", "url": "https://glyconnect.expasy.org/browser/proteins/1224" } ], "protein_name": "ER membrane protein complex subunit 10", "gene_name": "EMC10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 262, "chemical_mass": 27347.0 } ] }, { "start_pos": "182", "site_seq": "GHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIER", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5UCC4-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1224", "url": "https://glyconnect.expasy.org/browser/proteins/1224" } ], "protein_name": "ER membrane protein complex subunit 10", "gene_name": "EMC10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 262, "chemical_mass": 27347.0 } ] }, { "start_pos": "182", "site_seq": "", "site_lbl": "N182", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "19", "chr_pos": "50480723", "evidence": [ { "id": "rs2122661343", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2122661343" }, { "id": "rs2122661343", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2122661343" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->nullTS).", "chr_id": "19", "chr_pos": "50480721", "evidence": [ { "id": "rs1211225273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211225273" }, { "id": "35684946", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35684946" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5UCC4-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1224", "url": "https://glyconnect.expasy.org/browser/proteins/1224" } ], "protein_name": "ER membrane protein complex subunit 10", "gene_name": "EMC10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 262, "chemical_mass": 27347.0 } ] }, { "start_pos": "280", "site_seq": "KWGHnITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1225", "url": "https://glyconnect.expasy.org/browser/proteins/1225" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "WGHnITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1225", "url": "https://glyconnect.expasy.org/browser/proteins/1225" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "N", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1225", "url": "https://glyconnect.expasy.org/browser/proteins/1225" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "WGHNITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1225", "url": "https://glyconnect.expasy.org/browser/proteins/1225" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "15136577", "url": "https://glygen.org/publication/PubMed/15136577" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1225", "url": "https://glyconnect.expasy.org/browser/proteins/1225" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "444", "site_seq": "N", "site_lbl": "Asn444", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 444, "end_pos": 444, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "444", "site_seq": "HIPGLIHnMTAR", "site_lbl": "Asn444", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 444, "end_pos": 444, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "444", "site_seq": "HIPGLIHNMTAR", "site_lbl": "Asn444", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 444, "end_pos": 444, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "444", "site_seq": "", "site_lbl": "N444", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->TMT).", "chr_id": "1", "chr_pos": "150512751", "evidence": [ { "id": "rs909048486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs909048486" }, { "id": "rs909048486", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs909048486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 444, "end_pos": 444, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "197", "site_seq": "DYFTDLITnESINYFK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU6-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1231", "url": "https://glyconnect.expasy.org/browser/proteins/1231" } ], "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 871, "chemical_mass": 101027.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU6-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1231", "url": "https://glyconnect.expasy.org/browser/proteins/1231" } ], "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 871, "chemical_mass": 101027.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "8", "chr_pos": "69588996", "evidence": [ { "id": "rs2130284306", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2130284306" }, { "id": "rs2130284306", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2130284306" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU6-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1231", "url": "https://glyconnect.expasy.org/browser/proteins/1231" } ], "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 871, "chemical_mass": 101027.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "N1067", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "P35555", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35555" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "15", "chr_pos": "48488375", "evidence": [ { "id": "rs1358163754", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358163754" }, { "id": "rs1358163754", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358163754" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "rs765043727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" }, { "id": "rs765043727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "", "site_lbl": "N1112", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "P35556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35556" }, { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0111595", "name": "congenital contractural arachnodactyly", "description": "A distal arthrogryposis characterized by contractures, arachnodactyly, scoliosis, and crumpled ears that has_material_basis_in heterozygous mutation in the FBN2 gene on chromosome 5q23.3.", "url": "http://disease-ontology.org/term/DOID:0111595", "evidence": [ { "id": "121050", "database": "MIM", "url": "https://www.omim.org/entry/121050" }, { "id": "0111595", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111595" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" }, { "id": "rs1301097230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301097230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "", "site_lbl": "N1025", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "19", "chr_pos": "8123473", "evidence": [ { "id": "rs1725454320", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1725454320" }, { "id": "rs1725454320", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1725454320" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "19", "chr_pos": "8123471", "evidence": [ { "id": "rs2082902690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2082902690" }, { "id": "rs2082902690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2082902690#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "19", "chr_pos": "8123472", "evidence": [ { "id": "rs765206008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765206008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "ALGFEnATQALGR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "17", "chr_pos": "78976002", "evidence": [ { "id": "rs770079138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770079138#frequency_tab" }, { "id": "rs770079138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770079138" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "nFTMNEK", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGnISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGNISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "116", "site_seq": "", "site_lbl": "N116", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "8", "chr_pos": "63027193", "evidence": [ { "id": "Q92820", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92820" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "18175095", "evidence": [ { "id": "rs1190449225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1190449225" }, { "id": "rs1190449225", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1190449225#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "157", "site_seq": "NInSSCRPGPGAWLR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95479-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1264", "url": "https://glyconnect.expasy.org/browser/proteins/1264" } ], "protein_name": "GDH/6PGL endoplasmic bifunctional protein", "gene_name": "H6PD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 791, "chemical_mass": 88893.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95479-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1264", "url": "https://glyconnect.expasy.org/browser/proteins/1264" } ], "protein_name": "GDH/6PGL endoplasmic bifunctional protein", "gene_name": "H6PD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 791, "chemical_mass": 88893.0 } ] }, { "start_pos": "157", "site_seq": "NINSSCRPGPGAWLR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95479-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1264", "url": "https://glyconnect.expasy.org/browser/proteins/1264" } ], "protein_name": "GDH/6PGL endoplasmic bifunctional protein", "gene_name": "H6PD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 791, "chemical_mass": 88893.0 } ] }, { "start_pos": "476", "site_seq": "YEQGTGCWQGPnR", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "N", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "YEQGTGCWQGPNR", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "72", "site_seq": "DGSDEPGTAACPNGSFHCTNTGYK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "", "site_lbl": "N476", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "19", "chr_pos": "11449162", "evidence": [ { "id": "rs922380592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs922380592" }, { "id": "rs922380592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs922380592#frequency_tab" }, { "id": "rs922380592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs922380592" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "19", "chr_pos": "11437894", "evidence": [ { "id": "rs762834835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762834835" }, { "id": "rs762834835", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762834835" }, { "id": "rs762834835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762834835" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->nullGS).", "chr_id": "19", "chr_pos": "11437894", "evidence": [ { "id": "rs1555725707", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555725707" }, { "id": "12529853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12529853" } ], "disease": [ { "disease_id": "DOID:0060980", "name": "polycystic liver disease 1", "description": "A polycystic disease characterized by the presence of multiple liver cysts of biliary epithelial origin that has_material_basis_in heterozygous mutation in the PRKCSH gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0060980", "evidence": [ { "id": "0060980", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060980" }, { "id": "0060980", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060980" } ] }, { "disease_id": "DOID:0060980", "name": "polycystic liver disease 1", "description": "A polycystic disease characterized by the presence of multiple liver cysts of biliary epithelial origin that has_material_basis_in heterozygous mutation in the PRKCSH gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0060980", "evidence": [ { "id": "0060980", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060980" }, { "id": "0060980", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060980" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1269", "url": "https://glyconnect.expasy.org/browser/proteins/1269" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "309", "site_seq": "N", "site_lbl": "Asn309", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 309, "end_pos": 309, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "309", "site_seq": "DLGPTLANSTHHNVR", "site_lbl": "Asn309", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 309, "end_pos": 309, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "58", "site_seq": "PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSR", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969N2-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1286", "url": "https://glyconnect.expasy.org/browser/proteins/1286" } ], "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 578, "chemical_mass": 65700.0 } ] }, { "start_pos": "327", "site_seq": "TYAIYDLLDTAMInNSR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969N2-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1286", "url": "https://glyconnect.expasy.org/browser/proteins/1286" } ], "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 578, "chemical_mass": 65700.0 } ] }, { "start_pos": "327", "site_seq": "KTYAIYDLLDTAMINNSR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969N2-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1286", "url": "https://glyconnect.expasy.org/browser/proteins/1286" } ], "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 578, "chemical_mass": 65700.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->HNS).", "chr_id": "20", "chr_pos": "45420639", "evidence": [ { "id": "rs117616742", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs117616742" }, { "id": "rs117616742", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs117616742" }, { "id": "rs117616742", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs117616742" }, { "id": "rs117616742", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs117616742#frequency_tab" }, { "id": "rs117616742", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs117616742" } ], "disease": [ { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] }, { "disease_id": "DOID:0080140", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 3", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by neonatal hypotonia, lack of psychomotor development, seizures, dysmorphic features, and variable congenital anomalies involving the cardiac, urinary, and gastrointestinal systems and that has_material_basis_in homozygous or compound heterozygous mutation in the PIGT gene on chromosome 20q13.", "url": "http://disease-ontology.org/term/DOID:0080140", "evidence": [ { "id": "0014165", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014165" }, { "id": "615398", "database": "MIM", "url": "https://www.omim.org/entry/615398" }, { "id": "PIGT", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGT/#!details" }, { "id": "0080140", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080140" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "20", "chr_pos": "45420641", "evidence": [ { "id": "rs750287066", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750287066" }, { "id": "rs750287066", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750287066" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q969N2-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1286", "url": "https://glyconnect.expasy.org/browser/proteins/1286" } ], "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 578, "chemical_mass": 65700.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on function in GPI-anchor attachment to protein.", "evidence": [ { "database": "UniProtKB", "id": "Q969N2", "url": "https://www.uniprot.org/uniprotkb/Q969N2" }, { "database": "PubMed", "id": "34576938", "url": "https://glygen.org/publication/PubMed/34576938" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q969N2-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1286", "url": "https://glyconnect.expasy.org/browser/proteins/1286" } ], "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 578, "chemical_mass": 65700.0 } ] }, { "start_pos": "289", "site_seq": "VFVQTPTInYTLR", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1292", "url": "https://glyconnect.expasy.org/browser/proteins/1292" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "289", "site_seq": "N", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1292", "url": "https://glyconnect.expasy.org/browser/proteins/1292" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "289", "site_seq": "VFVQTPTINYTLR", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1292", "url": "https://glyconnect.expasy.org/browser/proteins/1292" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "289", "site_seq": "", "site_lbl": "N289", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "16", "chr_pos": "68259283", "evidence": [ { "id": "rs548914013", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs548914013" }, { "id": "rs548914013", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs548914013" }, { "id": "rs548914013", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs548914013" }, { "id": "rs548914013", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs548914013" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1292", "url": "https://glyconnect.expasy.org/browser/proteins/1292" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "289", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation site. Mildly reduces production of the mature, active enzyme.", "evidence": [ { "database": "UniProtKB", "id": "Q8NCC3", "url": "https://www.uniprot.org/uniprotkb/Q8NCC3" }, { "database": "PubMed", "id": "23958596", "url": "https://glygen.org/publication/PubMed/23958596" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1292", "url": "https://glyconnect.expasy.org/browser/proteins/1292" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "162", "site_seq": "FGEFGnYSLLVK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CP4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1307", "url": "https://glyconnect.expasy.org/browser/proteins/1307" } ], "protein_name": "Heparan-alpha-glucosaminide N-acetyltransferase", "gene_name": "HGSNAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 663, "chemical_mass": 73293.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CP4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1307", "url": "https://glyconnect.expasy.org/browser/proteins/1307" } ], "protein_name": "Heparan-alpha-glucosaminide N-acetyltransferase", "gene_name": "HGSNAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 663, "chemical_mass": 73293.0 } ] }, { "start_pos": "162", "site_seq": "FGEFGNYSLLVK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CP4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1307", "url": "https://glyconnect.expasy.org/browser/proteins/1307" } ], "protein_name": "Heparan-alpha-glucosaminide N-acetyltransferase", "gene_name": "HGSNAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 663, "chemical_mass": 73293.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1366", "url": "https://glyconnect.expasy.org/browser/proteins/1366" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1366", "url": "https://glyconnect.expasy.org/browser/proteins/1366" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1366", "url": "https://glyconnect.expasy.org/browser/proteins/1366" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "143", "site_seq": "FTPPVVnVTWLR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1368", "url": "https://glyconnect.expasy.org/browser/proteins/1368" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1368", "url": "https://glyconnect.expasy.org/browser/proteins/1368" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "352", "site_seq": "DSLSInATNIK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "137", "url": "https://glyconnect.expasy.org/browser/proteins/137" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "137", "url": "https://glyconnect.expasy.org/browser/proteins/137" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "352", "site_seq": "DSLSINATNIK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "137", "url": "https://glyconnect.expasy.org/browser/proteins/137" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "352", "site_seq": "", "site_lbl": "N352", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "7", "chr_pos": "55156580", "evidence": [ { "id": "rs2128938267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2128938267" }, { "id": "rs2128938267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2128938267" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "55156582", "evidence": [ { "id": "rs2128938270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2128938270" }, { "id": "rs2128938270", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2128938270" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->YAT).", "chr_id": "7", "chr_pos": "55156580", "evidence": [ { "id": "rs2128938267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2128938267" }, { "id": "rs2128938267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2128938267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "137", "url": "https://glyconnect.expasy.org/browser/proteins/137" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "222", "site_seq": "DInTTAQNIMFYDMGSGSTVCTIVTYQMVK", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "N", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "DINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "830", "site_seq": "N", "site_lbl": "Asn830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 830, "end_pos": 830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "830", "site_seq": "LSALDNLLnHSSMFLK", "site_lbl": "Asn830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 830, "end_pos": 830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "830", "site_seq": "LSALDNLLnHSSMFLKGAR", "site_lbl": "Asn830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 830, "end_pos": 830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "", "site_lbl": "N222", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "11", "chr_pos": "119054508", "evidence": [ { "id": "rs2133605388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133605388" }, { "id": "rs2133605388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133605388" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "11", "chr_pos": "119054507", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "", "site_lbl": "N596", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "119049575", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "11", "chr_pos": "119049576", "evidence": [ { "id": "rs2133574126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133574126" }, { "id": "rs2133574126", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133574126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "", "site_lbl": "N862", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "11", "chr_pos": "119047745", "evidence": [ { "id": "rs1944168165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1944168165" }, { "id": "rs1944168165", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1944168165" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "119047744", "evidence": [ { "id": "rs534349629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534349629" }, { "id": "rs534349629", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534349629" }, { "id": "rs534349629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs534349629#frequency_tab" }, { "id": "rs2133557957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2133557957" }, { "id": "rs2133557957", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133557957" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "328", "site_seq": "ISnLTIVQAEIK", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q70UQ0-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1398", "url": "https://glyconnect.expasy.org/browser/proteins/1398" } ], "protein_name": "Inhibitor of nuclear factor kappa-B kinase-interacting protein", "gene_name": "IKBIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 39309.0 } ] }, { "start_pos": "328", "site_seq": "N", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q70UQ0-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1398", "url": "https://glyconnect.expasy.org/browser/proteins/1398" } ], "protein_name": "Inhibitor of nuclear factor kappa-B kinase-interacting protein", "gene_name": "IKBIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 39309.0 } ] }, { "start_pos": "328", "site_seq": "ISNLTIVQAEIK", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q70UQ0-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1398", "url": "https://glyconnect.expasy.org/browser/proteins/1398" } ], "protein_name": "Inhibitor of nuclear factor kappa-B kinase-interacting protein", "gene_name": "IKBIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 39309.0 } ] }, { "start_pos": "2512", "site_seq": "VESGEnCSSPAPR", "site_lbl": "Asn2512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14643-1", "start_pos": 2512, "end_pos": 2512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1399", "url": "https://glyconnect.expasy.org/browser/proteins/1399" } ], "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2758, "chemical_mass": 313929.0 } ] }, { "start_pos": "2512", "site_seq": "VESGENCSSPAPR", "site_lbl": "Asn2512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14643-1", "start_pos": 2512, "end_pos": 2512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1399", "url": "https://glyconnect.expasy.org/browser/proteins/1399" } ], "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2758, "chemical_mass": 313929.0 } ] }, { "start_pos": "2512", "site_seq": "N", "site_lbl": "Asn2512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14643-1", "start_pos": 2512, "end_pos": 2512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1399", "url": "https://glyconnect.expasy.org/browser/proteins/1399" } ], "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2758, "chemical_mass": 313929.0 } ] }, { "start_pos": "2512", "site_seq": "", "site_lbl": "N2512", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "3", "chr_pos": "4813209", "evidence": [ { "id": "rs2470171756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2470171756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14643-1", "start_pos": 2512, "end_pos": 2512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1399", "url": "https://glyconnect.expasy.org/browser/proteins/1399" } ], "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2758, "chemical_mass": 313929.0 } ] }, { "start_pos": "418", "site_seq": "nTTFNVESTK", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1405", "url": "https://glyconnect.expasy.org/browser/proteins/1405" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "418", "site_seq": "NTTFNVESTK", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1405", "url": "https://glyconnect.expasy.org/browser/proteins/1405" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "418", "site_seq": "N", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1405", "url": "https://glyconnect.expasy.org/browser/proteins/1405" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "418", "site_seq": "nTTFNVESTKK", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1405", "url": "https://glyconnect.expasy.org/browser/proteins/1405" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "418", "site_seq": "", "site_lbl": "N418", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "5", "chr_pos": "52898326", "evidence": [ { "id": "rs1750263371", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1750263371" }, { "id": "rs1750263371", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1750263371" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1405", "url": "https://glyconnect.expasy.org/browser/proteins/1405" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "1074", "site_seq": "GEYFVnVTTR", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1074", "site_seq": "DVHMKGEYFVNVTTR", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1074", "site_seq": "", "site_lbl": "N1074", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "5", "chr_pos": "53083415", "evidence": [ { "id": "rs767693165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767693165" }, { "id": "rs767693165", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767693165" }, { "id": "rs767693165", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767693165" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "323", "site_seq": "AnHSGAVVLLK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "323", "site_seq": "ANHSGAVVLLKR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "YQTLnCSVNVNCVNIR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "YQTLNCSVNVNCVNIR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "LWnSTFLEEYSK", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "N", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "LWNSTFLEEYSK", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "2", "chr_pos": "172474130", "evidence": [ { "id": "rs1686060820", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686060820" }, { "id": "rs1686060820", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1686060820#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->YHS).", "chr_id": "2", "chr_pos": "172474129", "evidence": [ { "id": "rs371942298", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371942298" }, { "id": "rs371942298", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371942298" }, { "id": "rs371942298", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371942298#frequency_tab" }, { "id": "rs371942298", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371942298" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "", "site_lbl": "N966", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "2", "chr_pos": "172491222", "evidence": [ { "id": "rs111722287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs111722287" }, { "id": "rs111722287", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs111722287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "", "site_lbl": "N997", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "172491316", "evidence": [ { "id": "rs771270575", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771270575" }, { "id": "rs771270575", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771270575#frequency_tab" }, { "id": "rs771270575", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771270575" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "2", "chr_pos": "172491315", "evidence": [ { "id": "rs113510867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113510867" }, { "id": "rs113510867", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs113510867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1408", "url": "https://glyconnect.expasy.org/browser/proteins/1408" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "391", "site_seq": "STFInMTR", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "391", "site_seq": "N", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "391", "site_seq": "STFINMTR", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "945", "site_seq": "ENQnHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "SLLWTETFMNKENQnHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "N", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "ENQNHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "", "site_lbl": "N945", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->SHS); n-glyco-sequon-gain (NQN->NQS).", "chr_id": "2", "chr_pos": "186675833", "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P06756" }, { "id": "rs200733186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200733186" }, { "id": "rs200733186", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200733186" }, { "id": "rs200733186", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200733186" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "347", "site_seq": "nFTALIPGTTVEILDGDSK", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "347", "site_seq": "N", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "347", "site_seq": "NFTALIPGTTVEILDGDSK", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCnCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "N", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCNCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "347", "site_seq": "", "site_lbl": "N347", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "3", "chr_pos": "124817709", "evidence": [ { "id": "rs2107551944", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2107551944" }, { "id": "rs2107551944", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2107551944" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "", "site_lbl": "N586", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "3", "chr_pos": "124773850", "evidence": [ { "id": "rs1327646822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327646822" }, { "id": "rs1327646822", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1327646822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1418", "url": "https://glyconnect.expasy.org/browser/proteins/1418" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "463", "site_seq": "EVEVnSSK", "site_lbl": "Asn463", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18564-1", "start_pos": 463, "end_pos": 463, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1419", "url": "https://glyconnect.expasy.org/browser/proteins/1419" } ], "protein_name": "Integrin beta-6", "gene_name": "ITGB6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 85936.0 } ] }, { "start_pos": "463", "site_seq": "N", "site_lbl": "Asn463", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18564-1", "start_pos": 463, "end_pos": 463, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1419", "url": "https://glyconnect.expasy.org/browser/proteins/1419" } ], "protein_name": "Integrin beta-6", "gene_name": "ITGB6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 85936.0 } ] }, { "start_pos": "463", "site_seq": "", "site_lbl": "N463", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "2", "chr_pos": "160137707", "evidence": [ { "id": "rs1437561442", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1437561442" }, { "id": "rs1437561442", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1437561442#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18564-1", "start_pos": 463, "end_pos": 463, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1419", "url": "https://glyconnect.expasy.org/browser/proteins/1419" } ], "protein_name": "Integrin beta-6", "gene_name": "ITGB6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 85936.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y624-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1427", "url": "https://glyconnect.expasy.org/browser/proteins/1427" } ], "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 299, "chemical_mass": 32583.0 } ] }, { "start_pos": "185", "site_seq": "AFSNSSYVLNPTTGELVFDPLSASDTGEYSCEAR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y624-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1427", "url": "https://glyconnect.expasy.org/browser/proteins/1427" } ], "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 299, "chemical_mass": 32583.0 } ] }, { "start_pos": "185", "site_seq": "", "site_lbl": "N185", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "161000183", "evidence": [ { "id": "Q9Y624", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y624" }, { "id": "rs574502480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs574502480" }, { "id": "rs574502480", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs574502480" }, { "id": "rs574502480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs574502480#frequency_tab" }, { "id": "rs574502480", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs574502480" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y624-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1427", "url": "https://glyconnect.expasy.org/browser/proteins/1427" } ], "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 299, "chemical_mass": 32583.0 } ] }, { "start_pos": "302", "site_seq": "N", "site_lbl": "Asn302", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW63-1", "start_pos": 302, "end_pos": 302, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1430", "url": "https://glyconnect.expasy.org/browser/proteins/1430" } ], "protein_name": "Protein O-glucosyltransferase 2", "gene_name": "POGLUT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 58043.0 } ] }, { "start_pos": "302", "site_seq": "NSTAVWR", "site_lbl": "Asn302", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW63-1", "start_pos": 302, "end_pos": 302, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1430", "url": "https://glyconnect.expasy.org/browser/proteins/1430" } ], "protein_name": "Protein O-glucosyltransferase 2", "gene_name": "POGLUT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 58043.0 } ] }, { "start_pos": "302", "site_seq": "", "site_lbl": "N302", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "13", "chr_pos": "102791080", "evidence": [ { "id": "Q6UW63", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6UW63" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "13", "chr_pos": "102791079", "evidence": [ { "id": "rs746060607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746060607" }, { "id": "rs746060607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746060607" }, { "id": "rs746060607", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746060607#frequency_tab" }, { "id": "rs746060607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746060607" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "13", "chr_pos": "102791079", "evidence": [ { "id": "rs746060607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746060607" }, { "id": "rs746060607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746060607" }, { "id": "rs746060607", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746060607#frequency_tab" }, { "id": "rs746060607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746060607" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UW63-1", "start_pos": 302, "end_pos": 302, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1430", "url": "https://glyconnect.expasy.org/browser/proteins/1430" } ], "protein_name": "Protein O-glucosyltransferase 2", "gene_name": "POGLUT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 58043.0 } ] }, { "start_pos": "306", "site_seq": "N", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z4H8-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1431", "url": "https://glyconnect.expasy.org/browser/proteins/1431" } ], "protein_name": "Protein O-glucosyltransferase 3", "gene_name": "POGLUT3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 507, "chemical_mass": 58572.0 } ] }, { "start_pos": "306", "site_seq": "GVTNDLLSIQGNTGPSWINKTER", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z4H8-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1431", "url": "https://glyconnect.expasy.org/browser/proteins/1431" } ], "protein_name": "Protein O-glucosyltransferase 3", "gene_name": "POGLUT3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 507, "chemical_mass": 58572.0 } ] }, { "start_pos": "306", "site_seq": "", "site_lbl": "N306", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "108481361", "evidence": [ { "id": "rs1401007749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401007749" }, { "id": "rs1401007749", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1401007749#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z4H8-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1431", "url": "https://glyconnect.expasy.org/browser/proteins/1431" } ], "protein_name": "Protein O-glucosyltransferase 3", "gene_name": "POGLUT3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 507, "chemical_mass": 58572.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60938-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1432", "url": "https://glyconnect.expasy.org/browser/proteins/1432" } ], "protein_name": "Keratocan", "gene_name": "KERA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 40509.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "12", "chr_pos": "91055781", "evidence": [ { "id": "rs1446588427", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1446588427" }, { "id": "rs1446588427", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1446588427" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60938-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1432", "url": "https://glyconnect.expasy.org/browser/proteins/1432" } ], "protein_name": "Keratocan", "gene_name": "KERA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 40509.0 } ] }, { "start_pos": "238", "site_seq": "nNSIPDK", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1437", "url": "https://glyconnect.expasy.org/browser/proteins/1437" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1437", "url": "https://glyconnect.expasy.org/browser/proteins/1437" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "238", "site_seq": "NNSIPDK", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1437", "url": "https://glyconnect.expasy.org/browser/proteins/1437" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "238", "site_seq": "", "site_lbl": "N238", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "15", "chr_pos": "88901708", "evidence": [ { "id": "rs1898442973", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1898442973" }, { "id": "rs1898442973", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1898442973#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1437", "url": "https://glyconnect.expasy.org/browser/proteins/1437" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "677", "site_seq": "GTnYTVR", "site_lbl": "Asn677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 677, "end_pos": 677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "677", "site_seq": "N", "site_lbl": "Asn677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 677, "end_pos": 677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "677", "site_seq": "GTNYTVR", "site_lbl": "Asn677", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 677, "end_pos": 677, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "134", "site_seq": "LCQGLGLnLTK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RQ9-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1446", "url": "https://glyconnect.expasy.org/browser/proteins/1446" } ], "protein_name": "L-amino-acid oxidase", "gene_name": "IL4I1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62881.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RQ9-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1446", "url": "https://glyconnect.expasy.org/browser/proteins/1446" } ], "protein_name": "L-amino-acid oxidase", "gene_name": "IL4I1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62881.0 } ] }, { "start_pos": "134", "site_seq": "LCQGLGLNLTK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RQ9-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1446", "url": "https://glyconnect.expasy.org/browser/proteins/1446" } ], "protein_name": "L-amino-acid oxidase", "gene_name": "IL4I1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62881.0 } ] }, { "start_pos": "134", "site_seq": "", "site_lbl": "N134", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "19", "chr_pos": "49894435", "evidence": [ { "id": "rs1279274410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1279274410" }, { "id": "rs1279274410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1279274410" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "49894433", "evidence": [ { "id": "rs967937148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs967937148" }, { "id": "rs967937148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs967937148#frequency_tab" }, { "id": "rs967937148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs967937148" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "19", "chr_pos": "49894434", "evidence": [ { "id": "rs539656065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs539656065" }, { "id": "rs539656065", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs539656065" }, { "id": "rs539656065", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs539656065" }, { "id": "rs539656065", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs539656065" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96RQ9-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1446", "url": "https://glyconnect.expasy.org/browser/proteins/1446" } ], "protein_name": "L-amino-acid oxidase", "gene_name": "IL4I1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62881.0 } ] }, { "start_pos": "167", "site_seq": "DLnETIHYMYK", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1449", "url": "https://glyconnect.expasy.org/browser/proteins/1449" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1449", "url": "https://glyconnect.expasy.org/browser/proteins/1449" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "DLNETIHYMYK", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1449", "url": "https://glyconnect.expasy.org/browser/proteins/1449" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "14", "chr_pos": "92713865", "evidence": [ { "id": "rs1303621486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1303621486" }, { "id": "rs1303621486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1303621486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1449", "url": "https://glyconnect.expasy.org/browser/proteins/1449" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "73", "site_seq": "GRDIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1456", "url": "https://glyconnect.expasy.org/browser/proteins/1456" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "N", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1456", "url": "https://glyconnect.expasy.org/browser/proteins/1456" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "DIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1456", "url": "https://glyconnect.expasy.org/browser/proteins/1456" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "", "site_lbl": "N73", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->TKS).", "chr_id": "3", "chr_pos": "108080173", "evidence": [ { "id": "rs2108266168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108266168" }, { "id": "rs2108266168", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108266168" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1456", "url": "https://glyconnect.expasy.org/browser/proteins/1456" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "616", "site_seq": "N", "site_lbl": "Asn616", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BU23-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1457", "url": "https://glyconnect.expasy.org/browser/proteins/1457" } ], "protein_name": "Lipase maturation factor 2", "gene_name": "LMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 79698.0 } ] }, { "start_pos": "616", "site_seq": "SANSTLAQALHWTR", "site_lbl": "Asn616", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BU23-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1457", "url": "https://glyconnect.expasy.org/browser/proteins/1457" } ], "protein_name": "Lipase maturation factor 2", "gene_name": "LMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 79698.0 } ] }, { "start_pos": "616", "site_seq": "SAnSTLAQALHWTR", "site_lbl": "Asn616", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BU23-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1457", "url": "https://glyconnect.expasy.org/browser/proteins/1457" } ], "protein_name": "Lipase maturation factor 2", "gene_name": "LMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 79698.0 } ] }, { "start_pos": "616", "site_seq": "", "site_lbl": "N616", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "22", "chr_pos": "50503668", "evidence": [ { "id": "rs143566943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143566943" }, { "id": "rs143566943", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143566943" }, { "id": "rs143566943", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143566943#frequency_tab" }, { "id": "rs143566943", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143566943" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "22", "chr_pos": "50503668", "evidence": [ { "id": "rs143566943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143566943" }, { "id": "rs143566943", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143566943" }, { "id": "rs143566943", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143566943#frequency_tab" }, { "id": "rs143566943", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143566943" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BU23-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1457", "url": "https://glyconnect.expasy.org/browser/proteins/1457" } ], "protein_name": "Lipase maturation factor 2", "gene_name": "LMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 79698.0 } ] }, { "start_pos": "1983", "site_seq": "N", "site_lbl": "Asn1983", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZR2-1", "start_pos": 1983, "end_pos": 1983, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1466", "url": "https://glyconnect.expasy.org/browser/proteins/1466" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "LRP1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4599, "chemical_mass": 515498.0 } ] }, { "start_pos": "1983", "site_seq": "", "site_lbl": "N1983", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "2", "chr_pos": "140716048", "evidence": [ { "id": "rs750818136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750818136" }, { "id": "rs750818136", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750818136" }, { "id": "rs750818136", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750818136#frequency_tab" }, { "id": "rs750818136", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750818136" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "2", "chr_pos": "140716047", "evidence": [ { "id": "rs1687198473", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1687198473" }, { "id": "rs1687198473", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1687198473" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "2", "chr_pos": "140716048", "evidence": [ { "id": "Q9NZR2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NZR2" }, { "id": "rs750818136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750818136" }, { "id": "rs750818136", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750818136" }, { "id": "rs750818136", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750818136#frequency_tab" }, { "id": "rs750818136", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750818136" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZR2-1", "start_pos": 1983, "end_pos": 1983, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1466", "url": "https://glyconnect.expasy.org/browser/proteins/1466" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "LRP1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4599, "chemical_mass": 515498.0 } ] }, { "start_pos": "161", "site_seq": "YDLPASINFILnK", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1475", "url": "https://glyconnect.expasy.org/browser/proteins/1475" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "N", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1475", "url": "https://glyconnect.expasy.org/browser/proteins/1475" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "YDLPASINFILNK", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1475", "url": "https://glyconnect.expasy.org/browser/proteins/1475" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "", "site_lbl": "N161", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "10", "chr_pos": "89226952", "evidence": [ { "id": "rs1842777596", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842777596" }, { "id": "rs1842777596", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1842777596" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "89226952", "evidence": [ { "id": "rs762559980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762559980" }, { "id": "21963785", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21963785" } ], "disease": [ { "disease_id": "DOID:0080217", "name": "lysosomal acid lipase deficiency", "description": "A lipid storage disease characterized by dyslipidemia and accumulation of cholesteryl esters and triglycerides within various organs that has_material_basis_in homozygous or compound heterozygous mutation in the LIPA gene on chromosome 10q23.31.", "url": "http://disease-ontology.org/term/DOID:0080217", "evidence": [ { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" }, { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" } ] }, { "disease_id": "DOID:0080217", "name": "lysosomal acid lipase deficiency", "description": "A lipid storage disease characterized by dyslipidemia and accumulation of cholesteryl esters and triglycerides within various organs that has_material_basis_in homozygous or compound heterozygous mutation in the LIPA gene on chromosome 10q23.31.", "url": "http://disease-ontology.org/term/DOID:0080217", "evidence": [ { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" }, { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" } ] }, { "disease_id": "DOID:14502", "name": "cholesterol ester storage disease", "description": "A lysosomal acid lipase deficiency characterized by onset in childhood or later of progressive accumulation of cholesteryl esters and triglycerides primarily in the liver and spleen.", "url": "http://disease-ontology.org/term/DOID:14502", "evidence": [ { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" }, { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" } ] }, { "disease_id": "DOID:14502", "name": "cholesterol ester storage disease", "description": "A lysosomal acid lipase deficiency characterized by onset in childhood or later of progressive accumulation of cholesteryl esters and triglycerides primarily in the liver and spleen.", "url": "http://disease-ontology.org/term/DOID:14502", "evidence": [ { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" }, { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" } ] }, { "disease_id": "DOID:14497", "name": "Wolman disease", "description": "A lysosomal acid lipase deficiency characterized by infantile onset of rapidly progressive accumulation of cholesteryl esters and triglycerides throughout the body, resulting in hepatosplenomegaly, severe malnutrition, jaundice, vomiting, diarrhea, steatorrhea. Death usually occurs within the first year of life.", "url": "http://disease-ontology.org/term/DOID:14497", "evidence": [ { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" }, { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" } ] }, { "disease_id": "DOID:14497", "name": "Wolman disease", "description": "A lysosomal acid lipase deficiency characterized by infantile onset of rapidly progressive accumulation of cholesteryl esters and triglycerides throughout the body, resulting in hepatosplenomegaly, severe malnutrition, jaundice, vomiting, diarrhea, steatorrhea. Death usually occurs within the first year of life.", "url": "http://disease-ontology.org/term/DOID:14497", "evidence": [ { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" }, { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1475", "url": "https://glyconnect.expasy.org/browser/proteins/1475" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "167", "site_seq": "YEQLQnETR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1476", "url": "https://glyconnect.expasy.org/browser/proteins/1476" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1476", "url": "https://glyconnect.expasy.org/browser/proteins/1476" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "167", "site_seq": "YEQLQnETRQTPEYQNESSR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1476", "url": "https://glyconnect.expasy.org/browser/proteins/1476" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "47245523", "evidence": [ { "id": "P11117", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11117" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1476", "url": "https://glyconnect.expasy.org/browser/proteins/1476" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "333", "site_seq": "MDPPCTnTTAASTYLNNPYVR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "333", "site_seq": "VRMDPPCTnTTAASTYLNNPYVR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "333", "site_seq": "MDPPCTNTTAASTYLNNPYVR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "45892473", "evidence": [ { "id": "rs1256294756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256294756" }, { "id": "rs1256294756", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256294756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "20", "chr_pos": "45895042", "evidence": [ { "id": "rs112880409", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs112880409" }, { "id": "rs112880409", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs112880409" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "NC_000020.11", "chr_pos": "45895044", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "20", "chr_pos": "45895043", "evidence": [ { "id": "rs1350738725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1350738725" }, { "id": "rs1350738725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1350738725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1477", "url": "https://glyconnect.expasy.org/browser/proteins/1477" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "47", "site_seq": "nYSVLYFQQK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1478", "url": "https://glyconnect.expasy.org/browser/proteins/1478" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1478", "url": "https://glyconnect.expasy.org/browser/proteins/1478" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "47", "site_seq": "NYSVLYFQQK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1478", "url": "https://glyconnect.expasy.org/browser/proteins/1478" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "47", "site_seq": "", "site_lbl": "N47", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "11", "chr_pos": "82900263", "evidence": [ { "id": "rs150424357", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150424357" }, { "id": "rs150424357", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150424357" }, { "id": "rs150424357", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150424357" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "11", "chr_pos": "82900263", "evidence": [ { "id": "rs150424357", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150424357" }, { "id": "rs150424357", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150424357" }, { "id": "rs150424357", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150424357" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1478", "url": "https://glyconnect.expasy.org/browser/proteins/1478" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13296-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1486", "url": "https://glyconnect.expasy.org/browser/proteins/1486" } ], "protein_name": "Mammaglobin-A", "gene_name": "SCGB2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 93, "chemical_mass": 10499.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "11", "chr_pos": "62270983", "evidence": [ { "id": "rs772554381", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772554381" }, { "id": "rs772554381", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772554381" }, { "id": "rs772554381", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772554381#frequency_tab" }, { "id": "rs772554381", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772554381" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13296-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1486", "url": "https://glyconnect.expasy.org/browser/proteins/1486" } ], "protein_name": "Mammaglobin-A", "gene_name": "SCGB2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 93, "chemical_mass": 10499.0 } ] }, { "start_pos": "2203", "site_seq": "VFAnGTLVVK", "site_lbl": "Asn2203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2203, "end_pos": 2203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2203", "site_seq": "N", "site_lbl": "Asn2203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2203, "end_pos": 2203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "ITVHGnGSLDIR", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "N", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "", "site_lbl": "N2500", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "23", "chr_pos": "3310703", "evidence": [ { "id": "Q9NR99", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NR99" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "76", "site_seq": "N", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43356-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1497", "url": "https://glyconnect.expasy.org/browser/proteins/1497" } ], "protein_name": "Melanoma-associated antigen 2", "gene_name": "MAGEA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 35055.0 } ] }, { "start_pos": "246", "site_seq": "N", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "246", "site_seq": "LKVPESENnK", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "246", "site_seq": "VPESENNKTSNSSQVSNEQDK", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "250", "site_seq": "TSnSSQVSNEQDK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "250", "site_seq": "VPESENNKTSNSSQVSNEQDKIDAYK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "589", "site_seq": "IQQESLGSAPLMGDDHPnASR", "site_lbl": "Asn589", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 589, "end_pos": 589, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "589", "site_seq": "N", "site_lbl": "Asn589", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 589, "end_pos": 589, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "589", "site_seq": "IQQESLGSAPLMGDDHPNASR", "site_lbl": "Asn589", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 589, "end_pos": 589, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "246", "site_seq": "", "site_lbl": "N246", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->DKT).", "chr_id": "1", "chr_pos": "222627956", "evidence": [ { "id": "Q5JRA6", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q5JRA6" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "250", "site_seq": "", "site_lbl": "N250", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "222627969", "evidence": [ { "id": "rs1662196131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1662196131" }, { "id": "rs1662196131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1662196131#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "589", "site_seq": "", "site_lbl": "N589", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "1", "chr_pos": "222628985", "evidence": [ { "id": "rs61738963", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61738963" }, { "id": "rs61738963", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61738963" }, { "id": "rs61738963", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61738963" }, { "id": "rs61738963", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61738963#frequency_tab" }, { "id": "rs61738963", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61738963" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "1", "chr_pos": "222628987", "evidence": [ { "id": "rs773991416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773991416" }, { "id": "rs773991416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773991416" }, { "id": "rs773991416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773991416#frequency_tab" }, { "id": "rs773991416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773991416" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->YAS).", "chr_id": "1", "chr_pos": "222628985", "evidence": [ { "id": "Q5JRA6", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q5JRA6" }, { "id": "rs61738963", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61738963" }, { "id": "rs61738963", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61738963" }, { "id": "rs61738963", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61738963" }, { "id": "rs61738963", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61738963#frequency_tab" }, { "id": "rs61738963", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61738963" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5JRA6-1", "start_pos": 589, "end_pos": 589, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1498", "url": "https://glyconnect.expasy.org/browser/proteins/1498" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 213702.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1502", "url": "https://glyconnect.expasy.org/browser/proteins/1502" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "137", "site_seq": "QPQPnVSELVVGPLPHPSYMR", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1502", "url": "https://glyconnect.expasy.org/browser/proteins/1502" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "137", "site_seq": "", "site_lbl": "N137", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "17", "chr_pos": "42851754", "evidence": [ { "id": "rs755033067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755033067" }, { "id": "rs755033067", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755033067" }, { "id": "rs755033067", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755033067#frequency_tab" }, { "id": "rs755033067", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755033067" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "17", "chr_pos": "42851753", "evidence": [ { "id": "rs1381273400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1381273400" }, { "id": "rs1381273400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1381273400#frequency_tab" }, { "id": "rs1381273400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1381273400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1502", "url": "https://glyconnect.expasy.org/browser/proteins/1502" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "87", "site_seq": "RFnGSVSFFR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1512", "url": "https://glyconnect.expasy.org/browser/proteins/1512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "87", "site_seq": "N", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1512", "url": "https://glyconnect.expasy.org/browser/proteins/1512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "87", "site_seq": "FnGSVSFFR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1512", "url": "https://glyconnect.expasy.org/browser/proteins/1512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "87", "site_seq": "RFNGSVSFFR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1512", "url": "https://glyconnect.expasy.org/browser/proteins/1512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HC84-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1520", "url": "https://glyconnect.expasy.org/browser/proteins/1520" } ], "protein_name": "Mucin-5B", "gene_name": "MUC5B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5762, "chemical_mass": 596340.0 } ] }, { "start_pos": "254", "site_seq": "", "site_lbl": "N254", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "11", "chr_pos": "1227769", "evidence": [ { "id": "rs1410372784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410372784" }, { "id": "rs1410372784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410372784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HC84-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1520", "url": "https://glyconnect.expasy.org/browser/proteins/1520" } ], "protein_name": "Mucin-5B", "gene_name": "MUC5B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5762, "chemical_mass": 596340.0 } ] }, { "start_pos": "242", "site_seq": "nATALYHVEAFK", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UNW1-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1525", "url": "https://glyconnect.expasy.org/browser/proteins/1525" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "MINPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 55051.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UNW1-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1525", "url": "https://glyconnect.expasy.org/browser/proteins/1525" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "MINPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 55051.0 } ] }, { "start_pos": "242", "site_seq": "NATALYHVEAFK", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UNW1-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1525", "url": "https://glyconnect.expasy.org/browser/proteins/1525" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "MINPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 55051.0 } ] }, { "start_pos": "242", "site_seq": "", "site_lbl": "N242", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "87508423", "evidence": [ { "id": "Q9UNW1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UNW1" } ], "disease": [ { "disease_id": "DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary.", "url": "http://disease-ontology.org/term/DOID:2394", "evidence": [ { "id": "2394", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "10", "chr_pos": "87508423", "evidence": [ { "id": "Q9UNW1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UNW1" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UNW1-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1525", "url": "https://glyconnect.expasy.org/browser/proteins/1525" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "MINPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 55051.0 } ] }, { "start_pos": "118", "site_seq": "LQFDDnGTYTCQVK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60487-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1528", "url": "https://glyconnect.expasy.org/browser/proteins/1528" } ], "protein_name": "Myelin protein zero-like protein 2", "gene_name": "MPZL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24484.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60487-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1528", "url": "https://glyconnect.expasy.org/browser/proteins/1528" } ], "protein_name": "Myelin protein zero-like protein 2", "gene_name": "MPZL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24484.0 } ] }, { "start_pos": "118", "site_seq": "LQFDDNGTYTCQVK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60487-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1528", "url": "https://glyconnect.expasy.org/browser/proteins/1528" } ], "protein_name": "Myelin protein zero-like protein 2", "gene_name": "MPZL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24484.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "11", "chr_pos": "118262522", "evidence": [ { "id": "rs139437329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139437329" }, { "id": "rs139437329", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139437329" }, { "id": "rs139437329", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139437329" }, { "id": "rs139437329", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139437329#frequency_tab" }, { "id": "rs139437329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139437329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60487-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1528", "url": "https://glyconnect.expasy.org/browser/proteins/1528" } ], "protein_name": "Myelin protein zero-like protein 2", "gene_name": "MPZL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24484.0 } ] }, { "start_pos": "38", "site_seq": "nATEAAWR", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20933-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1530", "url": "https://glyconnect.expasy.org/browser/proteins/1530" } ], "protein_name": "N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase", "gene_name": "AGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 346, "chemical_mass": 37208.0 } ] }, { "start_pos": "38", "site_seq": "N", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20933-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1530", "url": "https://glyconnect.expasy.org/browser/proteins/1530" } ], "protein_name": "N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase", "gene_name": "AGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 346, "chemical_mass": 37208.0 } ] }, { "start_pos": "38", "site_seq": "NATEAAWR", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20933-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1530", "url": "https://glyconnect.expasy.org/browser/proteins/1530" } ], "protein_name": "N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase", "gene_name": "AGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 346, "chemical_mass": 37208.0 } ] }, { "start_pos": "38", "site_seq": "", "site_lbl": "N38", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "4", "chr_pos": "177442263", "evidence": [ { "id": "rs1737057087", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1737057087" }, { "id": "rs1737057087", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1737057087" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20933-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1530", "url": "https://glyconnect.expasy.org/browser/proteins/1530" } ], "protein_name": "N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase", "gene_name": "AGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 346, "chemical_mass": 37208.0 } ] }, { "start_pos": "204", "site_seq": "TGEANLTQIYLQEALDFIKR", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34059-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1531", "url": "https://glyconnect.expasy.org/browser/proteins/1531" } ], "protein_name": "N-acetylgalactosamine-6-sulfatase", "gene_name": "GALNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 58026.0 } ] }, { "start_pos": "204", "site_seq": "TGEAnLTQIYLQEALDFIK", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34059-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1531", "url": "https://glyconnect.expasy.org/browser/proteins/1531" } ], "protein_name": "N-acetylgalactosamine-6-sulfatase", "gene_name": "GALNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 58026.0 } ] }, { "start_pos": "204", "site_seq": "N", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34059-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1531", "url": "https://glyconnect.expasy.org/browser/proteins/1531" } ], "protein_name": "N-acetylgalactosamine-6-sulfatase", "gene_name": "GALNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 58026.0 } ] }, { "start_pos": "204", "site_seq": "", "site_lbl": "N204", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "16", "chr_pos": "88836223", "evidence": [ { "id": "rs569725936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs569725936" }, { "id": "rs569725936", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs569725936#frequency_tab" }, { "id": "rs569725936", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs569725936" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "16", "chr_pos": "88836222", "evidence": [ { "id": "rs118204435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs118204435" }, { "id": "rs118204435", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs118204435" }, { "id": "1522213", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1522213" } ], "disease": [ { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "88836223", "evidence": [ { "id": "rs569725936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs569725936" }, { "id": "rs569725936", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs569725936#frequency_tab" }, { "id": "rs569725936", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs569725936" } ], "disease": [ { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "88836223", "evidence": [ { "id": "rs569725936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs569725936" }, { "id": "rs569725936", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569725936" }, { "id": "rs569725936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs569725936#frequency_tab" }, { "id": "rs569725936", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs569725936" } ], "disease": [ { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] }, { "disease_id": "DOID:0111391", "name": "mucopolysaccharidosis IVA", "description": "A mucopolysaccharidosis IV characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate resulting in short stature, skeletal dysplasia, dental anomalies, and corneal clouding that has_material_basis_in homozygous or compound heterozygous mutation in the GALNS gene on chromosome 16q24.3.", "url": "http://disease-ontology.org/term/DOID:0111391", "evidence": [ { "id": "253000", "database": "MIM", "url": "https://www.omim.org/entry/253000" }, { "id": "2588", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2588#disease" }, { "id": "0111391", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111391" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P34059-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1531", "url": "https://glyconnect.expasy.org/browser/proteins/1531" } ], "protein_name": "N-acetylgalactosamine-6-sulfatase", "gene_name": "GALNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 522, "chemical_mass": 58026.0 } ] }, { "start_pos": "37", "site_seq": "FnVSLDSVPELR", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02083-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1534", "url": "https://glyconnect.expasy.org/browser/proteins/1534" } ], "protein_name": "N-acylethanolamine-hydrolyzing acid amidase", "gene_name": "NAAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 40066.0 } ] }, { "start_pos": "37", "site_seq": "N", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02083-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1534", "url": "https://glyconnect.expasy.org/browser/proteins/1534" } ], "protein_name": "N-acylethanolamine-hydrolyzing acid amidase", "gene_name": "NAAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 40066.0 } ] }, { "start_pos": "37", "site_seq": "FNVSLDSVPELR", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02083-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1534", "url": "https://glyconnect.expasy.org/browser/proteins/1534" } ], "protein_name": "N-acylethanolamine-hydrolyzing acid amidase", "gene_name": "NAAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 40066.0 } ] }, { "start_pos": "37", "site_seq": "", "site_lbl": "N37", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "4", "chr_pos": "75940839", "evidence": [ { "id": "rs751738837", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751738837" }, { "id": "rs751738837", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751738837" }, { "id": "rs751738837", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751738837#frequency_tab" }, { "id": "rs751738837", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751738837" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "4", "chr_pos": "75940840", "evidence": [ { "id": "rs757500227", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757500227" }, { "id": "rs757500227", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757500227" }, { "id": "rs757500227", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757500227" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "4", "chr_pos": "75940841", "evidence": [ { "id": "rs767841141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767841141" }, { "id": "rs767841141", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767841141" }, { "id": "rs767841141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767841141" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q02083-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1534", "url": "https://glyconnect.expasy.org/browser/proteins/1534" } ], "protein_name": "N-acylethanolamine-hydrolyzing acid amidase", "gene_name": "NAAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 40066.0 } ] }, { "start_pos": "474", "site_seq": "YnCTATNHIGTR", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15394-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1546", "url": "https://glyconnect.expasy.org/browser/proteins/1546" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "NCAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 837, "chemical_mass": 93046.0 } ] }, { "start_pos": "474", "site_seq": "N", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15394-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1546", "url": "https://glyconnect.expasy.org/browser/proteins/1546" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "NCAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 837, "chemical_mass": 93046.0 } ] }, { "start_pos": "474", "site_seq": "YNCTATNHIGTR", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15394-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1546", "url": "https://glyconnect.expasy.org/browser/proteins/1546" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "NCAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 837, "chemical_mass": 93046.0 } ] }, { "start_pos": "474", "site_seq": "", "site_lbl": "N474", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "21", "chr_pos": "21418509", "evidence": [ { "id": "O15394", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O15394" }, { "id": "rs994197393", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs994197393" }, { "id": "rs994197393", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs994197393#frequency_tab" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "21", "chr_pos": "21418509", "evidence": [ { "id": "rs994197393", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs994197393" }, { "id": "rs994197393", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs994197393#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15394-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1546", "url": "https://glyconnect.expasy.org/browser/proteins/1546" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "NCAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 837, "chemical_mass": 93046.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "19219206", "evidence": [ { "id": "O14594", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14594" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "446", "site_seq": "VILYnR", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O94856-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1552", "url": "https://glyconnect.expasy.org/browser/proteins/1552" } ], "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1347, "chemical_mass": 150027.0 } ] }, { "start_pos": "446", "site_seq": "N", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O94856-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1552", "url": "https://glyconnect.expasy.org/browser/proteins/1552" } ], "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1347, "chemical_mass": 150027.0 } ] }, { "start_pos": "197", "site_seq": "nASNMEYR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y639-2", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1558", "url": "https://glyconnect.expasy.org/browser/proteins/1558" } ], "protein_name": "Neuroplastin", "gene_name": "NPTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44387.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y639-2", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1558", "url": "https://glyconnect.expasy.org/browser/proteins/1558" } ], "protein_name": "Neuroplastin", "gene_name": "NPTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44387.0 } ] }, { "start_pos": "197", "site_seq": "KNASNMEYR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y639-2", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1558", "url": "https://glyconnect.expasy.org/browser/proteins/1558" } ], "protein_name": "Neuroplastin", "gene_name": "NPTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44387.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "15", "chr_pos": "73591987", "evidence": [ { "id": "rs1896609469", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1896609469" }, { "id": "rs1896609469", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1896609469" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y639-2", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1558", "url": "https://glyconnect.expasy.org/browser/proteins/1558" } ], "protein_name": "Neuroplastin", "gene_name": "NPTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44387.0 } ] }, { "start_pos": "212", "site_seq": "nITGTR", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15758-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1562", "url": "https://glyconnect.expasy.org/browser/proteins/1562" } ], "protein_name": "Neutral amino acid transporter B(0)", "gene_name": "SLC1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 56598.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15758-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1562", "url": "https://glyconnect.expasy.org/browser/proteins/1562" } ], "protein_name": "Neutral amino acid transporter B(0)", "gene_name": "SLC1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 56598.0 } ] }, { "start_pos": "212", "site_seq": "SYSTTYEERNITGTR", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15758-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1562", "url": "https://glyconnect.expasy.org/browser/proteins/1562" } ], "protein_name": "Neutral amino acid transporter B(0)", "gene_name": "SLC1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 56598.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "19", "chr_pos": "46784119", "evidence": [ { "id": "rs1568430436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1568430436" }, { "id": "rs1568430436", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1568430436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15758-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1562", "url": "https://glyconnect.expasy.org/browser/proteins/1562" } ], "protein_name": "Neutral amino acid transporter B(0)", "gene_name": "SLC1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 56598.0 } ] }, { "start_pos": "287", "site_seq": "LnWTSLLPASFTK", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PIU2-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1563", "url": "https://glyconnect.expasy.org/browser/proteins/1563" } ], "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "NCEH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 408, "chemical_mass": 45808.0 } ] }, { "start_pos": "287", "site_seq": "N", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PIU2-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1563", "url": "https://glyconnect.expasy.org/browser/proteins/1563" } ], "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "NCEH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 408, "chemical_mass": 45808.0 } ] }, { "start_pos": "287", "site_seq": "LNWTSLLPASFTK", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PIU2-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1563", "url": "https://glyconnect.expasy.org/browser/proteins/1563" } ], "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "NCEH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 408, "chemical_mass": 45808.0 } ] }, { "start_pos": "506", "site_seq": "ALYELAGGTnFSDTVQADPQTVTR", "site_lbl": "Asn506", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 506, "end_pos": 506, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1567", "url": "https://glyconnect.expasy.org/browser/proteins/1567" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "506", "site_seq": "N", "site_lbl": "Asn506", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 506, "end_pos": 506, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1567", "url": "https://glyconnect.expasy.org/browser/proteins/1567" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "506", "site_seq": "ALYELAGGTNFSDTVQADPQTVTR", "site_lbl": "Asn506", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 506, "end_pos": 506, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1567", "url": "https://glyconnect.expasy.org/browser/proteins/1567" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "369", "site_seq": "N", "site_lbl": "Asn369", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15155-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1572", "url": "https://glyconnect.expasy.org/browser/proteins/1572" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "NOMO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134324.0 } ] }, { "start_pos": "618", "site_seq": "N", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15155-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1572", "url": "https://glyconnect.expasy.org/browser/proteins/1572" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "NOMO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134324.0 } ] }, { "start_pos": "369", "site_seq": "", "site_lbl": "N369", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "14857541", "evidence": [ { "id": "rs1963860165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1963860165" }, { "id": "rs1963860165", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1963860165#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15155-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1572", "url": "https://glyconnect.expasy.org/browser/proteins/1572" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "NOMO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134324.0 } ] }, { "start_pos": "369", "site_seq": "N", "site_lbl": "Asn369", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JPE7-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1573", "url": "https://glyconnect.expasy.org/browser/proteins/1573" } ], "protein_name": "BOS complex subunit NOMO2", "gene_name": "NOMO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1267, "chemical_mass": 139439.0 } ] }, { "start_pos": "618", "site_seq": "N", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JPE7-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1573", "url": "https://glyconnect.expasy.org/browser/proteins/1573" } ], "protein_name": "BOS complex subunit NOMO2", "gene_name": "NOMO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1267, "chemical_mass": 139439.0 } ] }, { "start_pos": "369", "site_seq": "N", "site_lbl": "Asn369", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P69849-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1574", "url": "https://glyconnect.expasy.org/browser/proteins/1574" } ], "protein_name": "BOS complex subunit NOMO3", "gene_name": "NOMO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134134.0 } ] }, { "start_pos": "369", "site_seq": "LENITTGTYTIHAQK", "site_lbl": "Asn369", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P69849-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1574", "url": "https://glyconnect.expasy.org/browser/proteins/1574" } ], "protein_name": "BOS complex subunit NOMO3", "gene_name": "NOMO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134134.0 } ] }, { "start_pos": "618", "site_seq": "N", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P69849-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1574", "url": "https://glyconnect.expasy.org/browser/proteins/1574" } ], "protein_name": "BOS complex subunit NOMO3", "gene_name": "NOMO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134134.0 } ] }, { "start_pos": "618", "site_seq": "ENVGIYNLSK", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P69849-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1574", "url": "https://glyconnect.expasy.org/browser/proteins/1574" } ], "protein_name": "BOS complex subunit NOMO3", "gene_name": "NOMO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134134.0 } ] }, { "start_pos": "369", "site_seq": "", "site_lbl": "N369", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "16", "chr_pos": "16256043", "evidence": [ { "id": "rs1338405178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338405178" }, { "id": "rs1338405178", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1338405178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P69849-1", "start_pos": 369, "end_pos": 369, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1574", "url": "https://glyconnect.expasy.org/browser/proteins/1574" } ], "protein_name": "BOS complex subunit NOMO3", "gene_name": "NOMO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1222, "chemical_mass": 134134.0 } ] }, { "start_pos": "1441", "site_seq": "N", "site_lbl": "Asn1441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "1441", "site_seq": "GPTnNTCVVR", "site_lbl": "Asn1441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "1441", "site_seq": "GPTNNTCVVR", "site_lbl": "Asn1441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "926", "site_seq": "EGSGYFFLnTSTADVVK", "site_lbl": "Asn926", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 926, "end_pos": 926, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "926", "site_seq": "N", "site_lbl": "Asn926", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 926, "end_pos": 926, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "926", "site_seq": "IREGSGYFFLnTSTADVVK", "site_lbl": "Asn926", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 926, "end_pos": 926, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "926", "site_seq": "EGSGYFFLNTSTADVVK", "site_lbl": "Asn926", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 926, "end_pos": 926, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "1441", "site_seq": "", "site_lbl": "N1441", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "3", "chr_pos": "13327402", "evidence": [ { "id": "rs779187790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779187790" }, { "id": "rs779187790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779187790" }, { "id": "rs779187790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779187790#frequency_tab" }, { "id": "rs779187790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779187790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1579", "url": "https://glyconnect.expasy.org/browser/proteins/1579" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "193", "site_seq": "FnSSSSSLEEK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1581", "url": "https://glyconnect.expasy.org/browser/proteins/1581" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "N", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1581", "url": "https://glyconnect.expasy.org/browser/proteins/1581" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "FNSSSSSLEEK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1581", "url": "https://glyconnect.expasy.org/browser/proteins/1581" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "", "site_lbl": "N193", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "5", "chr_pos": "139026868", "evidence": [ { "id": "rs761754008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761754008" }, { "id": "rs761754008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761754008" }, { "id": "rs761754008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761754008#frequency_tab" }, { "id": "rs761754008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761754008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1581", "url": "https://glyconnect.expasy.org/browser/proteins/1581" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "216", "site_seq": "nYSEVCK", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1589", "url": "https://glyconnect.expasy.org/browser/proteins/1589" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "216", "site_seq": "N", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1589", "url": "https://glyconnect.expasy.org/browser/proteins/1589" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "216", "site_seq": "NYSEVCK", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1589", "url": "https://glyconnect.expasy.org/browser/proteins/1589" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "216", "site_seq": "", "site_lbl": "N216", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "6", "chr_pos": "108051168", "evidence": [ { "id": "Q86WC4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86WC4" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "6", "chr_pos": "108051166", "evidence": [ { "id": "Q86WC4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86WC4" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "6", "chr_pos": "108051167", "evidence": [ { "id": "rs1772067241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1772067241" }, { "id": "rs1772067241", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1772067241#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "6", "chr_pos": "108051167", "evidence": [ { "id": "Q86WC4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86WC4" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1589", "url": "https://glyconnect.expasy.org/browser/proteins/1589" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GINESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->IHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "1", "chr_pos": "40078651", "evidence": [ { "id": "rs568730410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs568730410" }, { "id": "rs568730410", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs568730410#frequency_tab" }, { "id": "rs568730410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs568730410" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->YES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "1", "chr_pos": "40078590", "evidence": [ { "id": "rs746776515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746776515" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "1", "chr_pos": "40078591", "evidence": [ { "id": "rs768490419", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768490419#frequency_tab" }, { "id": "rs768490419", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768490419" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "NC_000001.11", "chr_pos": "40078591", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "190", "site_seq": "PLTNCSIINSGK", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P45877-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1596", "url": "https://glyconnect.expasy.org/browser/proteins/1596" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase C", "gene_name": "PPIC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 212, "chemical_mass": 22763.0 } ] }, { "start_pos": "190", "site_seq": "N", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P45877-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1596", "url": "https://glyconnect.expasy.org/browser/proteins/1596" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase C", "gene_name": "PPIC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 212, "chemical_mass": 22763.0 } ] }, { "start_pos": "190", "site_seq": "", "site_lbl": "N190", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "5", "chr_pos": "123023946", "evidence": [ { "id": "rs137956160", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137956160" }, { "id": "rs137956160", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137956160" }, { "id": "rs137956160", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137956160#frequency_tab" }, { "id": "rs137956160", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137956160" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "5", "chr_pos": "123023945", "evidence": [ { "id": "rs451195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs451195" }, { "id": "rs451195", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs451195" }, { "id": "rs451195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs451195" }, { "id": "rs451195", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs451195#frequency_tab" }, { "id": "rs451195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs451195" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "5", "chr_pos": "123023944", "evidence": [ { "id": "rs1202781656", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1202781656" }, { "id": "rs1202781656", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1202781656" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "5", "chr_pos": "123023945", "evidence": [ { "id": "P45877", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P45877" }, { "id": "rs451195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs451195" }, { "id": "rs451195", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs451195" }, { "id": "rs451195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs451195" }, { "id": "rs451195", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs451195#frequency_tab" }, { "id": "rs451195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs451195" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P45877-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1596", "url": "https://glyconnect.expasy.org/browser/proteins/1596" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase C", "gene_name": "PPIC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 212, "chemical_mass": 22763.0 } ] }, { "start_pos": "310", "site_seq": "nHTYNTYIGQGYIIPGMDQGLQGACMGER", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "310", "site_seq": "N", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "393", "site_seq": "TLSRPSETCnETTK", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "393", "site_seq": "N", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "393", "site_seq": "TLSRPSETCNETTK", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "407", "site_seq": "N", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "407", "site_seq": "YHYNCSLLDGTQLFTSHDYGAPQEATLGANK", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "YHYnGTFEDGK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "EVQMGDFVRYHYnGTFEDGK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "407", "site_seq": "", "site_lbl": "N407", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "17", "chr_pos": "41820425", "evidence": [ { "id": "rs375797828", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375797828" }, { "id": "rs375797828", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375797828" }, { "id": "rs375797828", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375797828#frequency_tab" }, { "id": "rs375797828", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375797828" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "17", "chr_pos": "41813244", "evidence": [ { "id": "rs373594621", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373594621" }, { "id": "rs373594621", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373594621" }, { "id": "rs373594621", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373594621#frequency_tab" }, { "id": "rs373594621", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373594621" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "17", "chr_pos": "41813243", "evidence": [ { "id": "rs145424241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145424241" }, { "id": "rs145424241", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145424241" }, { "id": "rs145424241", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145424241" }, { "id": "rs145424241", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145424241#frequency_tab" }, { "id": "rs145424241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145424241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1597", "url": "https://glyconnect.expasy.org/browser/proteins/1597" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "174", "site_seq": "YHYnGTFLDGTLFDSSHNR", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "397", "site_seq": "YHYnASLLDGTLLDSTWNLGK", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "397", "site_seq": "YHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "174", "site_seq": "", "site_lbl": "N174", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "7", "chr_pos": "32975335", "evidence": [ { "id": "O95302", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95302" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "7", "chr_pos": "32996313", "evidence": [ { "id": "rs1413257423", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413257423" }, { "id": "rs1413257423", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1413257423#frequency_tab" }, { "id": "rs1413257423", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1413257423" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1598", "url": "https://glyconnect.expasy.org/browser/proteins/1598" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "1280", "site_seq": "ILCDNADnITR", "site_lbl": "Asn1280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1280, "end_pos": 1280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1280", "site_seq": "N", "site_lbl": "Asn1280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1280, "end_pos": 1280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1280", "site_seq": "ILCDNADNITR", "site_lbl": "Asn1280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1280, "end_pos": 1280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1425", "site_seq": "N", "site_lbl": "Asn1425", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1425, "end_pos": 1425, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1425", "site_seq": "LSTTECVDAGGESHAnNTK", "site_lbl": "Asn1425", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1425, "end_pos": 1425, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1425", "site_seq": "LSTTECVDAGGESHANNTK", "site_lbl": "Asn1425", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1425, "end_pos": 1425, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1280", "site_seq": "", "site_lbl": "N1280", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "2", "chr_pos": "1643482", "evidence": [ { "id": "rs774542319", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774542319" }, { "id": "rs774542319", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774542319" }, { "id": "rs774542319", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774542319" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "2", "chr_pos": "1643481", "evidence": [ { "id": "rs1463639532", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1463639532" }, { "id": "rs1463639532", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1463639532" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "2", "chr_pos": "1643482", "evidence": [ { "id": "rs774542319", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774542319" }, { "id": "rs774542319", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774542319" }, { "id": "rs774542319", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774542319" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1280, "end_pos": 1280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1425", "site_seq": "", "site_lbl": "N1425", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "1635455", "evidence": [ { "id": "rs1157313938", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1157313938" }, { "id": "rs1157313938", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1157313938#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "1635454", "evidence": [ { "id": "rs1335361048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335361048" }, { "id": "rs1335361048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1335361048" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1425, "end_pos": 1425, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1600", "url": "https://glyconnect.expasy.org/browser/proteins/1600" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "411", "site_seq": "N", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "411", "site_seq": "IYnWSGYPLLVQK", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "71", "site_seq": "NGDAYGFYnNSVK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "411", "site_seq": "", "site_lbl": "N411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "12", "chr_pos": "14507072", "evidence": [ { "id": "rs1419270468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1419270468" }, { "id": "rs1419270468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1419270468#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->SWS).", "chr_id": "12", "chr_pos": "14507073", "evidence": [ { "id": "rs1945262306", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1945262306" }, { "id": "rs1945262306", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1945262306" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "12", "chr_pos": "14553317", "evidence": [ { "id": "rs1162827704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1162827704" }, { "id": "rs1162827704", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1162827704#frequency_tab" }, { "id": "rs1162827704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1162827704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "12", "chr_pos": "14553316", "evidence": [ { "id": "rs376848008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376848008" }, { "id": "rs376848008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376848008" }, { "id": "rs376848008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376848008#frequency_tab" }, { "id": "rs376848008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376848008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1603", "url": "https://glyconnect.expasy.org/browser/proteins/1603" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "284", "site_seq": "N", "site_lbl": "Asn284", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IV08-1", "start_pos": 284, "end_pos": 284, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1604", "url": "https://glyconnect.expasy.org/browser/proteins/1604" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "PLD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 54705.0 } ] }, { "start_pos": "284", "site_seq": "", "site_lbl": "N284", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "40371845", "evidence": [ { "id": "rs200274020", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200274020" }, { "id": "rs200274020", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200274020" }, { "id": "rs200274020", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200274020" }, { "id": "rs200274020", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200274020#frequency_tab" }, { "id": "rs200274020", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200274020" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IV08-1", "start_pos": 284, "end_pos": 284, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1604", "url": "https://glyconnect.expasy.org/browser/proteins/1604" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "PLD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 54705.0 } ] }, { "start_pos": "54", "site_seq": "nVSCLWCNTNK", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1607", "url": "https://glyconnect.expasy.org/browser/proteins/1607" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "54", "site_seq": "N", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1607", "url": "https://glyconnect.expasy.org/browser/proteins/1607" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "54", "site_seq": "", "site_lbl": "N54", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "21", "chr_pos": "44865401", "evidence": [ { "id": "rs372701822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372701822" }, { "id": "rs372701822", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372701822" }, { "id": "rs372701822", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372701822#frequency_tab" }, { "id": "rs372701822", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372701822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1607", "url": "https://glyconnect.expasy.org/browser/proteins/1607" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSRR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQNMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "759", "site_seq": "LHVTLYnCSFGR", "site_lbl": "Asn759", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 759, "end_pos": 759, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "759", "site_seq": "N", "site_lbl": "Asn759", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 759, "end_pos": 759, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "759", "site_seq": "LHVTLYNCSFGR", "site_lbl": "Asn759", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 759, "end_pos": 759, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "22", "chr_pos": "50287693", "evidence": [ { "id": "rs920837059", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs920837059" }, { "id": "rs920837059", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs920837059" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "759", "site_seq": "", "site_lbl": "N759", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "22", "chr_pos": "50283979", "evidence": [ { "id": "O15031", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O15031" }, { "id": "rs79966207", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79966207" }, { "id": "rs79966207", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs79966207" }, { "id": "rs79966207", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79966207" }, { "id": "rs79966207", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs79966207#frequency_tab" }, { "id": "rs79966207", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs79966207" }, { "id": "rs79966207", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs79966207" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "22", "chr_pos": "50283978", "evidence": [ { "id": "rs772506820", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772506820" }, { "id": "rs772506820", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772506820" }, { "id": "rs772506820", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772506820" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 759, "end_pos": 759, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "40", "site_seq": "DCVLQCEEQnCSGGALNHFR", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96FM1-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1621", "url": "https://glyconnect.expasy.org/browser/proteins/1621" } ], "protein_name": "GPI-specific phospholipase A2-like PGAP3", "gene_name": "PGAP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 320, "chemical_mass": 36475.0 } ] }, { "start_pos": "40", "site_seq": "N", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96FM1-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1621", "url": "https://glyconnect.expasy.org/browser/proteins/1621" } ], "protein_name": "GPI-specific phospholipase A2-like PGAP3", "gene_name": "PGAP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 320, "chemical_mass": 36475.0 } ] }, { "start_pos": "40", "site_seq": "DCVLQCEEQNCSGGALNHFR", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96FM1-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1621", "url": "https://glyconnect.expasy.org/browser/proteins/1621" } ], "protein_name": "GPI-specific phospholipase A2-like PGAP3", "gene_name": "PGAP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 320, "chemical_mass": 36475.0 } ] }, { "start_pos": "40", "site_seq": "", "site_lbl": "N40", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "17", "chr_pos": "39687895", "evidence": [ { "id": "rs373850048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373850048" }, { "id": "rs373850048", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373850048" }, { "id": "rs373850048", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373850048#frequency_tab" }, { "id": "rs373850048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373850048" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "17", "chr_pos": "39687896", "evidence": [ { "id": "rs1205331684", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1205331684" }, { "id": "rs1205331684", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1205331684" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96FM1-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1621", "url": "https://glyconnect.expasy.org/browser/proteins/1621" } ], "protein_name": "GPI-specific phospholipase A2-like PGAP3", "gene_name": "PGAP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 320, "chemical_mass": 36475.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "GELnTSIFSSRPIDK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "2", "chr_pos": "70276841", "evidence": [ { "id": "rs764712210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764712210#frequency_tab" }, { "id": "rs764712210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764712210" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "2", "chr_pos": "70276842", "evidence": [ { "id": "Q9UHG3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UHG3" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "", "site_lbl": "N353", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "2", "chr_pos": "70276932", "evidence": [ { "id": "rs1696679990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1696679990" }, { "id": "rs1696679990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1696679990#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "123", "site_seq": "GVYELTHNnK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "123", "site_seq": "GVYELTHNNK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "389", "site_seq": "N", "site_lbl": "Asn389", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 389, "end_pos": 389, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "389", "site_seq": "FGLNMTK", "site_lbl": "Asn389", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 389, "end_pos": 389, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "123", "site_seq": "", "site_lbl": "N123", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "8", "chr_pos": "94739437", "evidence": [ { "id": "rs1811335972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1811335972" }, { "id": "rs1811335972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1811335972#frequency_tab" }, { "id": "rs1811335972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1811335972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z388-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1627", "url": "https://glyconnect.expasy.org/browser/proteins/1627" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "DPY19L4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 723, "chemical_mass": 83756.0 } ] }, { "start_pos": "78", "site_seq": "NQnGTFK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUN5-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1628", "url": "https://glyconnect.expasy.org/browser/proteins/1628" } ], "protein_name": "Lysosomal cobalamin transport escort protein LMBD1", "gene_name": "LMBRD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 61389.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUN5-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1628", "url": "https://glyconnect.expasy.org/browser/proteins/1628" } ], "protein_name": "Lysosomal cobalamin transport escort protein LMBD1", "gene_name": "LMBRD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 61389.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT); n-glyco-sequon-gain (NQN->NQS).", "chr_id": "6", "chr_pos": "69790309", "evidence": [ { "id": "rs769381926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769381926" }, { "id": "rs769381926", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769381926" }, { "id": "rs769381926", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769381926" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUN5-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1628", "url": "https://glyconnect.expasy.org/browser/proteins/1628" } ], "protein_name": "Lysosomal cobalamin transport escort protein LMBD1", "gene_name": "LMBRD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 61389.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Does not affect glycosylation status; when associated with Q-88.", "evidence": [ { "database": "UniProtKB", "id": "Q9NUN5", "url": "https://www.uniprot.org/uniprotkb/Q9NUN5" }, { "database": "PubMed", "id": "19136951", "url": "https://glygen.org/publication/PubMed/19136951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUN5-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1628", "url": "https://glyconnect.expasy.org/browser/proteins/1628" } ], "protein_name": "Lysosomal cobalamin transport escort protein LMBD1", "gene_name": "LMBRD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 61389.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "81", "site_seq": "SYAGFLTVnK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "", "site_lbl": "N346", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "7", "chr_pos": "29064162", "evidence": [ { "id": "rs774430947", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774430947" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "7", "chr_pos": "29064161", "evidence": [ { "id": "rs535663848", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs535663848" }, { "id": "rs535663848", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs535663848" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->IKT).", "chr_id": "7", "chr_pos": "29112750", "evidence": [ { "id": "rs771212555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771212555" }, { "id": "rs771212555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771212555" }, { "id": "rs771212555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771212555" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "NC_000007.14", "chr_pos": "29112749", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "7", "chr_pos": "29112750", "evidence": [ { "id": "Q9H3G5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9H3G5" }, { "id": "rs771212555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771212555" }, { "id": "rs771212555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771212555" }, { "id": "rs771212555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771212555" }, { "id": "rs771212555", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs771212555" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1630", "url": "https://glyconnect.expasy.org/browser/proteins/1630" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "381", "site_seq": "AMnTSQVEALGIQMLPGYR", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "381", "site_seq": "AMNTSQVEALGIQMLPGYR", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "96", "site_seq": "TALWVATDHNMDnTSTVLR", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "96", "site_seq": "N", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "96", "site_seq": "TALWVATDHNMDNTSTVLR", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ5-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1631", "url": "https://glyconnect.expasy.org/browser/proteins/1631" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "COLGALT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 71636.0 } ] }, { "start_pos": "382", "site_seq": "ALnTSQLK", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IYK4-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1632", "url": "https://glyconnect.expasy.org/browser/proteins/1632" } ], "protein_name": "Procollagen galactosyltransferase 2", "gene_name": "COLGALT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 626, "chemical_mass": 72924.0 } ] }, { "start_pos": "382", "site_seq": "N", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IYK4-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1632", "url": "https://glyconnect.expasy.org/browser/proteins/1632" } ], "protein_name": "Procollagen galactosyltransferase 2", "gene_name": "COLGALT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 626, "chemical_mass": 72924.0 } ] }, { "start_pos": "382", "site_seq": "ALNTSQLK", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IYK4-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1632", "url": "https://glyconnect.expasy.org/browser/proteins/1632" } ], "protein_name": "Procollagen galactosyltransferase 2", "gene_name": "COLGALT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 626, "chemical_mass": 72924.0 } ] }, { "start_pos": "382", "site_seq": "", "site_lbl": "N382", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 0 out of 0 filters:", "chr_id": "1", "chr_pos": "183945557", "evidence": [ { "id": "rs759400909", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759400909" }, { "id": "rs759400909", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759400909" }, { "id": "rs759400909", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs759400909" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "1", "chr_pos": "183945556", "evidence": [ { "id": "Q8IYK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IYK4" }, { "id": "rs1227000124", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1227000124" }, { "id": "rs1227000124", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1227000124#frequency_tab" }, { "id": "rs1227000124", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1227000124" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "1", "chr_pos": "183945556", "evidence": [ { "id": "rs1227000124", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1227000124" }, { "id": "rs1227000124", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1227000124#frequency_tab" }, { "id": "rs1227000124", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1227000124" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IYK4-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1632", "url": "https://glyconnect.expasy.org/browser/proteins/1632" } ], "protein_name": "Procollagen galactosyltransferase 2", "gene_name": "COLGALT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 626, "chemical_mass": 72924.0 } ] }, { "start_pos": "197", "site_seq": "EQInITLDHR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "197", "site_seq": "REQInITLDHR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "197", "site_seq": "EQINITLDHR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "538", "site_seq": "YIHQnYTK", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "538", "site_seq": "N", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "1", "chr_pos": "11954839", "evidence": [ { "id": "rs1645727034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1645727034" }, { "id": "rs1645727034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1645727034#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "1", "chr_pos": "11954840", "evidence": [ { "id": "rs750416079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750416079" }, { "id": "rs750416079", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750416079" }, { "id": "rs750416079", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750416079#frequency_tab" }, { "id": "rs750416079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750416079" } ], "disease": [ { "disease_id": "DOID:0080734", "name": "Ehlers-Danlos syndrome kyphoscoliotic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by severe muscle hypotonia at birth, generalized joint laxity, scoliosis at birth, and scleral fragility and rupture of the ocular globe and that has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding lysyl hydroxylase (PLOD1) on chromosome 1p36.", "url": "http://disease-ontology.org/term/DOID:0080734", "evidence": [ { "id": "0016002", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016002" }, { "id": "225400", "database": "MIM", "url": "https://www.omim.org/entry/225400" }, { "id": "5351", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/5351#disease" }, { "id": "0080734", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080734" } ] }, { "disease_id": "DOID:0080734", "name": "Ehlers-Danlos syndrome kyphoscoliotic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by severe muscle hypotonia at birth, generalized joint laxity, scoliosis at birth, and scleral fragility and rupture of the ocular globe and that has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding lysyl hydroxylase (PLOD1) on chromosome 1p36.", "url": "http://disease-ontology.org/term/DOID:0080734", "evidence": [ { "id": "0016002", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016002" }, { "id": "225400", "database": "MIM", "url": "https://www.omim.org/entry/225400" }, { "id": "5351", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/5351#disease" }, { "id": "0080734", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080734" } ] }, { "disease_id": "DOID:0080734", "name": "Ehlers-Danlos syndrome kyphoscoliotic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by severe muscle hypotonia at birth, generalized joint laxity, scoliosis at birth, and scleral fragility and rupture of the ocular globe and that has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding lysyl hydroxylase (PLOD1) on chromosome 1p36.", "url": "http://disease-ontology.org/term/DOID:0080734", "evidence": [ { "id": "0016002", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016002" }, { "id": "225400", "database": "MIM", "url": "https://www.omim.org/entry/225400" }, { "id": "5351", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/5351#disease" }, { "id": "0080734", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080734" } ] }, { "disease_id": "DOID:0080734", "name": "Ehlers-Danlos syndrome kyphoscoliotic type 1", "description": "An Ehlers-Danlos syndrome that is characterized by severe muscle hypotonia at birth, generalized joint laxity, scoliosis at birth, and scleral fragility and rupture of the ocular globe and that has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding lysyl hydroxylase (PLOD1) on chromosome 1p36.", "url": "http://disease-ontology.org/term/DOID:0080734", "evidence": [ { "id": "0016002", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016002" }, { "id": "225400", "database": "MIM", "url": "https://www.omim.org/entry/225400" }, { "id": "5351", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/5351#disease" }, { "id": "0080734", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080734" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "538", "site_seq": "", "site_lbl": "N538", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "1", "chr_pos": "11966279", "evidence": [ { "id": "rs1324713201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1324713201" }, { "id": "rs1324713201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1324713201" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1633", "url": "https://glyconnect.expasy.org/browser/proteins/1633" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHEnYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHENYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "SAEFFnYTVR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "SAEFFNYTVR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "", "site_lbl": "N548", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101210132", "evidence": [ { "id": "rs1798158118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1798158118" }, { "id": "rs1798158118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1798158118#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101216707", "evidence": [ { "id": "rs145886391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145886391" }, { "id": "rs145886391", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145886391" }, { "id": "rs145886391", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145886391#frequency_tab" }, { "id": "rs145886391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145886391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101216708", "evidence": [ { "id": "rs1249409241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1249409241" }, { "id": "rs1249409241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1249409241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1635", "url": "https://glyconnect.expasy.org/browser/proteins/1635" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "467", "site_seq": "LLnGSQR", "site_lbl": "Asn467", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "467", "site_seq": "N", "site_lbl": "Asn467", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "467", "site_seq": "LLNGSQR", "site_lbl": "Asn467", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "540", "site_seq": "VPLQSAHLYYnVTEK", "site_lbl": "Asn540", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "540", "site_seq": "N", "site_lbl": "Asn540", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "540", "site_seq": "VPLQSAHLYYNVTEK", "site_lbl": "Asn540", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "467", "site_seq": "", "site_lbl": "N467", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "1", "chr_pos": "42752610", "evidence": [ { "id": "Q32P28", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q32P28" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "540", "site_seq": "", "site_lbl": "N540", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "1", "chr_pos": "42750286", "evidence": [ { "id": "rs140334418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140334418" }, { "id": "rs140334418", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs140334418" }, { "id": "rs140334418", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140334418" }, { "id": "rs140334418", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140334418#frequency_tab" }, { "id": "rs140334418", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140334418" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->nullVT).", "chr_id": "1", "chr_pos": "42750288_42750290", "evidence": [ { "id": "rs1557562500", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1557562500" } ], "disease": [ { "disease_id": "DOID:0110336", "name": "osteogenesis imperfecta type 8", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the P3H1 gene on chromosome 1p34.2.", "url": "http://disease-ontology.org/term/DOID:0110336", "evidence": [ { "id": "610915", "database": "MIM", "url": "https://www.omim.org/entry/610915" }, { "id": "0110336", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110336" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q32P28-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1639", "url": "https://glyconnect.expasy.org/browser/proteins/1639" } ], "protein_name": "Prolyl 3-hydroxylase 1", "gene_name": "P3H1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 736, "chemical_mass": 83394.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1640", "url": "https://glyconnect.expasy.org/browser/proteins/1640" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1640", "url": "https://glyconnect.expasy.org/browser/proteins/1640" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1640", "url": "https://glyconnect.expasy.org/browser/proteins/1640" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "", "site_lbl": "N113", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "10", "chr_pos": "73068972", "evidence": [ { "id": "rs764044557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764044557" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1640", "url": "https://glyconnect.expasy.org/browser/proteins/1640" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "580", "site_seq": "TVTINASSSR", "site_lbl": "Asn580", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 580, "end_pos": 580, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1649", "url": "https://glyconnect.expasy.org/browser/proteins/1649" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "580", "site_seq": "N", "site_lbl": "Asn580", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 580, "end_pos": 580, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1649", "url": "https://glyconnect.expasy.org/browser/proteins/1649" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "580", "site_seq": "TVTInASSSR", "site_lbl": "Asn580", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 580, "end_pos": 580, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1649", "url": "https://glyconnect.expasy.org/browser/proteins/1649" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "580", "site_seq": "", "site_lbl": "N580", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "1", "chr_pos": "186674430", "evidence": [ { "id": "P35354", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35354" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "1", "chr_pos": "186674429", "evidence": [ { "id": "rs1665743771", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1665743771" }, { "id": "rs1665743771", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1665743771#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 580, "end_pos": 580, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1649", "url": "https://glyconnect.expasy.org/browser/proteins/1649" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "153", "site_seq": "VVMDIPYELWNETSAEVADLKK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1651", "url": "https://glyconnect.expasy.org/browser/proteins/1651" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1651", "url": "https://glyconnect.expasy.org/browser/proteins/1651" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "VVMDIPYELWnETSAEVADLK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1651", "url": "https://glyconnect.expasy.org/browser/proteins/1651" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "", "site_lbl": "N153", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "6", "chr_pos": "42937803", "evidence": [ { "id": "rs373936858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373936858" }, { "id": "rs373936858", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373936858" }, { "id": "rs373936858", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373936858" }, { "id": "rs373936858", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373936858#frequency_tab" }, { "id": "rs373936858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373936858" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "6", "chr_pos": "42937802", "evidence": [ { "id": "rs1238716233", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1238716233" }, { "id": "rs1238716233", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1238716233" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1651", "url": "https://glyconnect.expasy.org/browser/proteins/1651" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "160", "site_seq": "VnETEMDIAK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "160", "site_seq": "VNETEMDIAK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "N", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYnVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYNVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "167546280", "evidence": [ { "id": "rs1656322210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1656322210" }, { "id": "rs1656322210", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1656322210" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "", "site_lbl": "N216", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "1", "chr_pos": "167546113", "evidence": [ { "id": "rs144088168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144088168" }, { "id": "rs144088168", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144088168#frequency_tab" }, { "id": "rs144088168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144088168" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "1", "chr_pos": "167546112", "evidence": [ { "id": "rs748757226", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748757226#frequency_tab" }, { "id": "rs748757226", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748757226" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "1", "chr_pos": "167546114", "evidence": [ { "id": "rs1399559749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399559749" }, { "id": "rs1399559749", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1399559749#frequency_tab" }, { "id": "rs1399559749", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399559749" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "258", "site_seq": "nTSVEHTR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JJ7-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1656", "url": "https://glyconnect.expasy.org/browser/proteins/1656" } ], "protein_name": "Protein disulfide-isomerase TMX3", "gene_name": "TMX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 454, "chemical_mass": 51872.0 } ] }, { "start_pos": "258", "site_seq": "N", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JJ7-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1656", "url": "https://glyconnect.expasy.org/browser/proteins/1656" } ], "protein_name": "Protein disulfide-isomerase TMX3", "gene_name": "TMX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 454, "chemical_mass": 51872.0 } ] }, { "start_pos": "258", "site_seq": "NTSVEHTR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JJ7-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1656", "url": "https://glyconnect.expasy.org/browser/proteins/1656" } ], "protein_name": "Protein disulfide-isomerase TMX3", "gene_name": "TMX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 454, "chemical_mass": 51872.0 } ] }, { "start_pos": "204", "site_seq": "nSTAYFR", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1663", "url": "https://glyconnect.expasy.org/browser/proteins/1663" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "204", "site_seq": "N", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1663", "url": "https://glyconnect.expasy.org/browser/proteins/1663" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "204", "site_seq": "KKNSTAYFR", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1663", "url": "https://glyconnect.expasy.org/browser/proteins/1663" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "204", "site_seq": "", "site_lbl": "N204", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "3", "chr_pos": "119485360", "evidence": [ { "id": "Q8NBL1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8NBL1" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "119485360", "evidence": [ { "id": "rs772758729", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772758729" }, { "id": "rs772758729", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772758729" }, { "id": "rs772758729", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772758729" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1663", "url": "https://glyconnect.expasy.org/browser/proteins/1663" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5K3-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1664", "url": "https://glyconnect.expasy.org/browser/proteins/1664" } ], "protein_name": "Protein O-mannose kinase", "gene_name": "POMK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40050.0 } ] }, { "start_pos": "67", "site_seq": "nCSPWLSCEELR", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5K3-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1664", "url": "https://glyconnect.expasy.org/browser/proteins/1664" } ], "protein_name": "Protein O-mannose kinase", "gene_name": "POMK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40050.0 } ] }, { "start_pos": "67", "site_seq": "NCSPWLSCEELR", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5K3-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1664", "url": "https://glyconnect.expasy.org/browser/proteins/1664" } ], "protein_name": "Protein O-mannose kinase", "gene_name": "POMK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40050.0 } ] }, { "start_pos": "67", "site_seq": "", "site_lbl": "N67", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "8", "chr_pos": "43103748", "evidence": [ { "id": "rs746739561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746739561" }, { "id": "rs746739561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746739561" }, { "id": "rs746739561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746739561#frequency_tab" }, { "id": "rs746739561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746739561" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5K3-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1664", "url": "https://glyconnect.expasy.org/browser/proteins/1664" } ], "protein_name": "Protein O-mannose kinase", "gene_name": "POMK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40050.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13438-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1666", "url": "https://glyconnect.expasy.org/browser/proteins/1666" } ], "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 667, "chemical_mass": 75562.0 } ] }, { "start_pos": "177", "site_seq": "YHSQTYGnGSK", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13438-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1666", "url": "https://glyconnect.expasy.org/browser/proteins/1666" } ], "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 667, "chemical_mass": 75562.0 } ] }, { "start_pos": "177", "site_seq": "RYHSQTYGnGSK", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13438-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1666", "url": "https://glyconnect.expasy.org/browser/proteins/1666" } ], "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 667, "chemical_mass": 75562.0 } ] }, { "start_pos": "177", "site_seq": "YHSQTYGNGSK", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13438-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1666", "url": "https://glyconnect.expasy.org/browser/proteins/1666" } ], "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 667, "chemical_mass": 75562.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "12", "chr_pos": "57696324", "evidence": [ { "id": "rs761476126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761476126" }, { "id": "rs761476126", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761476126" }, { "id": "rs761476126", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761476126" }, { "id": "rs761476126", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs761476126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13438-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1666", "url": "https://glyconnect.expasy.org/browser/proteins/1666" } ], "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 667, "chemical_mass": 75562.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "217", "site_seq": "AASMnHTK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "431", "site_seq": "MYSEGSDIVPQSnETALHYFK", "site_lbl": "Asn431", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "431", "site_seq": "N", "site_lbl": "Asn431", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "14", "chr_pos": "81502849", "evidence": [ { "id": "rs1884070041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1884070041" }, { "id": "rs1884070041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1884070041#frequency_tab" }, { "id": "rs1884070041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1884070041" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "14", "chr_pos": "81502848", "evidence": [ { "id": "rs764394654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764394654" }, { "id": "rs764394654", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764394654" }, { "id": "rs764394654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764394654" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "431", "site_seq": "", "site_lbl": "N431", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "14", "chr_pos": "81490428", "evidence": [ { "id": "Q9UBV2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UBV2" }, { "id": "rs1443797116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443797116" }, { "id": "rs1443797116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443797116" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1669", "url": "https://glyconnect.expasy.org/browser/proteins/1669" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "465", "site_seq": "N", "site_lbl": "Asn465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 465, "end_pos": 465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "465", "site_seq": "nQSLVQDMDSMVR", "site_lbl": "Asn465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 465, "end_pos": 465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "465", "site_seq": "RNQSLVQDMDSMVR", "site_lbl": "Asn465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 465, "end_pos": 465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "HPDAVAWAnLTNAIR", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "HPDAVAWANLTNAIR", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "465", "site_seq": "", "site_lbl": "N465", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->TQS).", "chr_id": "NC_000012.12", "chr_pos": "113387041", "evidence": [ { "id": "rs770273877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770273877" }, { "id": "rs770273877", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770273877" }, { "id": "rs770273877", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770273877" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 465, "end_pos": 465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "", "site_lbl": "N88", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "113358863", "evidence": [ { "id": "rs1384462400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1384462400" }, { "id": "rs1384462400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1384462400" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "113358863", "evidence": [ { "id": "rs1384462400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1384462400" }, { "id": "rs1384462400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1384462400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1700", "url": "https://glyconnect.expasy.org/browser/proteins/1700" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "140", "site_seq": "GPLANPIWnVTGFTGR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "140", "site_seq": "GPLANPIWNVTGFTGR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "140", "site_seq": "", "site_lbl": "N140", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "6", "chr_pos": "128322116", "evidence": [ { "id": "rs1326266335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326266335" }, { "id": "rs1326266335", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1326266335#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "259", "site_seq": "HSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "530", "site_seq": "GHCWGPGPTQCVnCSQFLR", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "530", "site_seq": "N", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "530", "site_seq": "GHCWGPGPTQCVNCSQFLR", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "259", "site_seq": "", "site_lbl": "N259", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->HHS).", "chr_id": "17", "chr_pos": "39710355", "evidence": [ { "id": "rs2145517875", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2145517875" }, { "id": "rs2145517875", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2145517875" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "17", "chr_pos": "39710357", "evidence": [ { "id": "rs775666242", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775666242" }, { "id": "rs775666242", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775666242" }, { "id": "rs775666242", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775666242#frequency_tab" }, { "id": "rs775666242", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775666242" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "17", "chr_pos": "39710356", "evidence": [ { "id": "P04626", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04626" }, { "id": "rs769870618", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769870618" }, { "id": "rs769870618", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769870618" }, { "id": "rs769870618", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769870618#frequency_tab" }, { "id": "rs769870618", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769870618" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->YHS).", "chr_id": "17", "chr_pos": "39710355", "evidence": [ { "id": "rs2145517875", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2145517875" }, { "id": "rs2145517875", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2145517875" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "530", "site_seq": "", "site_lbl": "N530", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "17", "chr_pos": "39716376", "evidence": [ { "id": "rs771580372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771580372#frequency_tab" }, { "id": "rs771580372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771580372" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "17", "chr_pos": "39716377", "evidence": [ { "id": "rs957422814", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs957422814" }, { "id": "rs957422814", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs957422814#frequency_tab" }, { "id": "rs957422814", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs957422814" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "17", "chr_pos": "39716376", "evidence": [ { "id": "rs771580372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771580372#frequency_tab" }, { "id": "rs771580372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771580372" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "17", "chr_pos": "39716376", "evidence": [ { "id": "rs771580372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771580372" }, { "id": "rs771580372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771580372#frequency_tab" }, { "id": "rs771580372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771580372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04626-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1710", "url": "https://glyconnect.expasy.org/browser/proteins/1710" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1255, "chemical_mass": 137910.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1712", "url": "https://glyconnect.expasy.org/browser/proteins/1712" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1712", "url": "https://glyconnect.expasy.org/browser/proteins/1712" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1712", "url": "https://glyconnect.expasy.org/browser/proteins/1712" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75106-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1714", "url": "https://glyconnect.expasy.org/browser/proteins/1714" } ], "protein_name": "Amine oxidase [copper-containing] 2", "gene_name": "AOC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 83673.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "17", "chr_pos": "42845024", "evidence": [ { "id": "rs1269957701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1269957701" }, { "id": "rs1269957701", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1269957701" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75106-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1714", "url": "https://glyconnect.expasy.org/browser/proteins/1714" } ], "protein_name": "Amine oxidase [copper-containing] 2", "gene_name": "AOC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 83673.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB40-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1715", "url": "https://glyconnect.expasy.org/browser/proteins/1715" } ], "protein_name": "Retinoid-inducible serine carboxypeptidase", "gene_name": "SCPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 452, "chemical_mass": 50831.0 } ] }, { "start_pos": "126", "site_seq": "KTTWLQAASLLFVDNPVGTGFSYVNGSGAYAK", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB40-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1715", "url": "https://glyconnect.expasy.org/browser/proteins/1715" } ], "protein_name": "Retinoid-inducible serine carboxypeptidase", "gene_name": "SCPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 452, "chemical_mass": 50831.0 } ] }, { "start_pos": "106", "site_seq": "AYWPDVIHSFPnR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "106", "site_seq": "AYWPDVIHSFPNR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "212", "site_seq": "QDQQLQnCTEPGEQPSPK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "212", "site_seq": "QDQQLQNCTEPGEQPSPK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "6", "chr_pos": "166943035", "evidence": [ { "id": "rs1326095554", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326095554" }, { "id": "rs1326095554", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1326095554#frequency_tab" }, { "id": "rs1326095554", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1326095554" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->IRS).", "chr_id": "6", "chr_pos": "166943034", "evidence": [ { "id": "rs993877408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs993877408" }, { "id": "rs993877408", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs993877408#frequency_tab" }, { "id": "rs993877408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs993877408" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "6", "chr_pos": "166943034", "evidence": [ { "id": "rs993877408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs993877408" }, { "id": "rs993877408", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs993877408#frequency_tab" }, { "id": "rs993877408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs993877408" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "6", "chr_pos": "166929723", "evidence": [ { "id": "O00584", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O00584" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00584-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1719", "url": "https://glyconnect.expasy.org/browser/proteins/1719" } ], "protein_name": "Ribonuclease T2", "gene_name": "RNASET2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 256, "chemical_mass": 29481.0 } ] }, { "start_pos": "88", "site_seq": "TDCDSSTTSLCSFPVAnVSLTK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G97-2", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1728", "url": "https://glyconnect.expasy.org/browser/proteins/1728" } ], "protein_name": "Seipin", "gene_name": "BSCL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44392.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G97-2", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1728", "url": "https://glyconnect.expasy.org/browser/proteins/1728" } ], "protein_name": "Seipin", "gene_name": "BSCL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44392.0 } ] }, { "start_pos": "88", "site_seq": "TDCDSSTTSLCSFPVANVSLTK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G97-2", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1728", "url": "https://glyconnect.expasy.org/browser/proteins/1728" } ], "protein_name": "Seipin", "gene_name": "BSCL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44392.0 } ] }, { "start_pos": "88", "site_seq": "", "site_lbl": "N88", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "11", "chr_pos": "62702499", "evidence": [ { "id": "rs137852972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852972" }, { "id": "rs137852972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852972" }, { "id": "rs137852972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137852972#frequency_tab" }, { "id": "rs137852972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137852972" }, { "id": "14981520", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14981520" }, { "id": "15732094", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15732094" }, { "id": "16427281", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16427281" }, { "id": "1674639", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1674639" }, { "id": "19396477", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19396477" }, { "id": "23553728", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23553728" }, { "id": "5964029", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/5964029" } ], "disease": [ { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0111203", "name": "autosomal dominant distal hereditary motor neuronopathy 5", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by onset of distal muscle weakness and atrophy predominantly affecting the upper limbs in the first few decades of life and that has_material_basis_in heterozygous mutation in the GARS gene on chromosome 7p14.", "url": "http://disease-ontology.org/term/DOID:0111203", "evidence": [ { "id": "600794", "database": "MIM", "url": "https://www.omim.org/entry/600794" }, { "id": "0111203", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111203" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0110770", "name": "hereditary spastic paraplegia 17", "description": "A hereditary spastic paraplegia that has_material_basis_in mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0110770", "evidence": [ { "id": "270685", "database": "MIM", "url": "https://www.omim.org/entry/270685" }, { "id": "0110770", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110770" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] }, { "disease_id": "DOID:0081401", "name": "autosomal dominant distal hereditary motor neuronopathy 13", "description": "An autosomal dominant distal hereditary motor neuronopathy that is characterized by distal muscle weakness and atrophy affecting both the upper and lower limbs, resulting in difficulty walking and poor fine hand motor skills and that has_material_basis_in heterozygous mutation in the BSCL2 gene on chromosome 11q12.", "url": "http://disease-ontology.org/term/DOID:0081401", "evidence": [ { "id": "619112", "database": "MIM", "url": "https://www.omim.org/entry/619112" }, { "id": "0081401", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081401" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96G97-2", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1728", "url": "https://glyconnect.expasy.org/browser/proteins/1728" } ], "protein_name": "Seipin", "gene_name": "BSCL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 44392.0 } ] }, { "start_pos": "427", "site_seq": "N", "site_lbl": "Asn427", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49591-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1738", "url": "https://glyconnect.expasy.org/browser/proteins/1738" } ], "protein_name": "Serine--tRNA ligase, cytoplasmic", "gene_name": "SARS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 514, "chemical_mass": 58777.0 } ] }, { "start_pos": "427", "site_seq": "", "site_lbl": "N427", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "1", "chr_pos": "109237265", "evidence": [ { "id": "rs770562602", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770562602" }, { "id": "rs770562602", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs770562602" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "1", "chr_pos": "109237266", "evidence": [ { "id": "rs1655332425", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1655332425" }, { "id": "rs1655332425", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1655332425" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49591-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1738", "url": "https://glyconnect.expasy.org/browser/proteins/1738" } ], "protein_name": "Serine--tRNA ligase, cytoplasmic", "gene_name": "SARS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 514, "chemical_mass": 58777.0 } ] }, { "start_pos": "254", "site_seq": "HTNMnLTQLK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15165-2", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1741", "url": "https://glyconnect.expasy.org/browser/proteins/1741" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "PON2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 39381.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15165-2", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1741", "url": "https://glyconnect.expasy.org/browser/proteins/1741" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "PON2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 39381.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15165-2", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1741", "url": "https://glyconnect.expasy.org/browser/proteins/1741" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "PON2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 39381.0 } ] }, { "start_pos": "254", "site_seq": "", "site_lbl": "N254", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "7", "chr_pos": "95407004", "evidence": [ { "id": "Q15165", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q15165" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15165-2", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1741", "url": "https://glyconnect.expasy.org/browser/proteins/1741" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "PON2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 39381.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "7", "chr_pos": "95405428", "evidence": [ { "id": "rs760739231", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760739231" }, { "id": "rs760739231", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760739231" }, { "id": "rs760739231", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760739231#frequency_tab" }, { "id": "rs760739231", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760739231" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15165-2", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1741", "url": "https://glyconnect.expasy.org/browser/proteins/1741" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "PON2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 39381.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1742", "url": "https://glyconnect.expasy.org/browser/proteins/1742" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "HSVLWNAMIHPLCnMTLK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1742", "url": "https://glyconnect.expasy.org/browser/proteins/1742" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "HSVLWNAMIHPLCNMTLK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1742", "url": "https://glyconnect.expasy.org/browser/proteins/1742" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->DMT).", "chr_id": "11", "chr_pos": "124648099", "evidence": [ { "id": "rs1942967215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942967215" }, { "id": "rs1942967215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1942967215#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1742", "url": "https://glyconnect.expasy.org/browser/proteins/1742" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "149", "site_seq": "DMnQTLGDNITVK", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCT8-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1746", "url": "https://glyconnect.expasy.org/browser/proteins/1746" } ], "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 520, "chemical_mass": 58143.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCT8-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1746", "url": "https://glyconnect.expasy.org/browser/proteins/1746" } ], "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 520, "chemical_mass": 58143.0 } ] }, { "start_pos": "149", "site_seq": "DMNQTLGDNITVK", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCT8-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1746", "url": "https://glyconnect.expasy.org/browser/proteins/1746" } ], "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 520, "chemical_mass": 58143.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00241-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1747", "url": "https://glyconnect.expasy.org/browser/proteins/1747" } ], "protein_name": "Signal-regulatory protein beta-1", "gene_name": "SIRPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 43211.0 } ] }, { "start_pos": "269", "site_seq": "", "site_lbl": "N269", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "20", "chr_pos": "1571084", "evidence": [ { "id": "O00241", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O00241" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "20", "chr_pos": "1571083", "evidence": [ { "id": "rs770258540", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770258540" }, { "id": "rs770258540", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770258540" }, { "id": "rs770258540", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770258540#frequency_tab" }, { "id": "rs770258540", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770258540" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00241-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1747", "url": "https://glyconnect.expasy.org/browser/proteins/1747" } ], "protein_name": "Signal-regulatory protein beta-1", "gene_name": "SIRPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 43211.0 } ] }, { "start_pos": "1608", "site_seq": "N", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSnK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSNKTNTVLK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "2054", "site_seq": "HFnESR", "site_lbl": "Asn2054", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 2054, "end_pos": 2054, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "2054", "site_seq": "N", "site_lbl": "Asn2054", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 2054, "end_pos": 2054, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08842-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1770", "url": "https://glyconnect.expasy.org/browser/proteins/1770" } ], "protein_name": "Steryl-sulfatase", "gene_name": "STS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65492.0 } ] }, { "start_pos": "259", "site_seq": "NYEIIQQPMSYDNLTQR", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08842-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1770", "url": "https://glyconnect.expasy.org/browser/proteins/1770" } ], "protein_name": "Steryl-sulfatase", "gene_name": "STS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65492.0 } ] }, { "start_pos": "171", "site_seq": "LAVTnTTMTGTVLK", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13586-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1771", "url": "https://glyconnect.expasy.org/browser/proteins/1771" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 77423.0 } ] }, { "start_pos": "171", "site_seq": "N", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13586-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1771", "url": "https://glyconnect.expasy.org/browser/proteins/1771" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 77423.0 } ] }, { "start_pos": "171", "site_seq": "LAVTNTTMTGTVLK", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13586-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1771", "url": "https://glyconnect.expasy.org/browser/proteins/1771" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 77423.0 } ] }, { "start_pos": "171", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs ORAI1 ARC channel currents; when associated with Q-131.", "evidence": [ { "database": "UniProtKB", "id": "Q13586", "url": "https://www.uniprot.org/uniprotkb/Q13586" }, { "database": "PubMed", "id": "19622606", "url": "https://glygen.org/publication/PubMed/19622606" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13586-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1771", "url": "https://glyconnect.expasy.org/browser/proteins/1771" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 77423.0 } ] }, { "start_pos": "141", "site_seq": "FVnSTGYLTEAEK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBK3-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1772", "url": "https://glyconnect.expasy.org/browser/proteins/1772" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "SUMF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 374, "chemical_mass": 40556.0 } ] }, { "start_pos": "141", "site_seq": "N", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBK3-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1772", "url": "https://glyconnect.expasy.org/browser/proteins/1772" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "SUMF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 374, "chemical_mass": 40556.0 } ] }, { "start_pos": "141", "site_seq": "FVNSTGYLTEAEK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBK3-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1772", "url": "https://glyconnect.expasy.org/browser/proteins/1772" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "SUMF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 374, "chemical_mass": 40556.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "N141", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "3", "chr_pos": "4452898", "evidence": [ { "id": "Q8NBK3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8NBK3" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBK3-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1772", "url": "https://glyconnect.expasy.org/browser/proteins/1772" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "SUMF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 374, "chemical_mass": 40556.0 } ] }, { "start_pos": "530", "site_seq": "SISEnATATAAPK", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "N", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "SISENATATAAPK", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "963", "site_seq": "N", "site_lbl": "Asn963", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 963, "end_pos": 963, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "963", "site_seq": "LQnTSR", "site_lbl": "Asn963", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 963, "end_pos": 963, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "", "site_lbl": "N530", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "1", "chr_pos": "172585878", "evidence": [ { "id": "rs1285759601", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1285759601" }, { "id": "rs1285759601", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1285759601#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "963", "site_seq": "", "site_lbl": "N963", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "1", "chr_pos": "172591046", "evidence": [ { "id": "rs745444809", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745444809" }, { "id": "rs745444809", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745444809" }, { "id": "rs745444809", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745444809" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 963, "end_pos": 963, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "636", "site_seq": "ALSPnSTISSAPK", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UH99-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1777", "url": "https://glyconnect.expasy.org/browser/proteins/1777" } ], "protein_name": "SUN domain-containing protein 2", "gene_name": "SUN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 717, "chemical_mass": 80311.0 } ] }, { "start_pos": "636", "site_seq": "N", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UH99-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1777", "url": "https://glyconnect.expasy.org/browser/proteins/1777" } ], "protein_name": "SUN domain-containing protein 2", "gene_name": "SUN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 717, "chemical_mass": 80311.0 } ] }, { "start_pos": "636", "site_seq": "ALSPNSTISSAPK", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UH99-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1777", "url": "https://glyconnect.expasy.org/browser/proteins/1777" } ], "protein_name": "SUN domain-containing protein 2", "gene_name": "SUN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 717, "chemical_mass": 80311.0 } ] }, { "start_pos": "636", "site_seq": "", "site_lbl": "N636", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "22", "chr_pos": "38738626", "evidence": [ { "id": "rs1569294641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569294641" }, { "id": "rs1569294641", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569294641" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "22", "chr_pos": "38738627", "evidence": [ { "id": "rs746551792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746551792" }, { "id": "rs746551792", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746551792" }, { "id": "rs746551792", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746551792#frequency_tab" }, { "id": "rs746551792", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746551792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UH99-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1777", "url": "https://glyconnect.expasy.org/browser/proteins/1777" } ], "protein_name": "SUN domain-containing protein 2", "gene_name": "SUN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 717, "chemical_mass": 80311.0 } ] }, { "start_pos": "772", "site_seq": "VInQTTCENLLPQQITPR", "site_lbl": "Asn772", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Y6-1", "start_pos": 772, "end_pos": 772, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1779", "url": "https://glyconnect.expasy.org/browser/proteins/1779" } ], "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 855, "chemical_mass": 94770.0 } ] }, { "start_pos": "772", "site_seq": "N", "site_lbl": "Asn772", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Y6-1", "start_pos": 772, "end_pos": 772, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1779", "url": "https://glyconnect.expasy.org/browser/proteins/1779" } ], "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 855, "chemical_mass": 94770.0 } ] }, { "start_pos": "772", "site_seq": "", "site_lbl": "N772", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "11", "chr_pos": "130209487", "evidence": [ { "id": "rs1591899277", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1591899277" }, { "id": "rs1591899277", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1591899277" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Y6-1", "start_pos": 772, "end_pos": 772, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1779", "url": "https://glyconnect.expasy.org/browser/proteins/1779" } ], "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 855, "chemical_mass": 94770.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTEnK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1783", "url": "https://glyconnect.expasy.org/browser/proteins/1783" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1783", "url": "https://glyconnect.expasy.org/browser/proteins/1783" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTENK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1783", "url": "https://glyconnect.expasy.org/browser/proteins/1783" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "7", "chr_pos": "106099194", "evidence": [ { "id": "rs775964331", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775964331" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1783", "url": "https://glyconnect.expasy.org/browser/proteins/1783" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "1018", "site_seq": "N", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "LnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "YRLnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "", "site_lbl": "N1018", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "9", "chr_pos": "115073764", "evidence": [ { "id": "P24821", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24821" }, { "id": "rs61729548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61729548" }, { "id": "rs61729548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61729548#frequency_tab" }, { "id": "rs61729548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61729548" }, { "id": "rs61729548", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61729548" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->YYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWnTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "N", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWNTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "N141", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "1", "chr_pos": "46184868", "evidence": [ { "id": "rs1657392644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657392644" }, { "id": "rs1657392644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657392644#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "1", "chr_pos": "46184867", "evidence": [ { "id": "rs765158447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765158447#frequency_tab" }, { "id": "rs765158447", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765158447" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1797", "url": "https://glyconnect.expasy.org/browser/proteins/1797" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "595", "site_seq": "YLFPEVDMTSTnFTGLSCR", "site_lbl": "Asn595", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 595, "end_pos": 595, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1800", "url": "https://glyconnect.expasy.org/browser/proteins/1800" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "595", "site_seq": "N", "site_lbl": "Asn595", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 595, "end_pos": 595, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1800", "url": "https://glyconnect.expasy.org/browser/proteins/1800" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "595", "site_seq": "YLFPEVDMTSTNFTGLSCR", "site_lbl": "Asn595", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 595, "end_pos": 595, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1800", "url": "https://glyconnect.expasy.org/browser/proteins/1800" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "407", "site_seq": "LGFLGnQSQGCLPAR", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1806", "url": "https://glyconnect.expasy.org/browser/proteins/1806" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "407", "site_seq": "N", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1806", "url": "https://glyconnect.expasy.org/browser/proteins/1806" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "407", "site_seq": "LGFLGNQSQGCLPAR", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1806", "url": "https://glyconnect.expasy.org/browser/proteins/1806" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "382", "site_seq": "nTTSVWYTSK", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1810", "url": "https://glyconnect.expasy.org/browser/proteins/1810" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "382", "site_seq": "N", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1810", "url": "https://glyconnect.expasy.org/browser/proteins/1810" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "382", "site_seq": "NTTSVWYTSK", "site_lbl": "Asn382", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1810", "url": "https://glyconnect.expasy.org/browser/proteins/1810" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "382", "site_seq": "", "site_lbl": "N382", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "1", "chr_pos": "23848664", "evidence": [ { "id": "rs1368675481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368675481" }, { "id": "rs1368675481", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1368675481#frequency_tab" }, { "id": "rs1368675481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1368675481" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 382, "end_pos": 382, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1810", "url": "https://glyconnect.expasy.org/browser/proteins/1810" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JTV8-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1822", "url": "https://glyconnect.expasy.org/browser/proteins/1822" } ], "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "TOR1AIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 66248.0 } ] }, { "start_pos": "399", "site_seq": "HLnSSHPR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5JTV8-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1822", "url": "https://glyconnect.expasy.org/browser/proteins/1822" } ], "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "TOR1AIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 66248.0 } ] }, { "start_pos": "399", "site_seq": "", "site_lbl": "N399", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "179917683", "evidence": [ { "id": "rs1398409808", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1398409808" }, { "id": "rs1398409808", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1398409808" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "1", "chr_pos": "179917683", "evidence": [ { "id": "rs1398409808", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1398409808" }, { "id": "rs1398409808", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1398409808" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5JTV8-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1822", "url": "https://glyconnect.expasy.org/browser/proteins/1822" } ], "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "TOR1AIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 66248.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14657-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1824", "url": "https://glyconnect.expasy.org/browser/proteins/1824" } ], "protein_name": "Torsin-1B", "gene_name": "TOR1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 336, "chemical_mass": 37979.0 } ] }, { "start_pos": "64", "site_seq": "EERPLNASALK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14657-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1824", "url": "https://glyconnect.expasy.org/browser/proteins/1824" } ], "protein_name": "Torsin-1B", "gene_name": "TOR1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 336, "chemical_mass": 37979.0 } ] }, { "start_pos": "64", "site_seq": "EERPLnASALK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14657-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1824", "url": "https://glyconnect.expasy.org/browser/proteins/1824" } ], "protein_name": "Torsin-1B", "gene_name": "TOR1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 336, "chemical_mass": 37979.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->IAS).", "chr_id": "9", "chr_pos": "129803403", "evidence": [ { "id": "rs778856394", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778856394" }, { "id": "rs778856394", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778856394" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "9", "chr_pos": "129803404", "evidence": [ { "id": "rs747841289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747841289" }, { "id": "rs747841289", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747841289" }, { "id": "rs747841289", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747841289#frequency_tab" }, { "id": "rs747841289", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747841289" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "9", "chr_pos": "129803403", "evidence": [ { "id": "O14657", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14657" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14657-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1824", "url": "https://glyconnect.expasy.org/browser/proteins/1824" } ], "protein_name": "Torsin-1B", "gene_name": "TOR1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 336, "chemical_mass": 37979.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "191", "site_seq": "N", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "191", "site_seq": "DLNGNVFQDAVFnQTVTVIER", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "191", "site_seq": "DLNGNVFQDAVFNQTVTVIER", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "191", "site_seq": "", "site_lbl": "N191", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "6", "chr_pos": "7298794", "evidence": [ { "id": "rs763490649", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763490649" }, { "id": "rs763490649", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763490649" }, { "id": "rs763490649", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763490649" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "88", "site_seq": "IAPASnVSHTVVLRPLK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "156015013", "evidence": [ { "id": "rs762299406", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762299406" }, { "id": "rs762299406", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762299406" }, { "id": "rs762299406", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762299406#frequency_tab" }, { "id": "rs762299406", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762299406" }, { "id": "rs762299406", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs762299406" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "88", "site_seq": "", "site_lbl": "N88", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "1", "chr_pos": "156015062", "evidence": [ { "id": "rs759287947", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759287947" }, { "id": "rs759287947", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759287947" }, { "id": "rs759287947", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759287947#frequency_tab" }, { "id": "rs759287947", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759287947" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "117", "site_seq": "FTFTSHTPGDHQICLHSnSTR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1844", "url": "https://glyconnect.expasy.org/browser/proteins/1844" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1844", "url": "https://glyconnect.expasy.org/browser/proteins/1844" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "FTFTSHTPGDHQICLHSNSTR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1844", "url": "https://glyconnect.expasy.org/browser/proteins/1844" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "", "site_lbl": "N117", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "44581486", "evidence": [ { "id": "rs778354191", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778354191#frequency_tab" }, { "id": "rs778354191", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778354191" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "7", "chr_pos": "44581486", "evidence": [ { "id": "rs778354191", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778354191#frequency_tab" }, { "id": "rs778354191", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778354191" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1844", "url": "https://glyconnect.expasy.org/browser/proteins/1844" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "125", "site_seq": "FTFTSHTPGEHQICLHSnSTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1846", "url": "https://glyconnect.expasy.org/browser/proteins/1846" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1846", "url": "https://glyconnect.expasy.org/browser/proteins/1846" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "FTFTSHTPGEHQICLHSNSTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1846", "url": "https://glyconnect.expasy.org/browser/proteins/1846" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "5", "chr_pos": "177593738", "evidence": [ { "id": "rs755812768", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755812768" }, { "id": "rs755812768", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755812768#frequency_tab" }, { "id": "rs755812768", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755812768" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "5", "chr_pos": "177593738", "evidence": [ { "id": "rs755812768", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755812768" }, { "id": "rs755812768", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755812768#frequency_tab" }, { "id": "rs755812768", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755812768" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1846", "url": "https://glyconnect.expasy.org/browser/proteins/1846" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "183", "site_seq": "LNnITIIGPLDMK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "183", "site_seq": "LNNITIIGPLDMK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "290", "site_seq": "EADnHTAFIR", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92545-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1850", "url": "https://glyconnect.expasy.org/browser/proteins/1850" } ], "protein_name": "Transmembrane protein 131", "gene_name": "TMEM131", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1883, "chemical_mass": 205138.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92545-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1850", "url": "https://glyconnect.expasy.org/browser/proteins/1850" } ], "protein_name": "Transmembrane protein 131", "gene_name": "TMEM131", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1883, "chemical_mass": 205138.0 } ] }, { "start_pos": "290", "site_seq": "EADNHTAFIR", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92545-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1850", "url": "https://glyconnect.expasy.org/browser/proteins/1850" } ], "protein_name": "Transmembrane protein 131", "gene_name": "TMEM131", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1883, "chemical_mass": 205138.0 } ] }, { "start_pos": "290", "site_seq": "", "site_lbl": "N290", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->YHT).", "chr_id": "2", "chr_pos": "97834862", "evidence": [ { "id": "Q92545", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92545" }, { "id": "rs747879544", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747879544" }, { "id": "rs747879544", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747879544" }, { "id": "rs747879544", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747879544" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92545-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1850", "url": "https://glyconnect.expasy.org/browser/proteins/1850" } ], "protein_name": "Transmembrane protein 131", "gene_name": "TMEM131", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1883, "chemical_mass": 205138.0 } ] }, { "start_pos": "551", "site_seq": "VnNTAVIEK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "551", "site_seq": "ILGDKVnNTAVIEK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "551", "site_seq": "ILGDKVNNTAVIEK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "NVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "nVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "", "site_lbl": "N575", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "9", "chr_pos": "109057321", "evidence": [ { "id": "rs1828869914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1828869914" }, { "id": "rs1828869914", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1828869914#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "62", "site_seq": "nTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "NTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "15", "chr_pos": "42272084", "evidence": [ { "id": "rs750301944", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750301944" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "313", "site_seq": "HEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQR", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1858", "url": "https://glyconnect.expasy.org/browser/proteins/1858" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1858", "url": "https://glyconnect.expasy.org/browser/proteins/1858" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "", "site_lbl": "N313", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->nullES).", "chr_id": "11", "chr_pos": "6616451_6616452", "evidence": [ { "id": "rs886041487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs886041487" } ], "disease": [ { "disease_id": "DOID:0110726", "name": "neuronal ceroid lipofuscinosis 2", "description": "A neuronal ceroid lipofuscinosis that is characterized by 'curvilinear' profile lipopigment pattern and has_material_basis_in homozygous or compound heterozygous mutation in the TPP1 gene on chromosome 11p15.", "url": "http://disease-ontology.org/term/DOID:0110726", "evidence": [ { "id": "204500", "database": "MIM", "url": "https://www.omim.org/entry/204500" }, { "id": "0110726", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110726" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1858", "url": "https://glyconnect.expasy.org/browser/proteins/1858" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "1242111", "evidence": [ { "id": "rs1567573948", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567573948" }, { "id": "rs1567573948", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567573948" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "161", "site_seq": "AINQGNYGWQAGnHSAFWGMTLDEGIR", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1864", "url": "https://glyconnect.expasy.org/browser/proteins/1864" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "161", "site_seq": "N", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1864", "url": "https://glyconnect.expasy.org/browser/proteins/1864" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "161", "site_seq": "", "site_lbl": "N161", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->DHS).", "chr_id": "1", "chr_pos": "31583474", "evidence": [ { "id": "rs758662209", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758662209" }, { "id": "rs758662209", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758662209" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1864", "url": "https://glyconnect.expasy.org/browser/proteins/1864" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "120", "site_seq": "QCnQTSVCWCVNSVGVR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09758-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1865", "url": "https://glyconnect.expasy.org/browser/proteins/1865" } ], "protein_name": "Tumor-associated calcium signal transducer 2", "gene_name": "TACSTD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35709.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09758-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1865", "url": "https://glyconnect.expasy.org/browser/proteins/1865" } ], "protein_name": "Tumor-associated calcium signal transducer 2", "gene_name": "TACSTD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35709.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "1", "chr_pos": "58576799", "evidence": [ { "id": "rs1008163872", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1008163872" }, { "id": "rs1008163872", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1008163872" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P09758-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1865", "url": "https://glyconnect.expasy.org/browser/proteins/1865" } ], "protein_name": "Tumor-associated calcium signal transducer 2", "gene_name": "TACSTD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35709.0 } ] }, { "start_pos": "81", "site_seq": "nYSDTPPTSK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZX9-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1867", "url": "https://glyconnect.expasy.org/browser/proteins/1867" } ], "protein_name": "Twisted gastrulation protein homolog 1", "gene_name": "TWSG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25017.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZX9-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1867", "url": "https://glyconnect.expasy.org/browser/proteins/1867" } ], "protein_name": "Twisted gastrulation protein homolog 1", "gene_name": "TWSG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25017.0 } ] }, { "start_pos": "81", "site_seq": "NYSDTPPTSK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZX9-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1867", "url": "https://glyconnect.expasy.org/browser/proteins/1867" } ], "protein_name": "Twisted gastrulation protein homolog 1", "gene_name": "TWSG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25017.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12866-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1870", "url": "https://glyconnect.expasy.org/browser/proteins/1870" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 110249.0 } ] }, { "start_pos": "207", "site_seq": "QPESMnVTR", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12866-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1870", "url": "https://glyconnect.expasy.org/browser/proteins/1870" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 110249.0 } ] }, { "start_pos": "207", "site_seq": "QPESMNVTR", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12866-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1870", "url": "https://glyconnect.expasy.org/browser/proteins/1870" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 110249.0 } ] }, { "start_pos": "207", "site_seq": "", "site_lbl": "N207", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "111947430", "evidence": [ { "id": "rs933552461", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs933552461" }, { "id": "rs933552461", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs933552461#frequency_tab" }, { "id": "rs933552461", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs933552461" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12866-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1870", "url": "https://glyconnect.expasy.org/browser/proteins/1870" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 110249.0 } ] }, { "start_pos": "269", "site_seq": "GTEVnTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1871", "url": "https://glyconnect.expasy.org/browser/proteins/1871" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVNTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1871", "url": "https://glyconnect.expasy.org/browser/proteins/1871" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1871", "url": "https://glyconnect.expasy.org/browser/proteins/1871" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "", "site_lbl": "N269", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "128116277", "evidence": [ { "id": "rs1688096150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688096150" }, { "id": "rs1688096150", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688096150" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1871", "url": "https://glyconnect.expasy.org/browser/proteins/1871" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "347", "site_seq": "N", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22309-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1873", "url": "https://glyconnect.expasy.org/browser/proteins/1873" } ], "protein_name": "UDP-glucuronosyltransferase 1A1", "gene_name": "UGT1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59591.0 } ] }, { "start_pos": "347", "site_seq": "", "site_lbl": "N347", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P22309-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1873", "url": "https://glyconnect.expasy.org/browser/proteins/1873" } ], "protein_name": "UDP-glucuronosyltransferase 1A1", "gene_name": "UGT1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 59591.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW8-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1874", "url": "https://glyconnect.expasy.org/browser/proteins/1874" } ], "protein_name": "UDP-glucuronosyltransferase 1A10", "gene_name": "UGT1A10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59810.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW8-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1874", "url": "https://glyconnect.expasy.org/browser/proteins/1874" } ], "protein_name": "UDP-glucuronosyltransferase 1A10", "gene_name": "UGT1A10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59810.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1875", "url": "https://glyconnect.expasy.org/browser/proteins/1875" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1875", "url": "https://glyconnect.expasy.org/browser/proteins/1875" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1875", "url": "https://glyconnect.expasy.org/browser/proteins/1875" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22310-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1876", "url": "https://glyconnect.expasy.org/browser/proteins/1876" } ], "protein_name": "UDP-glucuronosyltransferase 1A4", "gene_name": "UGT1A4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60025.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P22310-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1876", "url": "https://glyconnect.expasy.org/browser/proteins/1876" } ], "protein_name": "UDP-glucuronosyltransferase 1A4", "gene_name": "UGT1A4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60025.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35504-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1877", "url": "https://glyconnect.expasy.org/browser/proteins/1877" } ], "protein_name": "UDP-glucuronosyltransferase 1A5", "gene_name": "UGT1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60071.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35504-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1877", "url": "https://glyconnect.expasy.org/browser/proteins/1877" } ], "protein_name": "UDP-glucuronosyltransferase 1A5", "gene_name": "UGT1A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60071.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19224-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1878", "url": "https://glyconnect.expasy.org/browser/proteins/1878" } ], "protein_name": "UDP-glucuronosyltransferase 1A6", "gene_name": "UGT1A6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 60751.0 } ] }, { "start_pos": "346", "site_seq": "", "site_lbl": "N346", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19224-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1878", "url": "https://glyconnect.expasy.org/browser/proteins/1878" } ], "protein_name": "UDP-glucuronosyltransferase 1A6", "gene_name": "UGT1A6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 60751.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW7-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1879", "url": "https://glyconnect.expasy.org/browser/proteins/1879" } ], "protein_name": "UDP-glucuronosyltransferase 1A7", "gene_name": "UGT1A7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59819.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW7-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1879", "url": "https://glyconnect.expasy.org/browser/proteins/1879" } ], "protein_name": "UDP-glucuronosyltransferase 1A7", "gene_name": "UGT1A7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59819.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW9-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1880", "url": "https://glyconnect.expasy.org/browser/proteins/1880" } ], "protein_name": "UDP-glucuronosyltransferase 1A8", "gene_name": "UGT1A8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59742.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAW9-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1880", "url": "https://glyconnect.expasy.org/browser/proteins/1880" } ], "protein_name": "UDP-glucuronosyltransferase 1A8", "gene_name": "UGT1A8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59742.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60656-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1881", "url": "https://glyconnect.expasy.org/browser/proteins/1881" } ], "protein_name": "UDP-glucuronosyltransferase 1A9", "gene_name": "UGT1A9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59941.0 } ] }, { "start_pos": "344", "site_seq": "PSNLANNTILVK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60656-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1881", "url": "https://glyconnect.expasy.org/browser/proteins/1881" } ], "protein_name": "UDP-glucuronosyltransferase 1A9", "gene_name": "UGT1A9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59941.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60656-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1881", "url": "https://glyconnect.expasy.org/browser/proteins/1881" } ], "protein_name": "UDP-glucuronosyltransferase 1A9", "gene_name": "UGT1A9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 530, "chemical_mass": 59941.0 } ] }, { "start_pos": "672", "site_seq": "N", "site_lbl": "Asn672", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXG2-1", "start_pos": 672, "end_pos": 672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1884", "url": "https://glyconnect.expasy.org/browser/proteins/1884" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator 1", "gene_name": "ELAPOR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1013, "chemical_mass": 111382.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXG2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1884", "url": "https://glyconnect.expasy.org/browser/proteins/1884" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator 1", "gene_name": "ELAPOR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1013, "chemical_mass": 111382.0 } ] }, { "start_pos": "672", "site_seq": "", "site_lbl": "N672", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS); n-glyco-sequon-gain (NYN->NYS).", "chr_id": "1", "chr_pos": "109194488", "evidence": [ { "id": "rs764345948", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764345948" }, { "id": "rs764345948", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764345948" }, { "id": "rs764345948", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764345948" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXG2-1", "start_pos": 672, "end_pos": 672, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1884", "url": "https://glyconnect.expasy.org/browser/proteins/1884" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator 1", "gene_name": "ELAPOR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1013, "chemical_mass": 111382.0 } ] }, { "start_pos": "717", "site_seq": "", "site_lbl": "N717", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "1", "chr_pos": "109197503", "evidence": [ { "id": "rs1653884098", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1653884098" }, { "id": "rs1653884098", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1653884098" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXG2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1884", "url": "https://glyconnect.expasy.org/browser/proteins/1884" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator 1", "gene_name": "ELAPOR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1013, "chemical_mass": 111382.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z4R8-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1885", "url": "https://glyconnect.expasy.org/browser/proteins/1885" } ], "protein_name": "UPF0669 protein C6orf120", "gene_name": "C6orf120", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 191, "chemical_mass": 20772.0 } ] }, { "start_pos": "112", "site_seq": "TAVFADQVIVGnASLR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7D3-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1897", "url": "https://glyconnect.expasy.org/browser/proteins/1897" } ], "protein_name": "V-set domain-containing T-cell activation inhibitor 1", "gene_name": "VTCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 282, "chemical_mass": 30878.0 } ] }, { "start_pos": "112", "site_seq": "N", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7D3-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1897", "url": "https://glyconnect.expasy.org/browser/proteins/1897" } ], "protein_name": "V-set domain-containing T-cell activation inhibitor 1", "gene_name": "VTCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 282, "chemical_mass": 30878.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "170", "site_seq": "LNASLPALLLIR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "170", "site_seq": "LnASLPALLLIR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "273", "site_seq": "ILFWAQnFSVAYK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "273", "site_seq": "ILFWAQNFSVAYK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->IAS).", "chr_id": "X", "chr_pos": "154432411", "evidence": [ { "id": "rs146873302", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146873302" }, { "id": "rs146873302", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146873302#frequency_tab" }, { "id": "rs146873302", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146873302" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "X", "chr_pos": "154432411", "evidence": [ { "id": "rs146873302", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146873302" }, { "id": "rs146873302", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146873302#frequency_tab" }, { "id": "rs146873302", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146873302" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15904-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1900", "url": "https://glyconnect.expasy.org/browser/proteins/1900" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 52026.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "106", "site_seq": "FnLTETSEAEIHQSFQHLLR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "94614759", "evidence": [ { "id": "rs1885922817", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1885922817" }, { "id": "rs1885922817", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1885922817" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "746", "site_seq": "CLYGEAYPACSPGnTSTAEEELCR", "site_lbl": "Asn746", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O76024-1", "start_pos": 746, "end_pos": 746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1903", "url": "https://glyconnect.expasy.org/browser/proteins/1903" } ], "protein_name": "Wolframin", "gene_name": "WFS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 100292.0 } ] }, { "start_pos": "746", "site_seq": "N", "site_lbl": "Asn746", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O76024-1", "start_pos": 746, "end_pos": 746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1903", "url": "https://glyconnect.expasy.org/browser/proteins/1903" } ], "protein_name": "Wolframin", "gene_name": "WFS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 100292.0 } ] }, { "start_pos": "746", "site_seq": "CLYGEAYPACSPGNTSTAEEELCR", "site_lbl": "Asn746", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O76024-1", "start_pos": 746, "end_pos": 746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1903", "url": "https://glyconnect.expasy.org/browser/proteins/1903" } ], "protein_name": "Wolframin", "gene_name": "WFS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 100292.0 } ] }, { "start_pos": "746", "site_seq": "", "site_lbl": "N746", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "4", "chr_pos": "6302033", "evidence": [ { "id": "rs1373506779", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1373506779" }, { "id": "rs1373506779", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1373506779" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "4", "chr_pos": "6302032", "evidence": [ { "id": "rs2109127276", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2109127276" }, { "id": "rs2109127276", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2109127276" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O76024-1", "start_pos": 746, "end_pos": 746, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1903", "url": "https://glyconnect.expasy.org/browser/proteins/1903" } ], "protein_name": "Wolframin", "gene_name": "WFS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 100292.0 } ] }, { "start_pos": "76", "site_seq": "N", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "NVTSESTCCVAK", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "NVTSESTCCVAK", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "", "site_lbl": "N76", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "6", "chr_pos": "87086296", "evidence": [ { "id": "rs373317335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373317335" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Increases from 1 to 3 the number of FSH binding a single FSHR receptor.", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprotkb/P01215" }, { "database": "PubMed", "id": "24692546", "url": "https://glygen.org/publication/PubMed/24692546" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "20030399", "url": "https://glygen.org/publication/PubMed/20030399" }, { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "N144", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "20030399", "url": "https://glygen.org/publication/PubMed/20030399" }, { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "", "site_lbl": "N144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "105708020", "evidence": [ { "id": "P01876", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01876" }, { "id": "rs745327941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745327941#frequency_tab" }, { "id": "rs745327941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745327941" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "14", "chr_pos": "105708021", "evidence": [ { "id": "rs1296586332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1296586332" }, { "id": "rs1296586332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1296586332" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "20030399", "url": "https://glygen.org/publication/PubMed/20030399" }, { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "SCPACPGSnITIR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "NLRnMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "N", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "nMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "NMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "391", "site_seq": "ALLPFDNLHDDPCLLTnR", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "391", "site_seq": "N", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "17", "chr_pos": "58278062", "evidence": [ { "id": "P05164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05164" }, { "id": "rs1197536833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197536833" }, { "id": "rs1197536833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1197536833" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "17", "chr_pos": "58278063", "evidence": [ { "id": "rs200234386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200234386#frequency_tab" }, { "id": "rs200234386", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200234386" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "", "site_lbl": "N355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "17", "chr_pos": "58277968", "evidence": [ { "id": "rs1970459950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1970459950" }, { "id": "rs1970459950", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1970459950#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "MAAALNATGR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42067244", "evidence": [ { "id": "rs374661289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374661289#frequency_tab" }, { "id": "rs374661289", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374661289" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42066778", "evidence": [ { "id": "rs749495971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749495971" }, { "id": "rs749495971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749495971#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "3336", "site_seq": "ELCTISHIFIPAMGnITYDFSFK", "site_lbl": "Asn3336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3336, "end_pos": 3336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3336", "site_seq": "N", "site_lbl": "Asn3336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3336, "end_pos": 3336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3336", "site_seq": "LSLPDFKELCTISHIFIPAMGNITYDFSFK", "site_lbl": "Asn3336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3336, "end_pos": 3336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "", "site_lbl": "N1365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "P01266", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01266" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "132911468", "evidence": [ { "id": "rs1819515531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1819515531" }, { "id": "rs1819515531", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1819515531" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "rs142264604", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142264604#frequency_tab" }, { "id": "rs142264604", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142264604" } ], "disease": [ { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "152", "site_seq": "N", "site_lbl": "Asn152", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "152", "site_seq": "", "site_lbl": "N152", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "8", "chr_pos": "42187481", "evidence": [ { "id": "rs757621967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757621967" }, { "id": "rs757621967", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757621967" }, { "id": "rs757621967", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757621967" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "131", "site_seq": "VPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLR", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "N205", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "131", "site_seq": "", "site_lbl": "N131", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "105587789", "evidence": [ { "id": "rs2085474772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085474772" }, { "id": "rs2085474772", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085474772#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "14", "chr_pos": "105587567", "evidence": [ { "id": "rs2085466217", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085466217" }, { "id": "rs2085466217", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085466217#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "14", "chr_pos": "105587568", "evidence": [ { "id": "rs558289293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs558289293" }, { "id": "rs558289293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs558289293" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "270", "site_seq": "AENQVnVTCQVR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "270", "site_seq": "VPPTLEVTQQPVRAENQVnVTCQVR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "20", "chr_pos": "1922367", "evidence": [ { "id": "rs1417859969", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1417859969" }, { "id": "rs1417859969", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1417859969" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "226", "site_seq": "N", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0C0L4-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "651", "url": "https://glyconnect.expasy.org/browser/proteins/651" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1744, "chemical_mass": 192785.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "rs1175912363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175912363" }, { "id": "rs1175912363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175912363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "P98160", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "130", "site_seq": "MATPLLMQALPMGALPQGPMQnATK", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "659", "url": "https://glyconnect.expasy.org/browser/proteins/659" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "659", "url": "https://glyconnect.expasy.org/browser/proteins/659" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "136", "site_seq": "YGnMTEDHVMHLLQNADPLK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "659", "url": "https://glyconnect.expasy.org/browser/proteins/659" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "659", "url": "https://glyconnect.expasy.org/browser/proteins/659" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->YAT).", "chr_id": "5", "chr_pos": "150406312", "evidence": [ { "id": "rs1234104385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234104385" }, { "id": "rs1234104385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234104385" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "659", "url": "https://glyconnect.expasy.org/browser/proteins/659" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "500", "site_seq": "nLSGPDK", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "500", "site_seq": "N", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "500", "site_seq": "nLSGPDKR", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "500", "site_seq": "NLSGPDKR", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "500", "site_seq": "", "site_lbl": "N500", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "16", "chr_pos": "4382377", "evidence": [ { "id": "Q6EMK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6EMK4" }, { "id": "rs1443611996", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443611996" }, { "id": "rs1443611996", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1443611996#frequency_tab" }, { "id": "rs1443611996", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443611996" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "4382376", "evidence": [ { "id": "Q6EMK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6EMK4" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGnVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "679", "url": "https://glyconnect.expasy.org/browser/proteins/679" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "679", "url": "https://glyconnect.expasy.org/browser/proteins/679" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGNVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "679", "url": "https://glyconnect.expasy.org/browser/proteins/679" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "7", "chr_pos": "99968386", "evidence": [ { "id": "rs191613328", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" }, { "id": "rs191613328", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191613328" }, { "id": "rs191613328", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "7", "chr_pos": "99968384", "evidence": [ { "id": "rs8192465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs8192465" }, { "id": "rs8192465", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs8192465#frequency_tab" }, { "id": "rs8192465", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs8192465" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "167", "site_seq": "nQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "710", "url": "https://glyconnect.expasy.org/browser/proteins/710" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "710", "url": "https://glyconnect.expasy.org/browser/proteins/710" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "710", "url": "https://glyconnect.expasy.org/browser/proteins/710" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "15", "chr_pos": "77052862", "evidence": [ { "id": "rs2076741164", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2076741164" }, { "id": "rs2076741164", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2076741164" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "710", "url": "https://glyconnect.expasy.org/browser/proteins/710" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "661", "site_seq": "N", "site_lbl": "Asn661", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14118-1", "start_pos": 661, "end_pos": 661, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "715", "url": "https://glyconnect.expasy.org/browser/proteins/715" } ], "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 895, "chemical_mass": 97441.0 } ] }, { "start_pos": "661", "site_seq": "GSIVVEWTNNTLPLEPCPK", "site_lbl": "Asn661", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14118-1", "start_pos": 661, "end_pos": 661, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "715", "url": "https://glyconnect.expasy.org/browser/proteins/715" } ], "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 895, "chemical_mass": 97441.0 } ] }, { "start_pos": "661", "site_seq": "GSIVVEWTnNTLPLEPCPK", "site_lbl": "Asn661", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14118-1", "start_pos": 661, "end_pos": 661, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "715", "url": "https://glyconnect.expasy.org/browser/proteins/715" } ], "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 895, "chemical_mass": 97441.0 } ] }, { "start_pos": "661", "site_seq": "", "site_lbl": "N661", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "3", "chr_pos": "49532492", "evidence": [ { "id": "rs765933260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765933260" }, { "id": "rs765933260", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs765933260" } ], "disease": [ { "disease_id": "DOID:0110293", "name": "autosomal recessive limb-girdle muscular dystrophy type 2P", "description": "An autosomal recessive limb-girdle muscular dystrophy that has_material_basis_in homozygous mutation in the gene encoding alpha-dystroglycan (DAG1) on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0110293", "evidence": [ { "id": "613818", "database": "MIM", "url": "https://www.omim.org/entry/613818" }, { "id": "0110293", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110293" } ] }, { "disease_id": "DOID:0110293", "name": "autosomal recessive limb-girdle muscular dystrophy type 2P", "description": "An autosomal recessive limb-girdle muscular dystrophy that has_material_basis_in homozygous mutation in the gene encoding alpha-dystroglycan (DAG1) on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0110293", "evidence": [ { "id": "613818", "database": "MIM", "url": "https://www.omim.org/entry/613818" }, { "id": "0110293", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110293" } ] }, { "disease_id": "DOID:0111232", "name": "congenital muscular dystrophy-dystroglycanopathy type A9", "description": "A congenital muscular dystrophy-dystroglycanopathy type A that has_material_basis_in homozygous or compound heterozygous mutation in DAG1 on 3p21.31.", "url": "http://disease-ontology.org/term/DOID:0111232", "evidence": [ { "id": "616538", "database": "MIM", "url": "https://www.omim.org/entry/616538" }, { "id": "0111232", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111232" } ] }, { "disease_id": "DOID:0111232", "name": "congenital muscular dystrophy-dystroglycanopathy type A9", "description": "A congenital muscular dystrophy-dystroglycanopathy type A that has_material_basis_in homozygous or compound heterozygous mutation in DAG1 on 3p21.31.", "url": "http://disease-ontology.org/term/DOID:0111232", "evidence": [ { "id": "616538", "database": "MIM", "url": "https://www.omim.org/entry/616538" }, { "id": "0111232", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111232" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "3", "chr_pos": "49532493_49532494delin", "evidence": [ { "id": "rs2051384851", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2051384851" }, { "id": "rs2051384851", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2051384851" } ], "disease": [ { "disease_id": "DOID:0110293", "name": "autosomal recessive limb-girdle muscular dystrophy type 2P", "description": "An autosomal recessive limb-girdle muscular dystrophy that has_material_basis_in homozygous mutation in the gene encoding alpha-dystroglycan (DAG1) on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0110293", "evidence": [ { "id": "613818", "database": "MIM", "url": "https://www.omim.org/entry/613818" }, { "id": "0110293", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110293" } ] }, { "disease_id": "DOID:0110293", "name": "autosomal recessive limb-girdle muscular dystrophy type 2P", "description": "An autosomal recessive limb-girdle muscular dystrophy that has_material_basis_in homozygous mutation in the gene encoding alpha-dystroglycan (DAG1) on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0110293", "evidence": [ { "id": "613818", "database": "MIM", "url": "https://www.omim.org/entry/613818" }, { "id": "0110293", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110293" } ] }, { "disease_id": "DOID:0111232", "name": "congenital muscular dystrophy-dystroglycanopathy type A9", "description": "A congenital muscular dystrophy-dystroglycanopathy type A that has_material_basis_in homozygous or compound heterozygous mutation in DAG1 on 3p21.31.", "url": "http://disease-ontology.org/term/DOID:0111232", "evidence": [ { "id": "616538", "database": "MIM", "url": "https://www.omim.org/entry/616538" }, { "id": "0111232", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111232" } ] }, { "disease_id": "DOID:0111232", "name": "congenital muscular dystrophy-dystroglycanopathy type A9", "description": "A congenital muscular dystrophy-dystroglycanopathy type A that has_material_basis_in homozygous or compound heterozygous mutation in DAG1 on 3p21.31.", "url": "http://disease-ontology.org/term/DOID:0111232", "evidence": [ { "id": "616538", "database": "MIM", "url": "https://www.omim.org/entry/616538" }, { "id": "0111232", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111232" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "3", "chr_pos": "49532494", "evidence": [ { "id": "rs1218383460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1218383460" }, { "id": "rs1218383460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1218383460" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14118-1", "start_pos": 661, "end_pos": 661, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "715", "url": "https://glyconnect.expasy.org/browser/proteins/715" } ], "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 895, "chemical_mass": 97441.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSSEMGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "140", "site_seq": "LEnLSSSEMGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVEnMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVENMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "GVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "N", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "RGVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "869", "site_seq": "SLGNVNFTVSAEALESQELCGTEVPSVPEHGR", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "63", "site_seq": "YFNYTVK", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "63", "site_seq": "YFnYTVK", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "FLRYnCSIESPR", "site_lbl": "Asn696", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "N", "site_lbl": "Asn696", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "YnCSIESPR", "site_lbl": "Asn696", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "YnCSIESPRK", "site_lbl": "Asn696", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "YNCSIESPR", "site_lbl": "Asn696", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "3", "chr_pos": "146124150", "evidence": [ { "id": "rs757997471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757997471" }, { "id": "rs757997471", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757997471" }, { "id": "rs757997471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757997471#frequency_tab" }, { "id": "rs757997471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757997471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "3", "chr_pos": "146124151", "evidence": [ { "id": "rs528029426", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528029426" }, { "id": "rs528029426", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs528029426" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->YYT).", "chr_id": "NC_000003.12", "chr_pos": "146124152", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "696", "site_seq": "", "site_lbl": "N696", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "3", "chr_pos": "146070845", "evidence": [ { "id": "rs769059398", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769059398" }, { "id": "rs769059398", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769059398" }, { "id": "rs769059398", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769059398#frequency_tab" }, { "id": "rs769059398", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769059398" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "3", "chr_pos": "146070844", "evidence": [ { "id": "rs1171673791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1171673791" }, { "id": "rs1171673791", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1171673791#frequency_tab" }, { "id": "rs1171673791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1171673791" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00469-1", "start_pos": 696, "end_pos": 696, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "746", "url": "https://glyconnect.expasy.org/browser/proteins/746" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2", "gene_name": "PLOD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 737, "chemical_mass": 84686.0 } ] }, { "start_pos": "367", "site_seq": "AnLTWSVK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "367", "site_seq": "ANLTWSVK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "930", "site_seq": "LEHQFAVGEDSGRnLSAPVTLNLR", "site_lbl": "Asn930", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 930, "end_pos": 930, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "930", "site_seq": "N", "site_lbl": "Asn930", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 930, "end_pos": 930, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "930", "site_seq": "nLSAPVTLNLR", "site_lbl": "Asn930", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 930, "end_pos": 930, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "775", "url": "https://glyconnect.expasy.org/browser/proteins/775" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "247", "site_seq": "HLnGTITAK", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "247", "site_seq": "HLNGTITAK", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "287", "site_seq": "InGSANFSFNDEEMK", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "287", "site_seq": "N", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "287", "site_seq": "INGSANFSFNDEEMK", "site_lbl": "Asn287", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "337", "site_seq": "N", "site_lbl": "Asn337", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 337, "end_pos": 337, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "337", "site_seq": "nVSTNVFFK", "site_lbl": "Asn337", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 337, "end_pos": 337, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "337", "site_seq": "NVSTNVFFK", "site_lbl": "Asn337", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 337, "end_pos": 337, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "247", "site_seq": "", "site_lbl": "N247", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "6", "chr_pos": "73759010", "evidence": [ { "id": "rs751957646", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751957646" }, { "id": "rs751957646", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751957646" }, { "id": "rs751957646", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751957646#frequency_tab" }, { "id": "rs751957646", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751957646" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "287", "site_seq": "", "site_lbl": "N287", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "6", "chr_pos": "73762744", "evidence": [ { "id": "Q6YHK3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6YHK3" }, { "id": "rs1773682234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1773682234" }, { "id": "rs1773682234", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1773682234" }, { "id": "rs1773682234", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1773682234" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 287, "end_pos": 287, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "183", "site_seq": "YYnYTLSINGK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "183", "site_seq": "YYNYTLSINGK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "279", "site_seq": "TPMTnSSIQFLDNAFR", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "279", "site_seq": "TPMTNSSIQFLDNAFR", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "279", "site_seq": "TPMTnSSIQFLDNAFRK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "317", "site_seq": "N", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "317", "site_seq": "RLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKR", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "405", "site_seq": "GASnLTWR", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "405", "site_seq": "N", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "405", "site_seq": "GASNLTWR", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "64744885", "evidence": [ { "id": "rs774174423", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774174423" }, { "id": "rs774174423", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774174423" }, { "id": "rs774174423", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774174423" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "12", "chr_pos": "64740646", "evidence": [ { "id": "rs2539521331", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2539521331" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "317", "site_seq": "", "site_lbl": "N317", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "12", "chr_pos": "64739425", "evidence": [ { "id": "rs2136245502", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136245502" }, { "id": "rs2136245502", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136245502" } ], "disease": [ { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "405", "site_seq": "", "site_lbl": "N405", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "12", "chr_pos": "64723099", "evidence": [ { "id": "rs1425989538", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1425989538" }, { "id": "rs1425989538", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1425989538" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "64723100", "evidence": [ { "id": "rs1869084105", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869084105" }, { "id": "rs1869084105", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1869084105#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" }, { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "AGPnGTLFVADAYK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" }, { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "196", "site_seq": "nMSFVNDLTVTQDGR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "196", "site_seq": "nMSFVNDLTVTQDGRK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "20", "chr_pos": "24971519", "evidence": [ { "id": "rs149732546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149732546" }, { "id": "rs149732546", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149732546#frequency_tab" }, { "id": "rs149732546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149732546" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" }, { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->KMS).", "chr_id": "20", "chr_pos": "24970322", "evidence": [ { "id": "rs2122491348", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2122491348" }, { "id": "rs2122491348", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2122491348" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "261", "site_seq": "VFPQVnVTK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "261", "site_seq": "VFPQVNVTK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "503", "site_seq": "SVYnCSGEACR", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "503", "site_seq": "N", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "503", "site_seq": "SVYNCSGEACR", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "N234", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "15", "chr_pos": "89805376", "evidence": [ { "id": "rs1338821581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338821581" }, { "id": "rs1338821581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338821581" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "15", "chr_pos": "89805377", "evidence": [ { "id": "rs1173509041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1173509041" }, { "id": "rs1173509041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1173509041#frequency_tab" }, { "id": "rs1173509041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1173509041" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "333", "site_seq": "NLGnNTK", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16880-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "980", "url": "https://glyconnect.expasy.org/browser/proteins/980" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "UGT8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 61438.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16880-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "980", "url": "https://glyconnect.expasy.org/browser/proteins/980" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "UGT8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 61438.0 } ] }, { "start_pos": "215", "site_seq": "InSTEAR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PK18-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "981", "url": "https://glyconnect.expasy.org/browser/proteins/981" } ], "protein_name": "2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3", "gene_name": "OGFOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 319, "chemical_mass": 35646.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PK18-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "981", "url": "https://glyconnect.expasy.org/browser/proteins/981" } ], "protein_name": "2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3", "gene_name": "OGFOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 319, "chemical_mass": 35646.0 } ] }, { "start_pos": "215", "site_seq": "", "site_lbl": "N215", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "17", "chr_pos": "82403992", "evidence": [ { "id": "rs765926113", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765926113" }, { "id": "rs765926113", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765926113" }, { "id": "rs765926113", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765926113#frequency_tab" }, { "id": "rs765926113", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765926113" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "17", "chr_pos": "82403993", "evidence": [ { "id": "rs1315508747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1315508747" }, { "id": "rs1315508747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1315508747" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PK18-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "981", "url": "https://glyconnect.expasy.org/browser/proteins/981" } ], "protein_name": "2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3", "gene_name": "OGFOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 319, "chemical_mass": 35646.0 } ] }, { "start_pos": "259", "site_seq": "TVLEnSTSYEEAK", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "342", "site_seq": "N", "site_lbl": "Asn342", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "TSQEnISFETMYDVLSTKPVLNK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "259", "site_seq": "", "site_lbl": "N259", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "NC_000008.11", "chr_pos": "18059685", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "NC_000008.11", "chr_pos": "18061386", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "342", "site_seq": "", "site_lbl": "N342", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "8", "chr_pos": "18059358", "evidence": [ { "id": "rs372928199", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372928199" }, { "id": "rs372928199", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372928199" }, { "id": "rs372928199", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372928199#frequency_tab" }, { "id": "rs372928199", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372928199" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "8", "chr_pos": "18059356", "evidence": [ { "id": "rs1381116986", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1381116986" }, { "id": "rs1381116986", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1381116986#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "8", "chr_pos": "18059357", "evidence": [ { "id": "rs1157896386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1157896386" }, { "id": "rs1157896386", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1157896386#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "8", "chr_pos": "18059357", "evidence": [ { "id": "rs1157896386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1157896386" }, { "id": "rs1157896386", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1157896386#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "8", "chr_pos": "18058891", "evidence": [ { "id": "rs1799575422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799575422" }, { "id": "rs1799575422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799575422" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "8", "chr_pos": "18058890", "evidence": [ { "id": "rs781477468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781477468#frequency_tab" }, { "id": "rs781477468", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781477468" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->nullIS).", "chr_id": "8", "chr_pos": "18058888_18058891", "evidence": [ { "id": "rs2537913430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2537913430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "259", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "342", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15309-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "2001", "url": "https://glyconnect.expasy.org/browser/proteins/2001" } ], "protein_name": "Prostatic acid phosphatase", "gene_name": "ACP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 386, "chemical_mass": 44566.0 } ] }, { "start_pos": "333", "site_seq": "NETQHEPYPLMLPGCSPSCPLER", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15309-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "2001", "url": "https://glyconnect.expasy.org/browser/proteins/2001" } ], "protein_name": "Prostatic acid phosphatase", "gene_name": "ACP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 386, "chemical_mass": 44566.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "3", "chr_pos": "132356715", "evidence": [ { "id": "rs1284583988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1284583988" }, { "id": "rs1284583988", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1284583988#frequency_tab" }, { "id": "rs1284583988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1284583988" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15309-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "2001", "url": "https://glyconnect.expasy.org/browser/proteins/2001" } ], "protein_name": "Prostatic acid phosphatase", "gene_name": "ACP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 386, "chemical_mass": 44566.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43734-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2015", "url": "https://glyconnect.expasy.org/browser/proteins/2015" } ], "protein_name": "E3 ubiquitin ligase TRAF3IP2", "gene_name": "TRAF3IP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 64666.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "6", "chr_pos": "111591327", "evidence": [ { "id": "rs1562433144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1562433144" }, { "id": "rs1562433144", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1562433144#frequency_tab" } ], "disease": [ { "disease_id": "DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp.", "url": "http://disease-ontology.org/term/DOID:2058", "evidence": [ { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] }, { "disease_id": "DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp.", "url": "http://disease-ontology.org/term/DOID:2058", "evidence": [ { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "6", "chr_pos": "111591327", "evidence": [ { "id": "rs1562433144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1562433144" }, { "id": "rs1562433144", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1562433144#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "6", "chr_pos": "111591326", "evidence": [ { "id": "rs1463029619", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1463029619" }, { "id": "rs1463029619", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1463029619" } ], "disease": [ { "disease_id": "DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp.", "url": "http://disease-ontology.org/term/DOID:2058", "evidence": [ { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] }, { "disease_id": "DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp.", "url": "http://disease-ontology.org/term/DOID:2058", "evidence": [ { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" }, { "id": "2058", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->TLS).", "chr_id": "6", "chr_pos": "111591326", "evidence": [ { "id": "O43734", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O43734" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43734-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2015", "url": "https://glyconnect.expasy.org/browser/proteins/2015" } ], "protein_name": "E3 ubiquitin ligase TRAF3IP2", "gene_name": "TRAF3IP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 64666.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q10588-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2017", "url": "https://glyconnect.expasy.org/browser/proteins/2017" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2", "gene_name": "BST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35724.0 } ] }, { "start_pos": "192", "site_seq": "DSSGVIHVMLnGSEPTGAYPIK", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q10588-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2017", "url": "https://glyconnect.expasy.org/browser/proteins/2017" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2", "gene_name": "BST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35724.0 } ] }, { "start_pos": "192", "site_seq": "", "site_lbl": "N192", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "4", "chr_pos": "15715325", "evidence": [ { "id": "rs751309245", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751309245" }, { "id": "rs751309245", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751309245" }, { "id": "rs751309245", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751309245" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q10588-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2017", "url": "https://glyconnect.expasy.org/browser/proteins/2017" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2", "gene_name": "BST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35724.0 } ] }, { "start_pos": "436", "site_seq": "N", "site_lbl": "Asn436", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BY07-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2038", "url": "https://glyconnect.expasy.org/browser/proteins/2038" } ], "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1137, "chemical_mass": 126255.0 } ] }, { "start_pos": "436", "site_seq": "", "site_lbl": "N436", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "2", "chr_pos": "74252350", "evidence": [ { "id": "Q9BY07", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BY07" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BY07-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2038", "url": "https://glyconnect.expasy.org/browser/proteins/2038" } ], "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1137, "chemical_mass": 126255.0 } ] }, { "start_pos": "494", "site_seq": "LISnCSK", "site_lbl": "Asn494", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "742", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "494", "site_seq": "N", "site_lbl": "Asn494", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "742", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "494", "site_seq": "LISNCSK", "site_lbl": "Asn494", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "742", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "494", "site_seq": "", "site_lbl": "N494", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "4", "chr_pos": "109742544", "evidence": [ { "id": "rs1723931486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1723931486" }, { "id": "rs1723931486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1723931486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "742", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "470", "site_seq": "N", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08575-3", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30582698", "url": "https://glygen.org/publication/PubMed/30582698" }, { "database": "GlyConnect", "id": "339", "url": "https://glyconnect.expasy.org/browser/proteins/339" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase C", "gene_name": "PTPRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 147486.0 } ] }, { "start_pos": "26", "site_seq": "N", "site_lbl": "Asn26", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20827-1", "start_pos": 26, "end_pos": 26, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1209", "url": "https://glyconnect.expasy.org/browser/proteins/1209" } ], "protein_name": "Ephrin-A1", "gene_name": "EFNA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 205, "chemical_mass": 23787.0 } ] }, { "start_pos": "26", "site_seq": "HTVFWNSSNPK", "site_lbl": "Asn26", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20827-1", "start_pos": 26, "end_pos": 26, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1209", "url": "https://glyconnect.expasy.org/browser/proteins/1209" } ], "protein_name": "Ephrin-A1", "gene_name": "EFNA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 205, "chemical_mass": 23787.0 } ] }, { "start_pos": "322", "site_seq": "N", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22079-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2939", "url": "https://glyconnect.expasy.org/browser/proteins/2939" } ], "protein_name": "Lactoperoxidase", "gene_name": "LPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 712, "chemical_mass": 80288.0 } ] }, { "start_pos": "322", "site_seq": "", "site_lbl": "N322", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "17", "chr_pos": "58252367", "evidence": [ { "id": "rs184677751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184677751" }, { "id": "rs184677751", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs184677751" }, { "id": "rs184677751", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184677751" }, { "id": "rs184677751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs184677751" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P22079-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2939", "url": "https://glyconnect.expasy.org/browser/proteins/2939" } ], "protein_name": "Lactoperoxidase", "gene_name": "LPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 712, "chemical_mass": 80288.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "151", "site_seq": "LRnVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "N", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "nVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "554", "site_seq": "N", "site_lbl": "Asn554", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 554, "end_pos": 554, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32310329", "url": "https://glygen.org/publication/PubMed/32310329" }, { "database": "GlyConnect", "id": "1120", "url": "https://glyconnect.expasy.org/browser/proteins/1120" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08637-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "GlyConnect", "id": "3000", "url": "https://glyconnect.expasy.org/browser/proteins/3000" } ], "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 29089.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08637-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "GlyConnect", "id": "3000", "url": "https://glyconnect.expasy.org/browser/proteins/3000" } ], "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 29089.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "1", "chr_pos": "161544738", "evidence": [ { "id": "rs767421682", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767421682" }, { "id": "rs767421682", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767421682" }, { "id": "rs767421682", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767421682" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "1", "chr_pos": "161544740", "evidence": [ { "id": "rs1677303776", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1677303776" }, { "id": "rs1677303776", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1677303776#frequency_tab" }, { "id": "rs1677303776", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1677303776" }, { "id": "rs1677303776", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1677303776" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08637-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "GlyConnect", "id": "3000", "url": "https://glyconnect.expasy.org/browser/proteins/3000" } ], "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 29089.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->KES).", "chr_id": "NC_000001.11", "chr_pos": "161548551", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "1", "chr_pos": "161548552", "evidence": [ { "id": "rs772451890", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772451890" }, { "id": "rs772451890", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772451890" }, { "id": "rs772451890", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772451890" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08637-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "GlyConnect", "id": "3000", "url": "https://glyconnect.expasy.org/browser/proteins/3000" } ], "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 29089.0 } ] }, { "start_pos": "627", "site_seq": "N", "site_lbl": "Asn627", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PHS9-1", "start_pos": 627, "end_pos": 627, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2436", "url": "https://glyconnect.expasy.org/browser/proteins/2436" }, { "database": "GlyConnect", "id": "2821", "url": "https://glyconnect.expasy.org/browser/proteins/2821" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-2", "gene_name": "Cacna2d2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1154, "chemical_mass": 130385.0 } ] }, { "start_pos": "627", "site_seq": "NYTWVPIR", "site_lbl": "Asn627", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PHS9-1", "start_pos": 627, "end_pos": 627, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2436", "url": "https://glyconnect.expasy.org/browser/proteins/2436" }, { "database": "GlyConnect", "id": "2821", "url": "https://glyconnect.expasy.org/browser/proteins/2821" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-2", "gene_name": "Cacna2d2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1154, "chemical_mass": 130385.0 } ] }, { "start_pos": "627", "site_seq": "", "site_lbl": "N627", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "9", "chr_pos": "107394816", "evidence": [ { "id": "rs3389062911", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389062911" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PHS9-1", "start_pos": 627, "end_pos": 627, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2436", "url": "https://glyconnect.expasy.org/browser/proteins/2436" }, { "database": "GlyConnect", "id": "2821", "url": "https://glyconnect.expasy.org/browser/proteins/2821" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-2", "gene_name": "Cacna2d2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1154, "chemical_mass": 130385.0 } ] }, { "start_pos": "517", "site_seq": "EICSGNSSQCAPNVHK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2443", "url": "https://glyconnect.expasy.org/browser/proteins/2443" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2443", "url": "https://glyconnect.expasy.org/browser/proteins/2443" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2446", "url": "https://glyconnect.expasy.org/browser/proteins/2446" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2446", "url": "https://glyconnect.expasy.org/browser/proteins/2446" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "152", "site_seq": "N", "site_lbl": "Asn152", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JHP7-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2449", "url": "https://glyconnect.expasy.org/browser/proteins/2449" } ], "protein_name": "Protein O-glucosyltransferase 2", "gene_name": "Poglut2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 502, "chemical_mass": 57985.0 } ] }, { "start_pos": "152", "site_seq": "EMNCSETISQIQK", "site_lbl": "Asn152", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JHP7-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2449", "url": "https://glyconnect.expasy.org/browser/proteins/2449" } ], "protein_name": "Protein O-glucosyltransferase 2", "gene_name": "Poglut2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 502, "chemical_mass": 57985.0 } ] }, { "start_pos": "235", "site_seq": "N", "site_lbl": "Asn235", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88829-1", "start_pos": 235, "end_pos": 235, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2454", "url": "https://glyconnect.expasy.org/browser/proteins/2454" } ], "protein_name": "Lactosylceramide alpha-2,3-sialyltransferase", "gene_name": "St3gal5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 414, "chemical_mass": 47360.0 } ] }, { "start_pos": "235", "site_seq": "LNSAPVEGYSEHVGNK", "site_lbl": "Asn235", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88829-1", "start_pos": 235, "end_pos": 235, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2454", "url": "https://glyconnect.expasy.org/browser/proteins/2454" } ], "protein_name": "Lactosylceramide alpha-2,3-sialyltransferase", "gene_name": "St3gal5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 414, "chemical_mass": 47360.0 } ] }, { "start_pos": "235", "site_seq": "", "site_lbl": "N235", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "6", "chr_pos": "72124096", "evidence": [ { "id": "rs3388832286", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388832286" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O88829-1", "start_pos": 235, "end_pos": 235, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2454", "url": "https://glyconnect.expasy.org/browser/proteins/2454" } ], "protein_name": "Lactosylceramide alpha-2,3-sialyltransferase", "gene_name": "St3gal5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 414, "chemical_mass": 47360.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60675-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2456", "url": "https://glyconnect.expasy.org/browser/proteins/2456" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "Lama2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3118, "chemical_mass": 343815.0 } ] }, { "start_pos": "299", "site_seq": "ACPLDPATNK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60675-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2456", "url": "https://glyconnect.expasy.org/browser/proteins/2456" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "Lama2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3118, "chemical_mass": 343815.0 } ] }, { "start_pos": "100", "site_seq": "LVGGPVAGGDPNQTIQGQYCDICTAANSNK", "site_lbl": "Asn100", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 100, "end_pos": 100, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "100", "site_seq": "N", "site_lbl": "Asn100", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 100, "end_pos": 100, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "3261", "site_seq": "N", "site_lbl": "Asn3261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 3261, "end_pos": 3261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "3261", "site_seq": "LLLGGLPVSGTFHNFSGCISNVFVQR", "site_lbl": "Asn3261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 3261, "end_pos": 3261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "3291", "site_seq": "N", "site_lbl": "Asn3291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 3291, "end_pos": 3291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "3291", "site_seq": "VFDLHQNMGSVNVSVGCTPAQLIETSR", "site_lbl": "Asn3291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61001-1", "start_pos": 3291, "end_pos": 3291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2458", "url": "https://glyconnect.expasy.org/browser/proteins/2458" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "Lama5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3718, "chemical_mass": 404054.0 } ] }, { "start_pos": "1643", "site_seq": "QADEDIQGTQNLLTSIESETAASEETLTNASQR", "site_lbl": "Asn1643", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02469-1", "start_pos": 1643, "end_pos": 1643, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2459", "url": "https://glyconnect.expasy.org/browser/proteins/2459" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "Lamb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1786, "chemical_mass": 197090.0 } ] }, { "start_pos": "1643", "site_seq": "N", "site_lbl": "Asn1643", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02469-1", "start_pos": 1643, "end_pos": 1643, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2459", "url": "https://glyconnect.expasy.org/browser/proteins/2459" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "Lamb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1786, "chemical_mass": 197090.0 } ] }, { "start_pos": "1105", "site_seq": "VNSSLHSQISR", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1105", "site_seq": "N", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1203", "site_seq": "TANETSAEAYNLLLR", "site_lbl": "Asn1203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1203, "end_pos": 1203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1203", "site_seq": "N", "site_lbl": "Asn1203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1203, "end_pos": 1203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1437", "site_seq": "NATSTKADAER", "site_lbl": "Asn1437", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1437, "end_pos": 1437, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1437", "site_seq": "N", "site_lbl": "Asn1437", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1437, "end_pos": 1437, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89017-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2463", "url": "https://glyconnect.expasy.org/browser/proteins/2463" } ], "protein_name": "Legumain", "gene_name": "Lgmn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 435, "chemical_mass": 49373.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UY51-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2471", "url": "https://glyconnect.expasy.org/browser/proteins/2471" } ], "protein_name": "Leucine-rich repeat-containing protein 55", "gene_name": "Lrrc55", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 298, "chemical_mass": 33030.0 } ] }, { "start_pos": "69", "site_seq": "NLSLAHNR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UY51-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2471", "url": "https://glyconnect.expasy.org/browser/proteins/2471" } ], "protein_name": "Leucine-rich repeat-containing protein 55", "gene_name": "Lrrc55", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 298, "chemical_mass": 33030.0 } ] }, { "start_pos": "301", "site_seq": "N", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGY3-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2476", "url": "https://glyconnect.expasy.org/browser/proteins/2476" } ], "protein_name": "Leucine zipper protein 2", "gene_name": "Luzp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 345, "chemical_mass": 39020.0 } ] }, { "start_pos": "301", "site_seq": "RPSVCGPQDEGSSCLVKHEEGPQSNSTAESELTTQK", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGY3-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2476", "url": "https://glyconnect.expasy.org/browser/proteins/2476" } ], "protein_name": "Leucine zipper protein 2", "gene_name": "Luzp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 345, "chemical_mass": 39020.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "145", "site_seq": "TNQSAELIQPVATNGK", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "215", "site_seq": "DIILHSTGHNISR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "LNKSYIFIYDGNK", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "LNKSYIFIYDGNKNSTTTDQNFTSAK", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "3164", "site_seq": "N", "site_lbl": "Asn3164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 3164, "end_pos": 3164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2484", "url": "https://glyconnect.expasy.org/browser/proteins/2484" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "3164", "site_seq": "VGMDGTNQSVVIETK", "site_lbl": "Asn3164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 3164, "end_pos": 3164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2484", "url": "https://glyconnect.expasy.org/browser/proteins/2484" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSTESGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "470", "site_seq": "N", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16675-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2492", "url": "https://glyconnect.expasy.org/browser/proteins/2492" } ], "protein_name": "Lysosomal protective protein", "gene_name": "Ctsa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 474, "chemical_mass": 53844.0 } ] }, { "start_pos": "327", "site_seq": "SGDKVRLDPPCTNTTAPSNYLNNPYVR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16675-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2492", "url": "https://glyconnect.expasy.org/browser/proteins/2492" } ], "protein_name": "Lysosomal protective protein", "gene_name": "Ctsa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 474, "chemical_mass": 53844.0 } ] }, { "start_pos": "289", "site_seq": "N", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35448-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2493", "url": "https://glyconnect.expasy.org/browser/proteins/2493" } ], "protein_name": "Lysosomal thioesterase PPT2", "gene_name": "Ppt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 302, "chemical_mass": 34366.0 } ] }, { "start_pos": "289", "site_seq": "CPMAGISHTTWHSNR", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35448-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2493", "url": "https://glyconnect.expasy.org/browser/proteins/2493" } ], "protein_name": "Lysosomal thioesterase PPT2", "gene_name": "Ppt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 302, "chemical_mass": 34366.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "115", "site_seq": "GYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "159", "site_seq": "NVTVVLR", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "159", "site_seq": "N", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "252", "site_seq": "AFNISPNDTSSGSCGINLVTLK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "265", "site_seq": "VPFIFNINPATTNFTGSCQPQSAQLR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "X", "chr_pos": "37519881", "evidence": [ { "id": "rs3409514954", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3409514954" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D387-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2496", "url": "https://glyconnect.expasy.org/browser/proteins/2496" } ], "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "Lamp5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 280, "chemical_mass": 31721.0 } ] }, { "start_pos": "127", "site_seq": "ESHNTSKGPEATWNLNK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D387-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2496", "url": "https://glyconnect.expasy.org/browser/proteins/2496" } ], "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "Lamp5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 280, "chemical_mass": 31721.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35114-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2497", "url": "https://glyconnect.expasy.org/browser/proteins/2497" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "Scarb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 54044.0 } ] }, { "start_pos": "122", "site_seq": "NQSVGDPNVDLIR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35114-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2497", "url": "https://glyconnect.expasy.org/browser/proteins/2497" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "Scarb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 54044.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation site. No effect on normal location in lysosomes.", "evidence": [ { "database": "UniProtKB", "id": "O35114", "url": "https://www.uniprot.org/uniprotkb/O35114" }, { "database": "PubMed", "id": "24162852", "url": "https://glygen.org/publication/PubMed/24162852" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O35114-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2497", "url": "https://glyconnect.expasy.org/browser/proteins/2497" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "Scarb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 54044.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0PMG2-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2500", "url": "https://glyconnect.expasy.org/browser/proteins/2500" } ], "protein_name": "MAM domain-containing glycosylphosphatidylinositol anchor protein 1", "gene_name": "Mdga1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 956, "chemical_mass": 106047.0 } ] }, { "start_pos": "307", "site_seq": "DSGYYNCTATNNVGNPAK", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0PMG2-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2500", "url": "https://glyconnect.expasy.org/browser/proteins/2500" } ], "protein_name": "MAM domain-containing glycosylphosphatidylinositol anchor protein 1", "gene_name": "Mdga1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 956, "chemical_mass": 106047.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P60755-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2501", "url": "https://glyconnect.expasy.org/browser/proteins/2501" } ], "protein_name": "MAM domain-containing glycosylphosphatidylinositol anchor protein 2", "gene_name": "Mdga2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 949, "chemical_mass": 106689.0 } ] }, { "start_pos": "92", "site_seq": "FQDSSVFNETLR", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P60755-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2501", "url": "https://glyconnect.expasy.org/browser/proteins/2501" } ], "protein_name": "MAM domain-containing glycosylphosphatidylinositol anchor protein 2", "gene_name": "Mdga2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 949, "chemical_mass": 106689.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99M71-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2502", "url": "https://glyconnect.expasy.org/browser/proteins/2502" } ], "protein_name": "Mammalian ependymin-related protein 1", "gene_name": "Epdr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 224, "chemical_mass": 25485.0 } ] }, { "start_pos": "182", "site_seq": "NYTVVMSTR", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99M71-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2502", "url": "https://glyconnect.expasy.org/browser/proteins/2502" } ], "protein_name": "Mammalian ependymin-related protein 1", "gene_name": "Epdr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 224, "chemical_mass": 25485.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BI84-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2505", "url": "https://glyconnect.expasy.org/browser/proteins/2505" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "Mia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1930, "chemical_mass": 213675.0 } ] }, { "start_pos": "252", "site_seq": "TGNSSPASVER", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BI84-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2505", "url": "https://glyconnect.expasy.org/browser/proteins/2505" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "Mia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1930, "chemical_mass": 213675.0 } ] }, { "start_pos": "631", "site_seq": "N", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BI84-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2505", "url": "https://glyconnect.expasy.org/browser/proteins/2505" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "Mia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1930, "chemical_mass": 213675.0 } ] }, { "start_pos": "631", "site_seq": "NLSWQQEQDVAAVVGK", "site_lbl": "Asn631", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BI84-1", "start_pos": 631, "end_pos": 631, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2505", "url": "https://glyconnect.expasy.org/browser/proteins/2505" } ], "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "Mia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1930, "chemical_mass": 213675.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CIV2-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2506", "url": "https://glyconnect.expasy.org/browser/proteins/2506" } ], "protein_name": "Membralin", "gene_name": "Tmem259", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 574, "chemical_mass": 63561.0 } ] }, { "start_pos": "180", "site_seq": "VFKPQSGADALNDSQDFPFPETPAK", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CIV2-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2506", "url": "https://glyconnect.expasy.org/browser/proteins/2506" } ], "protein_name": "Membralin", "gene_name": "Tmem259", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 574, "chemical_mass": 63561.0 } ] }, { "start_pos": "89", "site_seq": "FNGSVSFFR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D1H9-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2512", "url": "https://glyconnect.expasy.org/browser/proteins/2512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "Mfap4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 257, "chemical_mass": 28938.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D1H9-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2512", "url": "https://glyconnect.expasy.org/browser/proteins/2512" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "Mfap4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 257, "chemical_mass": 28938.0 } ] }, { "start_pos": "1115", "site_seq": "N", "site_lbl": "Asn1115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P60882-1", "start_pos": 1115, "end_pos": 1115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2516", "url": "https://glyconnect.expasy.org/browser/proteins/2516" } ], "protein_name": "Multiple epidermal growth factor-like domains protein 8", "gene_name": "Megf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2789, "chemical_mass": 297487.0 } ] }, { "start_pos": "1115", "site_seq": "GYQGDGITHCNR", "site_lbl": "Asn1115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P60882-1", "start_pos": 1115, "end_pos": 1115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2516", "url": "https://glyconnect.expasy.org/browser/proteins/2516" } ], "protein_name": "Multiple epidermal growth factor-like domains protein 8", "gene_name": "Megf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2789, "chemical_mass": 297487.0 } ] }, { "start_pos": "1115", "site_seq": "", "site_lbl": "N1115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "25040638", "evidence": [ { "id": "rs3388886014", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388886014" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P60882-1", "start_pos": 1115, "end_pos": 1115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2516", "url": "https://glyconnect.expasy.org/browser/proteins/2516" } ], "protein_name": "Multiple epidermal growth factor-like domains protein 8", "gene_name": "Megf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2789, "chemical_mass": 297487.0 } ] }, { "start_pos": "236", "site_seq": "N", "site_lbl": "Asn236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2L6-1", "start_pos": 236, "end_pos": 236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2518", "url": "https://glyconnect.expasy.org/browser/proteins/2518" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "Minpp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 481, "chemical_mass": 54537.0 } ] }, { "start_pos": "236", "site_seq": "FLTDVERNETALYHVEAFK", "site_lbl": "Asn236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2L6-1", "start_pos": 236, "end_pos": 236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2518", "url": "https://glyconnect.expasy.org/browser/proteins/2518" } ], "protein_name": "Multiple inositol polyphosphate phosphatase 1", "gene_name": "Minpp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 481, "chemical_mass": 54537.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6S5C2-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2526", "url": "https://glyconnect.expasy.org/browser/proteins/2526" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunit gamma", "gene_name": "Gnptg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 307, "chemical_mass": 34169.0 } ] }, { "start_pos": "88", "site_seq": "YEFCPFHNVTQHEQTFR", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6S5C2-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2526", "url": "https://glyconnect.expasy.org/browser/proteins/2526" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunit gamma", "gene_name": "Gnptg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 307, "chemical_mass": 34169.0 } ] }, { "start_pos": "88", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Abolishes localization to the Golgi apparatus; when associated with Q-115.", "evidence": [ { "database": "UniProtKB", "id": "Q6S5C2", "url": "https://www.uniprot.org/uniprotkb/Q6S5C2" }, { "database": "PubMed", "id": "21173149", "url": "https://glygen.org/publication/PubMed/21173149" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6S5C2-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2526", "url": "https://glyconnect.expasy.org/browser/proteins/2526" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunit gamma", "gene_name": "Gnptg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 307, "chemical_mass": 34169.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BFR4-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2527", "url": "https://glyconnect.expasy.org/browser/proteins/2527" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 544, "chemical_mass": 61175.0 } ] }, { "start_pos": "354", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BFR4-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2527", "url": "https://glyconnect.expasy.org/browser/proteins/2527" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 544, "chemical_mass": 61175.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BFR4-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2527", "url": "https://glyconnect.expasy.org/browser/proteins/2527" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 544, "chemical_mass": 61175.0 } ] }, { "start_pos": "397", "site_seq": "GDRNLTWR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BFR4-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2527", "url": "https://glyconnect.expasy.org/browser/proteins/2527" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 544, "chemical_mass": 61175.0 } ] }, { "start_pos": "320", "site_seq": "N", "site_lbl": "Asn320", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R4G0-1", "start_pos": 320, "end_pos": 320, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2532", "url": "https://glyconnect.expasy.org/browser/proteins/2532" } ], "protein_name": "Netrin-G1", "gene_name": "Ntng1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 60566.0 } ] }, { "start_pos": "320", "site_seq": "LTCECEHNTTGPDCGK", "site_lbl": "Asn320", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R4G0-1", "start_pos": 320, "end_pos": 320, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2532", "url": "https://glyconnect.expasy.org/browser/proteins/2532" } ], "protein_name": "Netrin-G1", "gene_name": "Ntng1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 60566.0 } ] }, { "start_pos": "310", "site_seq": "N", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R4F1-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2533", "url": "https://glyconnect.expasy.org/browser/proteins/2533" } ], "protein_name": "Netrin-G2", "gene_name": "Ntng2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 589, "chemical_mass": 66166.0 } ] }, { "start_pos": "310", "site_seq": "EGSLQCECEHNTTGPDCGR", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R4F1-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2533", "url": "https://glyconnect.expasy.org/browser/proteins/2533" } ], "protein_name": "Netrin-G2", "gene_name": "Ntng2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 589, "chemical_mass": 66166.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70211-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2534", "url": "https://glyconnect.expasy.org/browser/proteins/2534" } ], "protein_name": "Netrin receptor DCC", "gene_name": "Dcc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1447, "chemical_mass": 158341.0 } ] }, { "start_pos": "94", "site_seq": "KQQLPNGSLLIQNILHSR", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70211-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2534", "url": "https://glyconnect.expasy.org/browser/proteins/2534" } ], "protein_name": "Netrin receptor DCC", "gene_name": "Dcc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1447, "chemical_mass": 158341.0 } ] }, { "start_pos": "1073", "site_seq": "N", "site_lbl": "Asn1073", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 1073, "end_pos": 1073, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "1073", "site_seq": "VSPDHQPQPQYVSYNQSSYTQWNLQPDTK", "site_lbl": "Asn1073", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 1073, "end_pos": 1073, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "293", "site_seq": "VIYQNHNK", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "478", "site_seq": "FFPYANGTLSIR", "site_lbl": "Asn478", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 478, "end_pos": 478, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "478", "site_seq": "N", "site_lbl": "Asn478", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 478, "end_pos": 478, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "476", "site_seq": "N", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70232-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2538", "url": "https://glyconnect.expasy.org/browser/proteins/2538" } ], "protein_name": "Neural cell adhesion molecule L1-like protein", "gene_name": "Chl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1209, "chemical_mass": 135074.0 } ] }, { "start_pos": "476", "site_seq": "YHTHENGTLEIYR", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70232-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2538", "url": "https://glyconnect.expasy.org/browser/proteins/2538" } ], "protein_name": "Neural cell adhesion molecule L1-like protein", "gene_name": "Chl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1209, "chemical_mass": 135074.0 } ] }, { "start_pos": "190", "site_seq": "N", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CS84-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2539", "url": "https://glyconnect.expasy.org/browser/proteins/2539" } ], "protein_name": "Neurexin-1", "gene_name": "Nrxn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1514, "chemical_mass": 166169.0 } ] }, { "start_pos": "121", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55066-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2545", "url": "https://glyconnect.expasy.org/browser/proteins/2545" } ], "protein_name": "Neurocan core protein", "gene_name": "Ncan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1268, "chemical_mass": 137200.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55066-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2545", "url": "https://glyconnect.expasy.org/browser/proteins/2545" } ], "protein_name": "Neurocan core protein", "gene_name": "Ncan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1268, "chemical_mass": 137200.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21661-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2546", "url": "https://glyconnect.expasy.org/browser/proteins/2546" } ], "protein_name": "Neuroendocrine convertase 2", "gene_name": "Pcsk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 637, "chemical_mass": 70785.0 } ] }, { "start_pos": "374", "site_seq": "RNPEAGVATTDLYGNCTLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21661-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2546", "url": "https://glyconnect.expasy.org/browser/proteins/2546" } ], "protein_name": "Neuroendocrine convertase 2", "gene_name": "Pcsk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 637, "chemical_mass": 70785.0 } ] }, { "start_pos": "523", "site_seq": "N", "site_lbl": "Asn523", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21661-1", "start_pos": 523, "end_pos": 523, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2546", "url": "https://glyconnect.expasy.org/browser/proteins/2546" } ], "protein_name": "Neuroendocrine convertase 2", "gene_name": "Pcsk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 637, "chemical_mass": 70785.0 } ] }, { "start_pos": "523", "site_seq": "RGDLNINMTSPMGTK", "site_lbl": "Asn523", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21661-1", "start_pos": 523, "end_pos": 523, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2546", "url": "https://glyconnect.expasy.org/browser/proteins/2546" } ], "protein_name": "Neuroendocrine convertase 2", "gene_name": "Pcsk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 637, "chemical_mass": 70785.0 } ] }, { "start_pos": "305", "site_seq": "ITNVSEEDSGEYFCLASNK", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "305", "site_seq": "N", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "409", "site_seq": "N", "site_lbl": "Asn409", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 409, "end_pos": 409, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "409", "site_seq": "AVYQCNTSNEHGYLLANAFVSVLDVPPR", "site_lbl": "Asn409", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 409, "end_pos": 409, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "483", "site_seq": "NGQGSNLDGGNYHVYENGSLEIK", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "866", "site_seq": "YVPFNGTK", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "217", "site_seq": "FNHTQTIQQK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "501", "site_seq": "GSALHEDIYVLHDNGTLEIPVAQK", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "501", "site_seq": "N", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "77", "site_seq": "NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "193", "site_seq": "N", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62443-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2552", "url": "https://glyconnect.expasy.org/browser/proteins/2552" } ], "protein_name": "Neuronal pentraxin-1", "gene_name": "Nptx1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 432, "chemical_mass": 47117.0 } ] }, { "start_pos": "193", "site_seq": "GGPKNDTEER", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62443-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2552", "url": "https://glyconnect.expasy.org/browser/proteins/2552" } ], "protein_name": "Neuronal pentraxin-1", "gene_name": "Nptx1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 432, "chemical_mass": 47117.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99J85-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2554", "url": "https://glyconnect.expasy.org/browser/proteins/2554" } ], "protein_name": "Neuronal pentraxin receptor", "gene_name": "Nptxr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 493, "chemical_mass": 52285.0 } ] }, { "start_pos": "211", "site_seq": "GNLSSAPAPAMPTALHSK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99J85-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2554", "url": "https://glyconnect.expasy.org/browser/proteins/2554" } ], "protein_name": "Neuronal pentraxin receptor", "gene_name": "Nptxr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 493, "chemical_mass": 52285.0 } ] }, { "start_pos": "9", "site_seq": "N", "site_lbl": "Asn9", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TRM4-1", "start_pos": 9, "end_pos": 9, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2555", "url": "https://glyconnect.expasy.org/browser/proteins/2555" } ], "protein_name": "Patatin-like phospholipase domain-containing protein 6", "gene_name": "Pnpla6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1355, "chemical_mass": 149537.0 } ] }, { "start_pos": "9", "site_seq": "GTPSHELNTTSSGAEVIQK", "site_lbl": "Asn9", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TRM4-1", "start_pos": 9, "end_pos": 9, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2555", "url": "https://glyconnect.expasy.org/browser/proteins/2555" } ], "protein_name": "Patatin-like phospholipase domain-containing protein 6", "gene_name": "Pnpla6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1355, "chemical_mass": 149537.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "196", "site_seq": "NASNMEYR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "283", "site_seq": "N", "site_lbl": "Asn283", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 283, "end_pos": 283, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "283", "site_seq": "KENGVFEEISNSSGR", "site_lbl": "Asn283", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 283, "end_pos": 283, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "321", "site_seq": "N", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35684-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2558", "url": "https://glyconnect.expasy.org/browser/proteins/2558" } ], "protein_name": "Neuroserpin", "gene_name": "Serpini1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 46348.0 } ] }, { "start_pos": "321", "site_seq": "DANLTAMSDK", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35684-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2558", "url": "https://glyconnect.expasy.org/browser/proteins/2558" } ], "protein_name": "Neuroserpin", "gene_name": "Serpini1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 46348.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLF1-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2560", "url": "https://glyconnect.expasy.org/browser/proteins/2560" } ], "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "Nceh1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 408, "chemical_mass": 45740.0 } ] }, { "start_pos": "270", "site_seq": "GNYDFVEAMIVNNHTSLDVER", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLF1-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2560", "url": "https://glyconnect.expasy.org/browser/proteins/2560" } ], "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "Nceh1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 408, "chemical_mass": 45740.0 } ] }, { "start_pos": "434", "site_seq": "N", "site_lbl": "Asn434", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P57716-1", "start_pos": 434, "end_pos": 434, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2562", "url": "https://glyconnect.expasy.org/browser/proteins/2562" } ], "protein_name": "Nicastrin", "gene_name": "Ncstn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 708, "chemical_mass": 78492.0 } ] }, { "start_pos": "434", "site_seq": "NISGVVLADHSGSFHNR", "site_lbl": "Asn434", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P57716-1", "start_pos": 434, "end_pos": 434, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2562", "url": "https://glyconnect.expasy.org/browser/proteins/2562" } ], "protein_name": "Nicastrin", "gene_name": "Ncstn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 708, "chemical_mass": 78492.0 } ] }, { "start_pos": "361", "site_seq": "N", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6GQT9-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2564", "url": "https://glyconnect.expasy.org/browser/proteins/2564" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "Nomo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1214, "chemical_mass": 133420.0 } ] }, { "start_pos": "361", "site_seq": "LENITTGTYTIHAQK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6GQT9-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2564", "url": "https://glyconnect.expasy.org/browser/proteins/2564" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "Nomo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1214, "chemical_mass": 133420.0 } ] }, { "start_pos": "610", "site_seq": "N", "site_lbl": "Asn610", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6GQT9-1", "start_pos": 610, "end_pos": 610, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2564", "url": "https://glyconnect.expasy.org/browser/proteins/2564" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "Nomo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1214, "chemical_mass": 133420.0 } ] }, { "start_pos": "610", "site_seq": "CALSHAITLEFHQDGNGPENVGIYNLSR", "site_lbl": "Asn610", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6GQT9-1", "start_pos": 610, "end_pos": 610, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2564", "url": "https://glyconnect.expasy.org/browser/proteins/2564" } ], "protein_name": "BOS complex subunit NOMO1", "gene_name": "Nomo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1214, "chemical_mass": 133420.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88998-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2565", "url": "https://glyconnect.expasy.org/browser/proteins/2565" } ], "protein_name": "Noelin", "gene_name": "Olfm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 485, "chemical_mass": 55398.0 } ] }, { "start_pos": "307", "site_seq": "SMVDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNK", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88998-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2565", "url": "https://glyconnect.expasy.org/browser/proteins/2565" } ], "protein_name": "Noelin", "gene_name": "Olfm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 485, "chemical_mass": 55398.0 } ] }, { "start_pos": "307", "site_seq": "LPHPWSGTGQVVYNGSIYFNK", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88998-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2565", "url": "https://glyconnect.expasy.org/browser/proteins/2565" } ], "protein_name": "Noelin", "gene_name": "Olfm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 485, "chemical_mass": 55398.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BM13-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2566", "url": "https://glyconnect.expasy.org/browser/proteins/2566" } ], "protein_name": "Noelin-2", "gene_name": "Olfm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 448, "chemical_mass": 50720.0 } ] }, { "start_pos": "435", "site_seq": "N", "site_lbl": "Asn435", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BM13-1", "start_pos": 435, "end_pos": 435, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2566", "url": "https://glyconnect.expasy.org/browser/proteins/2566" } ], "protein_name": "Noelin-2", "gene_name": "Olfm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 448, "chemical_mass": 50720.0 } ] }, { "start_pos": "1135", "site_seq": "GLMVGNGSVLGVVQAVDAETGK", "site_lbl": "Asn1135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 1135, "end_pos": 1135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "1135", "site_seq": "N", "site_lbl": "Asn1135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 1135, "end_pos": 1135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "1441", "site_seq": "N", "site_lbl": "Asn1441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "1441", "site_seq": "GATNNTCIIR", "site_lbl": "Asn1441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 1441, "end_pos": 1441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "681", "site_seq": "NVTSEDTGSISLSLLGPPASR", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY81-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2567", "url": "https://glyconnect.expasy.org/browser/proteins/2567" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "Nup210", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1886, "chemical_mass": 204101.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EPK6-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2568", "url": "https://glyconnect.expasy.org/browser/proteins/2568" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "Sil1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 465, "chemical_mass": 52430.0 } ] }, { "start_pos": "197", "site_seq": "FNSSSSSLEEK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EPK6-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2568", "url": "https://glyconnect.expasy.org/browser/proteins/2568" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "Sil1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 465, "chemical_mass": 52430.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63912-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2569", "url": "https://glyconnect.expasy.org/browser/proteins/2569" } ], "protein_name": "Oligodendrocyte-myelin glycoprotein", "gene_name": "Omg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 49284.0 } ] }, { "start_pos": "103", "site_seq": "SLWNMSAANNNIK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63912-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2569", "url": "https://glyconnect.expasy.org/browser/proteins/2569" } ], "protein_name": "Oligodendrocyte-myelin glycoprotein", "gene_name": "Omg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 49284.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "G5E8G3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2570", "url": "https://glyconnect.expasy.org/browser/proteins/2570" } ], "protein_name": "Opioid binding protein/cell adhesion molecule-like", "gene_name": "Opcml", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 345, "chemical_mass": 38011.0 } ] }, { "start_pos": "70", "site_seq": "VTRVAWLNRSTILYAGNDK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "G5E8G3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2570", "url": "https://glyconnect.expasy.org/browser/proteins/2570" } ], "protein_name": "Opioid binding protein/cell adhesion molecule-like", "gene_name": "Opcml", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 345, "chemical_mass": 38011.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGT0-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2571", "url": "https://glyconnect.expasy.org/browser/proteins/2571" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "Ostm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 338, "chemical_mass": 38000.0 } ] }, { "start_pos": "139", "site_seq": "NIGNTSEGPR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGT0-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2571", "url": "https://glyconnect.expasy.org/browser/proteins/2571" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "Ostm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 338, "chemical_mass": 38000.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88531-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2574", "url": "https://glyconnect.expasy.org/browser/proteins/2574" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "Ppt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 306, "chemical_mass": 34490.0 } ] }, { "start_pos": "212", "site_seq": "CVNESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88531-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2574", "url": "https://glyconnect.expasy.org/browser/proteins/2574" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "Ppt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 306, "chemical_mass": 34490.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61576-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2577", "url": "https://glyconnect.expasy.org/browser/proteins/2577" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "Fkbp10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 581, "chemical_mass": 64697.0 } ] }, { "start_pos": "69", "site_seq": "YHYNGTFEDGK", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61576-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2577", "url": "https://glyconnect.expasy.org/browser/proteins/2577" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "Fkbp10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 581, "chemical_mass": 64697.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59024-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2578", "url": "https://glyconnect.expasy.org/browser/proteins/2578" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP14", "gene_name": "Fkbp14", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 211, "chemical_mass": 24252.0 } ] }, { "start_pos": "176", "site_seq": "HGAVVNESHHDALVEDIFDKEDEDKDGFISAR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59024-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2578", "url": "https://glyconnect.expasy.org/browser/proteins/2578" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP14", "gene_name": "Fkbp14", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 211, "chemical_mass": 24252.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z247-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2579", "url": "https://glyconnect.expasy.org/browser/proteins/2579" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "Fkbp9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 570, "chemical_mass": 62995.0 } ] }, { "start_pos": "174", "site_seq": "YHYNGTFLDGTLFDSSHNR", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z247-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2579", "url": "https://glyconnect.expasy.org/browser/proteins/2579" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "Fkbp9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 570, "chemical_mass": 62995.0 } ] }, { "start_pos": "1277", "site_seq": "N", "site_lbl": "Asn1277", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UQ28-1", "start_pos": 1277, "end_pos": 1277, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2580", "url": "https://glyconnect.expasy.org/browser/proteins/2580" } ], "protein_name": "Peroxidasin homolog", "gene_name": "Pxdn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1475, "chemical_mass": 165103.0 } ] }, { "start_pos": "1277", "site_seq": "ILCDNSDNITR", "site_lbl": "Asn1277", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UQ28-1", "start_pos": 1277, "end_pos": 1277, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2580", "url": "https://glyconnect.expasy.org/browser/proteins/2580" } ], "protein_name": "Peroxidasin homolog", "gene_name": "Pxdn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1475, "chemical_mass": 165103.0 } ] }, { "start_pos": "294", "site_seq": "CFVCPVEYNNDTNSFTVDCEPSDLFR", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99L43-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2581", "url": "https://glyconnect.expasy.org/browser/proteins/2581" } ], "protein_name": "Phosphatidate cytidylyltransferase 2", "gene_name": "Cds2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 444, "chemical_mass": 51314.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99L43-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2581", "url": "https://glyconnect.expasy.org/browser/proteins/2581" } ], "protein_name": "Phosphatidate cytidylyltransferase 2", "gene_name": "Cds2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 444, "chemical_mass": 51314.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16301-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2582", "url": "https://glyconnect.expasy.org/browser/proteins/2582" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "Lcat", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 438, "chemical_mass": 49747.0 } ] }, { "start_pos": "108", "site_seq": "IVYNHSSGR", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16301-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2582", "url": "https://glyconnect.expasy.org/browser/proteins/2582" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "Lcat", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 438, "chemical_mass": 49747.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35405-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2583", "url": "https://glyconnect.expasy.org/browser/proteins/2583" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 488, "chemical_mass": 54389.0 } ] }, { "start_pos": "282", "site_seq": "SFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35405-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2583", "url": "https://glyconnect.expasy.org/browser/proteins/2583" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 488, "chemical_mass": 54389.0 } ] }, { "start_pos": "385", "site_seq": "N", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35405-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2583", "url": "https://glyconnect.expasy.org/browser/proteins/2583" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 488, "chemical_mass": 54389.0 } ] }, { "start_pos": "385", "site_seq": "SFLLSLAALHDNHTHSDIQVK", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35405-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2583", "url": "https://glyconnect.expasy.org/browser/proteins/2583" } ], "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 488, "chemical_mass": 54389.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70207-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2590", "url": "https://glyconnect.expasy.org/browser/proteins/2590" } ], "protein_name": "Plexin-A2", "gene_name": "Plxna2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1894, "chemical_mass": 211535.0 } ] }, { "start_pos": "163", "site_seq": "EHYLSSVNK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70207-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2590", "url": "https://glyconnect.expasy.org/browser/proteins/2590" } ], "protein_name": "Plexin-A2", "gene_name": "Plxna2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1894, "chemical_mass": 211535.0 } ] }, { "start_pos": "655", "site_seq": "N", "site_lbl": "Asn655", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70207-1", "start_pos": 655, "end_pos": 655, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2590", "url": "https://glyconnect.expasy.org/browser/proteins/2590" } ], "protein_name": "Plexin-A2", "gene_name": "Plxna2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1894, "chemical_mass": 211535.0 } ] }, { "start_pos": "655", "site_seq": "FYNCSAHQLCLSCVNSAFR", "site_lbl": "Asn655", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70207-1", "start_pos": 655, "end_pos": 655, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2590", "url": "https://glyconnect.expasy.org/browser/proteins/2590" } ], "protein_name": "Plexin-A2", "gene_name": "Plxna2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1894, "chemical_mass": 211535.0 } ] }, { "start_pos": "163", "site_seq": "", "site_lbl": "N163", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "1", "chr_pos": "194326554", "evidence": [ { "id": "rs3388527889", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388527889" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P70207-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2590", "url": "https://glyconnect.expasy.org/browser/proteins/2590" } ], "protein_name": "Plexin-A2", "gene_name": "Plxna2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1894, "chemical_mass": 211535.0 } ] }, { "start_pos": "1006", "site_seq": "N", "site_lbl": "Asn1006", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80UG2-1", "start_pos": 1006, "end_pos": 1006, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2592", "url": "https://glyconnect.expasy.org/browser/proteins/2592" } ], "protein_name": "Plexin-A4", "gene_name": "Plxna4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1893, "chemical_mass": 212560.0 } ] }, { "start_pos": "1006", "site_seq": "RSPSYIICNTTSSEEVLDMK", "site_lbl": "Asn1006", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80UG2-1", "start_pos": 1006, "end_pos": 1006, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2592", "url": "https://glyconnect.expasy.org/browser/proteins/2592" } ], "protein_name": "Plexin-A4", "gene_name": "Plxna4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1893, "chemical_mass": 212560.0 } ] }, { "start_pos": "441", "site_seq": "NHSLAFVGTK", "site_lbl": "Asn441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80UG2-1", "start_pos": 441, "end_pos": 441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2592", "url": "https://glyconnect.expasy.org/browser/proteins/2592" } ], "protein_name": "Plexin-A4", "gene_name": "Plxna4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1893, "chemical_mass": 212560.0 } ] }, { "start_pos": "441", "site_seq": "N", "site_lbl": "Asn441", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80UG2-1", "start_pos": 441, "end_pos": 441, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2592", "url": "https://glyconnect.expasy.org/browser/proteins/2592" } ], "protein_name": "Plexin-A4", "gene_name": "Plxna4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1893, "chemical_mass": 212560.0 } ] }, { "start_pos": "1251", "site_seq": "YTSDPNVTSVGPSK", "site_lbl": "Asn1251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 1251, "end_pos": 1251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "1251", "site_seq": "N", "site_lbl": "Asn1251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 1251, "end_pos": 1251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "31", "site_seq": "N", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "31", "site_seq": "SPLPAAFTANGTHLQHLAR", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "735", "site_seq": "N", "site_lbl": "Asn735", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "735", "site_seq": "LSHDGNETLPLHLYVK", "site_lbl": "Asn735", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "761", "site_seq": "N", "site_lbl": "Asn761", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 761, "end_pos": 761, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "761", "site_seq": "LQVTLYNCSFGR", "site_lbl": "Asn761", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 761, "end_pos": 761, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "735", "site_seq": "", "site_lbl": "N735", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "15", "chr_pos": "89047190", "evidence": [ { "id": "rs3389382028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389382028" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "717", "site_seq": "VSHVLNDTHMK", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "86", "site_seq": "DQAGNCTEPVSLAPPAR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "877", "site_seq": "N", "site_lbl": "Asn877", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 877, "end_pos": 877, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "877", "site_seq": "ENDNFNISKDDIDITLFHGENK", "site_lbl": "Asn877", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 877, "end_pos": 877, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "1019", "site_seq": "SREQFSYVVLVNDTDPCTDLTR", "site_lbl": "Asn1019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UH93-1", "start_pos": 1019, "end_pos": 1019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2597", "url": "https://glyconnect.expasy.org/browser/proteins/2597" } ], "protein_name": "Plexin-D1", "gene_name": "Plxnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1925, "chemical_mass": 211608.0 } ] }, { "start_pos": "1019", "site_seq": "N", "site_lbl": "Asn1019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UH93-1", "start_pos": 1019, "end_pos": 1019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2597", "url": "https://glyconnect.expasy.org/browser/proteins/2597" } ], "protein_name": "Plexin-D1", "gene_name": "Plxnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1925, "chemical_mass": 211608.0 } ] }, { "start_pos": "1019", "site_seq": "ITIHGSDLNVGSMLQVLVNDTDPCTDLTR", "site_lbl": "Asn1019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UH93-1", "start_pos": 1019, "end_pos": 1019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2597", "url": "https://glyconnect.expasy.org/browser/proteins/2597" } ], "protein_name": "Plexin-D1", "gene_name": "Plxnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1925, "chemical_mass": 211608.0 } ] }, { "start_pos": "1101", "site_seq": "FHMVQNVSMAVHHIGR", "site_lbl": "Asn1101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UH93-1", "start_pos": 1101, "end_pos": 1101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2597", "url": "https://glyconnect.expasy.org/browser/proteins/2597" } ], "protein_name": "Plexin-D1", "gene_name": "Plxnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1925, "chemical_mass": 211608.0 } ] }, { "start_pos": "1101", "site_seq": "N", "site_lbl": "Asn1101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UH93-1", "start_pos": 1101, "end_pos": 1101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2597", "url": "https://glyconnect.expasy.org/browser/proteins/2597" } ], "protein_name": "Plexin-D1", "gene_name": "Plxnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1925, "chemical_mass": 211608.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q76M80-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2598", "url": "https://glyconnect.expasy.org/browser/proteins/2598" } ], "protein_name": "Potassium channel, subfamily K, member 12", "gene_name": "Kcnk12", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 430, "chemical_mass": 46949.0 } ] }, { "start_pos": "78", "site_seq": "NFSAAHGVAEPELR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q76M80-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2598", "url": "https://glyconnect.expasy.org/browser/proteins/2598" } ], "protein_name": "Potassium channel, subfamily K, member 12", "gene_name": "Kcnk12", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 430, "chemical_mass": 46949.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TVI8-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2599", "url": "https://glyconnect.expasy.org/browser/proteins/2599" } ], "protein_name": "Pre-B-cell leukemia transcription factor-interacting protein 1", "gene_name": "Pbxip1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81164.0 } ] }, { "start_pos": "455", "site_seq": "SPNDSEAWHQK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TVI8-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2599", "url": "https://glyconnect.expasy.org/browser/proteins/2599" } ], "protein_name": "Pre-B-cell leukemia transcription factor-interacting protein 1", "gene_name": "Pbxip1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81164.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "196", "site_seq": "LLNQTLR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "323", "site_seq": "MSNITFR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "353", "site_seq": "GELNSTLFSSR", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQF9-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2601", "url": "https://glyconnect.expasy.org/browser/proteins/2601" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "Pcyox1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 505, "chemical_mass": 56495.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C7K6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2602", "url": "https://glyconnect.expasy.org/browser/proteins/2602" } ], "protein_name": "Prenylcysteine oxidase 1-like", "gene_name": "Pcyox1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 495, "chemical_mass": 54875.0 } ] }, { "start_pos": "185", "site_seq": "YQAHGYAFSGVEELLYSLGEATFVNMTQR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C7K6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2602", "url": "https://glyconnect.expasy.org/browser/proteins/2602" } ], "protein_name": "Prenylcysteine oxidase 1-like", "gene_name": "Pcyox1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 495, "chemical_mass": 54875.0 } ] }, { "start_pos": "443", "site_seq": "N", "site_lbl": "Asn443", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C165-1", "start_pos": 443, "end_pos": 443, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2603", "url": "https://glyconnect.expasy.org/browser/proteins/2603" } ], "protein_name": "N-fatty-acyl-amino acid synthase/hydrolase PM20D1", "gene_name": "Pm20d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 503, "chemical_mass": 55663.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C165-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2603", "url": "https://glyconnect.expasy.org/browser/proteins/2603" } ], "protein_name": "N-fatty-acyl-amino acid synthase/hydrolase PM20D1", "gene_name": "Pm20d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 503, "chemical_mass": 55663.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2AJQ3-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2604", "url": "https://glyconnect.expasy.org/browser/proteins/2604" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "Dpy19l4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 722, "chemical_mass": 83604.0 } ] }, { "start_pos": "122", "site_seq": "GVYELTHNNK", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2AJQ3-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2604", "url": "https://glyconnect.expasy.org/browser/proteins/2604" } ], "protein_name": "Probable C-mannosyltransferase DPY19L4", "gene_name": "Dpy19l4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 722, "chemical_mass": 83604.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K297-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2606", "url": "https://glyconnect.expasy.org/browser/proteins/2606" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "Colgalt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 617, "chemical_mass": 71061.0 } ] }, { "start_pos": "91", "site_seq": "TALWVATDHNTDNTSAILR", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K297-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2606", "url": "https://glyconnect.expasy.org/browser/proteins/2606" } ], "protein_name": "Procollagen galactosyltransferase 1", "gene_name": "Colgalt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 617, "chemical_mass": 71061.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E2-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2607", "url": "https://glyconnect.expasy.org/browser/proteins/2607" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "Plod1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 728, "chemical_mass": 83595.0 } ] }, { "start_pos": "198", "site_seq": "EQINISLDHR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E2-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2607", "url": "https://glyconnect.expasy.org/browser/proteins/2607" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "Plod1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 728, "chemical_mass": 83595.0 } ] }, { "start_pos": "539", "site_seq": "N", "site_lbl": "Asn539", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E2-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2607", "url": "https://glyconnect.expasy.org/browser/proteins/2607" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "Plod1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 728, "chemical_mass": 83595.0 } ] }, { "start_pos": "539", "site_seq": "YIHENYTK", "site_lbl": "Asn539", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E2-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2607", "url": "https://glyconnect.expasy.org/browser/proteins/2607" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "Plod1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 728, "chemical_mass": 83595.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "4", "chr_pos": "148012968", "evidence": [ { "id": "rs3388720046", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388720046" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E2-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2607", "url": "https://glyconnect.expasy.org/browser/proteins/2607" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "Plod1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 728, "chemical_mass": 83595.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E1-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2609", "url": "https://glyconnect.expasy.org/browser/proteins/2609" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "Plod3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 84922.0 } ] }, { "start_pos": "551", "site_seq": "EQYIHENYSR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E1-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2609", "url": "https://glyconnect.expasy.org/browser/proteins/2609" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "Plod3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 84922.0 } ] }, { "start_pos": "66", "site_seq": "N", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E1-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2609", "url": "https://glyconnect.expasy.org/browser/proteins/2609" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "Plod3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 84922.0 } ] }, { "start_pos": "66", "site_seq": "FLQSAEFFNYTVR", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0E1-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2609", "url": "https://glyconnect.expasy.org/browser/proteins/2609" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "Plod3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 84922.0 } ] }, { "start_pos": "1512", "site_seq": "N", "site_lbl": "Asn1512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1512, "end_pos": 1512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1512", "site_seq": "WTGHNVTVVQR", "site_lbl": "Asn1512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1512, "end_pos": 1512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1559", "site_seq": "GPCSHLCLINYNR", "site_lbl": "Asn1559", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1559, "end_pos": 1559, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1559", "site_seq": "N", "site_lbl": "Asn1559", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1559, "end_pos": 1559, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1576", "site_seq": "DNTTCYEFK", "site_lbl": "Asn1576", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1576, "end_pos": 1576, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1576", "site_seq": "N", "site_lbl": "Asn1576", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1576, "end_pos": 1576, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1646", "site_seq": "N", "site_lbl": "Asn1646", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1646, "end_pos": 1646, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1646", "site_seq": "AFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNK", "site_lbl": "Asn1646", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1646, "end_pos": 1646, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1764", "site_seq": "N", "site_lbl": "Asn1764", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1764, "end_pos": 1764, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1764", "site_seq": "LYWISSGNHTINR", "site_lbl": "Asn1764", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1764, "end_pos": 1764, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1826", "site_seq": "N", "site_lbl": "Asn1826", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1826, "end_pos": 1826, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1826", "site_seq": "NSTTLVMHMK", "site_lbl": "Asn1826", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1826, "end_pos": 1826, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1996", "site_seq": "N", "site_lbl": "Asn1996", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1996, "end_pos": 1996, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "2128", "site_seq": "N", "site_lbl": "Asn2128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2128, "end_pos": 2128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "2128", "site_seq": "DNATDSVPLR", "site_lbl": "Asn2128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2128, "end_pos": 2128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3840", "site_seq": "N", "site_lbl": "Asn3840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3840, "end_pos": 3840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3840", "site_seq": "FGTCSQLCNNTK", "site_lbl": "Asn3840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3840, "end_pos": 3840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "4076", "site_seq": "N", "site_lbl": "Asn4076", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 4076, "end_pos": 4076, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "4076", "site_seq": "LNGTDPIVAADSK", "site_lbl": "Asn4076", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 4076, "end_pos": 4076, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "266", "site_seq": "SLSNQTDAGLATQENLYER", "site_lbl": "Asn266", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60716-1", "start_pos": 266, "end_pos": 266, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2612", "url": "https://glyconnect.expasy.org/browser/proteins/2612" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-2", "gene_name": "P4ha2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 537, "chemical_mass": 61002.0 } ] }, { "start_pos": "266", "site_seq": "N", "site_lbl": "Asn266", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60716-1", "start_pos": 266, "end_pos": 266, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2612", "url": "https://glyconnect.expasy.org/browser/proteins/2612" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-2", "gene_name": "P4ha2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 537, "chemical_mass": 61002.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "TNSSFIQGFVDHVK", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "N", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "NSTKEEILAALEK", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "DNATQEEILHYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09114-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2617", "url": "https://glyconnect.expasy.org/browser/proteins/2617" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "Ptgds", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 189, "chemical_mass": 21066.0 } ] }, { "start_pos": "78", "site_seq": "TVVAPSTEGGLNLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09114-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2617", "url": "https://glyconnect.expasy.org/browser/proteins/2617" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "Ptgds", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 189, "chemical_mass": 21066.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DAU1-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2619", "url": "https://glyconnect.expasy.org/browser/proteins/2619" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "Cnpy3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 276, "chemical_mass": 30538.0 } ] }, { "start_pos": "153", "site_seq": "VVMDIPYELWNETSAEVADLK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DAU1-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2619", "url": "https://glyconnect.expasy.org/browser/proteins/2619" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "Cnpy3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 276, "chemical_mass": 30538.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88668-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2620", "url": "https://glyconnect.expasy.org/browser/proteins/2620" } ], "protein_name": "Protein CREG1", "gene_name": "Creg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 220, "chemical_mass": 24452.0 } ] }, { "start_pos": "160", "site_seq": "VNKTEEDYAR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88668-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2620", "url": "https://glyconnect.expasy.org/browser/proteins/2620" } ], "protein_name": "Protein CREG1", "gene_name": "Creg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 220, "chemical_mass": 24452.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXZ1-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2623", "url": "https://glyconnect.expasy.org/browser/proteins/2623" } ], "protein_name": "Protein disulfide-isomerase TMX3", "gene_name": "Tmx3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 456, "chemical_mass": 51848.0 } ] }, { "start_pos": "261", "site_seq": "NTSLEHTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXZ1-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2623", "url": "https://glyconnect.expasy.org/browser/proteins/2623" } ], "protein_name": "Protein disulfide-isomerase TMX3", "gene_name": "Tmx3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 456, "chemical_mass": 51848.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYI8-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2630", "url": "https://glyconnect.expasy.org/browser/proteins/2630" } ], "protein_name": "Protein FAM234B", "gene_name": "Fam234b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 624, "chemical_mass": 67031.0 } ] }, { "start_pos": "239", "site_seq": "MLSAFNATSGK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYI8-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2630", "url": "https://glyconnect.expasy.org/browser/proteins/2630" } ], "protein_name": "Protein FAM234B", "gene_name": "Fam234b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 624, "chemical_mass": 67031.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61220-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2634", "url": "https://glyconnect.expasy.org/browser/proteins/2634" } ], "protein_name": "Protein kinase C-binding protein NELL2", "gene_name": "Nell2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 819, "chemical_mass": 91432.0 } ] }, { "start_pos": "56", "site_seq": "QVPGLHNGTK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61220-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2634", "url": "https://glyconnect.expasy.org/browser/proteins/2634" } ], "protein_name": "Protein kinase C-binding protein NELL2", "gene_name": "Nell2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 819, "chemical_mass": 91432.0 } ] }, { "start_pos": "204", "site_seq": "N", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYB9-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2636", "url": "https://glyconnect.expasy.org/browser/proteins/2636" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "Poglut1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 392, "chemical_mass": 46379.0 } ] }, { "start_pos": "204", "site_seq": "KNSTAYFR", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYB9-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2636", "url": "https://glyconnect.expasy.org/browser/proteins/2636" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "Poglut1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 392, "chemical_mass": 46379.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYB9-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2636", "url": "https://glyconnect.expasy.org/browser/proteins/2636" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "Poglut1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 392, "chemical_mass": 46379.0 } ] }, { "start_pos": "276", "site_seq": "N", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BW41-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2638", "url": "https://glyconnect.expasy.org/browser/proteins/2638" } ], "protein_name": "Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2", "gene_name": "Pomgnt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 580, "chemical_mass": 66661.0 } ] }, { "start_pos": "276", "site_seq": "LNVSHAGAPLGEEYILVFSR", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BW41-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2638", "url": "https://glyconnect.expasy.org/browser/proteins/2638" } ], "protein_name": "Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2", "gene_name": "Pomgnt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 580, "chemical_mass": 66661.0 } ] }, { "start_pos": "471", "site_seq": "N", "site_lbl": "Asn471", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R2R1-1", "start_pos": 471, "end_pos": 471, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2639", "url": "https://glyconnect.expasy.org/browser/proteins/2639" } ], "protein_name": "Protein O-mannosyl-transferase 1", "gene_name": "Pomt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 746, "chemical_mass": 85234.0 } ] }, { "start_pos": "471", "site_seq": "FVHVNTSAILK", "site_lbl": "Asn471", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R2R1-1", "start_pos": 471, "end_pos": 471, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2639", "url": "https://glyconnect.expasy.org/browser/proteins/2639" } ], "protein_name": "Protein O-mannosyl-transferase 1", "gene_name": "Pomt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 746, "chemical_mass": 85234.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K2C7-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2640", "url": "https://glyconnect.expasy.org/browser/proteins/2640" } ], "protein_name": "Protein OS-9", "gene_name": "Os9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 672, "chemical_mass": 76108.0 } ] }, { "start_pos": "177", "site_seq": "YHSQTYGNGSKCDLNGK", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K2C7-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2640", "url": "https://glyconnect.expasy.org/browser/proteins/2640" } ], "protein_name": "Protein OS-9", "gene_name": "Os9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 672, "chemical_mass": 76108.0 } ] }, { "start_pos": "427", "site_seq": "N", "site_lbl": "Asn427", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2G6-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2642", "url": "https://glyconnect.expasy.org/browser/proteins/2642" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "Sel1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88340.0 } ] }, { "start_pos": "427", "site_seq": "MYSEGSDIVPQSNETALHYFK", "site_lbl": "Asn427", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2G6-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2642", "url": "https://glyconnect.expasy.org/browser/proteins/2642" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "Sel1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88340.0 } ] }, { "start_pos": "1989", "site_seq": "N", "site_lbl": "Asn1989", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PVD3-1", "start_pos": 1989, "end_pos": 1989, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2648", "url": "https://glyconnect.expasy.org/browser/proteins/2648" } ], "protein_name": "Protocadherin-16", "gene_name": "Dchs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3291, "chemical_mass": 346384.0 } ] }, { "start_pos": "1989", "site_seq": "DAGANASILYR", "site_lbl": "Asn1989", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PVD3-1", "start_pos": 1989, "end_pos": 1989, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2648", "url": "https://glyconnect.expasy.org/browser/proteins/2648" } ], "protein_name": "Protocadherin-16", "gene_name": "Dchs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3291, "chemical_mass": 346384.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TF3-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2650", "url": "https://glyconnect.expasy.org/browser/proteins/2650" } ], "protein_name": "Protocadherin-19", "gene_name": "Pcdh19", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1145, "chemical_mass": 126035.0 } ] }, { "start_pos": "485", "site_seq": "DPDMGLNGSVSYQIVPSQVR", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TF3-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2650", "url": "https://glyconnect.expasy.org/browser/proteins/2650" } ], "protein_name": "Protocadherin-19", "gene_name": "Pcdh19", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1145, "chemical_mass": 126035.0 } ] }, { "start_pos": "754", "site_seq": "LVVNISDLGYPK", "site_lbl": "Asn754", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F8VPK8-1", "start_pos": 754, "end_pos": 754, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2652", "url": "https://glyconnect.expasy.org/browser/proteins/2652" } ], "protein_name": "Protocadherin 9", "gene_name": "Pcdh9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1237, "chemical_mass": 136145.0 } ] }, { "start_pos": "754", "site_seq": "N", "site_lbl": "Asn754", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F8VPK8-1", "start_pos": 754, "end_pos": 754, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2652", "url": "https://glyconnect.expasy.org/browser/proteins/2652" } ], "protein_name": "Protocadherin 9", "gene_name": "Pcdh9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1237, "chemical_mass": 136145.0 } ] }, { "start_pos": "1993", "site_seq": "FTQDAYSAVVKENSTEAR", "site_lbl": "Asn1993", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A0A087WRT4-1", "start_pos": 1993, "end_pos": 1993, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2653", "url": "https://glyconnect.expasy.org/browser/proteins/2653" } ], "protein_name": "FAT atypical cadherin 1", "gene_name": "Fat1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4602, "chemical_mass": 507531.0 } ] }, { "start_pos": "1993", "site_seq": "N", "site_lbl": "Asn1993", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A0A087WRT4-1", "start_pos": 1993, "end_pos": 1993, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2653", "url": "https://glyconnect.expasy.org/browser/proteins/2653" } ], "protein_name": "FAT atypical cadherin 1", "gene_name": "Fat1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4602, "chemical_mass": 507531.0 } ] }, { "start_pos": "2327", "site_seq": "N", "site_lbl": "Asn2327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A0A087WRT4-1", "start_pos": 2327, "end_pos": 2327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2653", "url": "https://glyconnect.expasy.org/browser/proteins/2653" } ], "protein_name": "FAT atypical cadherin 1", "gene_name": "Fat1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4602, "chemical_mass": 507531.0 } ] }, { "start_pos": "2327", "site_seq": "GISYQLIGNHSK", "site_lbl": "Asn2327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A0A087WRT4-1", "start_pos": 2327, "end_pos": 2327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2653", "url": "https://glyconnect.expasy.org/browser/proteins/2653" } ], "protein_name": "FAT atypical cadherin 1", "gene_name": "Fat1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4602, "chemical_mass": 507531.0 } ] }, { "start_pos": "2183", "site_seq": "VPENITLYTPILHTQAR", "site_lbl": "Asn2183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5F226-1", "start_pos": 2183, "end_pos": 2183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2654", "url": "https://glyconnect.expasy.org/browser/proteins/2654" } ], "protein_name": "Protocadherin Fat 2", "gene_name": "Fat2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4351, "chemical_mass": 480109.0 } ] }, { "start_pos": "2183", "site_seq": "N", "site_lbl": "Asn2183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5F226-1", "start_pos": 2183, "end_pos": 2183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2654", "url": "https://glyconnect.expasy.org/browser/proteins/2654" } ], "protein_name": "Protocadherin Fat 2", "gene_name": "Fat2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4351, "chemical_mass": 480109.0 } ] }, { "start_pos": "2325", "site_seq": "N", "site_lbl": "Asn2325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5F226-1", "start_pos": 2325, "end_pos": 2325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2654", "url": "https://glyconnect.expasy.org/browser/proteins/2654" } ], "protein_name": "Protocadherin Fat 2", "gene_name": "Fat2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4351, "chemical_mass": 480109.0 } ] }, { "start_pos": "2325", "site_seq": "INGSTGEMFTIQELDYEAHQHFR", "site_lbl": "Asn2325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5F226-1", "start_pos": 2325, "end_pos": 2325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2654", "url": "https://glyconnect.expasy.org/browser/proteins/2654" } ], "protein_name": "Protocadherin Fat 2", "gene_name": "Fat2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4351, "chemical_mass": 480109.0 } ] }, { "start_pos": "898", "site_seq": "N", "site_lbl": "Asn898", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BNA6-1", "start_pos": 898, "end_pos": 898, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2655", "url": "https://glyconnect.expasy.org/browser/proteins/2655" } ], "protein_name": "Protocadherin Fat 3", "gene_name": "Fat3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4555, "chemical_mass": 502011.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TCN2-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2661", "url": "https://glyconnect.expasy.org/browser/proteins/2661" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "Plbd2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 594, "chemical_mass": 66289.0 } ] }, { "start_pos": "724", "site_seq": "N", "site_lbl": "Asn724", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64487-4", "start_pos": 724, "end_pos": 724, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2667", "url": "https://glyconnect.expasy.org/browser/proteins/2667" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase delta", "gene_name": "Ptprd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1912, "chemical_mass": 214410.0 } ] }, { "start_pos": "724", "site_seq": "KVEVEAVNATAVK", "site_lbl": "Asn724", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64487-4", "start_pos": 724, "end_pos": 724, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2667", "url": "https://glyconnect.expasy.org/browser/proteins/2667" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase delta", "gene_name": "Ptprd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1912, "chemical_mass": 214410.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35822-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2671", "url": "https://glyconnect.expasy.org/browser/proteins/2671" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "Ptprk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1457, "chemical_mass": 164186.0 } ] }, { "start_pos": "139", "site_seq": "GPLANPIWNVTGFTGR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35822-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2671", "url": "https://glyconnect.expasy.org/browser/proteins/2671" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "Ptprk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1457, "chemical_mass": 164186.0 } ] }, { "start_pos": "722", "site_seq": "N", "site_lbl": "Asn722", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9Q612-1", "start_pos": 722, "end_pos": 722, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2674", "url": "https://glyconnect.expasy.org/browser/proteins/2674" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase O", "gene_name": "Ptpro", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1226, "chemical_mass": 138589.0 } ] }, { "start_pos": "722", "site_seq": "GSNTSLPR", "site_lbl": "Asn722", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9Q612-1", "start_pos": 722, "end_pos": 722, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2674", "url": "https://glyconnect.expasy.org/browser/proteins/2674" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase O", "gene_name": "Ptpro", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1226, "chemical_mass": 138589.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61526-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2676", "url": "https://glyconnect.expasy.org/browser/proteins/2676" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-3", "gene_name": "Erbb3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1339, "chemical_mass": 147613.0 } ] }, { "start_pos": "250", "site_seq": "HFNDSGACVPR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61526-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2676", "url": "https://glyconnect.expasy.org/browser/proteins/2676" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-3", "gene_name": "Erbb3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1339, "chemical_mass": 147613.0 } ] }, { "start_pos": "3016", "site_seq": "N", "site_lbl": "Asn3016", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60841-1", "start_pos": 3016, "end_pos": 3016, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2678", "url": "https://glyconnect.expasy.org/browser/proteins/2678" } ], "protein_name": "Reelin", "gene_name": "Reln", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3461, "chemical_mass": 387495.0 } ] }, { "start_pos": "3016", "site_seq": "HDYILLPEGALTNTTR", "site_lbl": "Asn3016", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60841-1", "start_pos": 3016, "end_pos": 3016, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2678", "url": "https://glyconnect.expasy.org/browser/proteins/2678" } ], "protein_name": "Reelin", "gene_name": "Reln", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3461, "chemical_mass": 387495.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "VVRPDSELGERPPEDNQSFQYDHEAFLGK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "1932", "site_seq": "N", "site_lbl": "Asn1932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35600-1", "start_pos": 1932, "end_pos": 1932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2683", "url": "https://glyconnect.expasy.org/browser/proteins/2683" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "Abca4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2310, "chemical_mass": 260209.0 } ] }, { "start_pos": "1932", "site_seq": "VMSGGNKTDILK", "site_lbl": "Asn1932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35600-1", "start_pos": 1932, "end_pos": 1932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2683", "url": "https://glyconnect.expasy.org/browser/proteins/2683" } ], "protein_name": "Retinal-specific phospholipid-transporting ATPase ABCA4", "gene_name": "Abca4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2310, "chemical_mass": 260209.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q812C9-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2684", "url": "https://glyconnect.expasy.org/browser/proteins/2684" } ], "protein_name": "Amine oxidase [copper-containing] 2", "gene_name": "Aoc2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 757, "chemical_mass": 83583.0 } ] }, { "start_pos": "1911", "site_seq": "N", "site_lbl": "Asn1911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JLC8-1", "start_pos": 1911, "end_pos": 1911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2689", "url": "https://glyconnect.expasy.org/browser/proteins/2689" } ], "protein_name": "Sacsin", "gene_name": "Sacs", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4582, "chemical_mass": 520685.0 } ] }, { "start_pos": "1911", "site_seq": "WNTTFMRHVIVK", "site_lbl": "Asn1911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JLC8-1", "start_pos": 1911, "end_pos": 1911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2689", "url": "https://glyconnect.expasy.org/browser/proteins/2689" } ], "protein_name": "Sacsin", "gene_name": "Sacs", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4582, "chemical_mass": 520685.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2E9-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2691", "url": "https://glyconnect.expasy.org/browser/proteins/2691" } ], "protein_name": "Seipin", "gene_name": "Bscl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 383, "chemical_mass": 43105.0 } ] }, { "start_pos": "88", "site_seq": "TDCDSSTASLCSFPVANVSLAK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2E9-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2691", "url": "https://glyconnect.expasy.org/browser/proteins/2691" } ], "protein_name": "Seipin", "gene_name": "Bscl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 383, "chemical_mass": 43105.0 } ] }, { "start_pos": "126", "site_seq": "VLHHYNR", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70275-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2694", "url": "https://glyconnect.expasy.org/browser/proteins/2694" } ], "protein_name": "Semaphorin-3E", "gene_name": "Sema3e", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 89543.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70275-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2694", "url": "https://glyconnect.expasy.org/browser/proteins/2694" } ], "protein_name": "Semaphorin-3E", "gene_name": "Sema3e", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 89543.0 } ] }, { "start_pos": "496", "site_seq": "N", "site_lbl": "Asn496", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62178-1", "start_pos": 496, "end_pos": 496, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2696", "url": "https://glyconnect.expasy.org/browser/proteins/2696" } ], "protein_name": "Semaphorin-4A", "gene_name": "Sema4a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 83421.0 } ] }, { "start_pos": "496", "site_seq": "ANCSVYESCVDCVLAR", "site_lbl": "Asn496", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62178-1", "start_pos": 496, "end_pos": 496, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2696", "url": "https://glyconnect.expasy.org/browser/proteins/2696" } ], "protein_name": "Semaphorin-4A", "gene_name": "Sema4a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 83421.0 } ] }, { "start_pos": "56", "site_seq": "KFEAENISNYTALLLSQDGK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2697", "url": "https://glyconnect.expasy.org/browser/proteins/2697" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2697", "url": "https://glyconnect.expasy.org/browser/proteins/2697" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "191", "site_seq": "N", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09126-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2698", "url": "https://glyconnect.expasy.org/browser/proteins/2698" } ], "protein_name": "Semaphorin-4D", "gene_name": "Sema4d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 861, "chemical_mass": 95640.0 } ] }, { "start_pos": "191", "site_seq": "NSSHSPLR", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09126-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2698", "url": "https://glyconnect.expasy.org/browser/proteins/2698" } ], "protein_name": "Semaphorin-4D", "gene_name": "Sema4d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 861, "chemical_mass": 95640.0 } ] }, { "start_pos": "419", "site_seq": "N", "site_lbl": "Asn419", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09126-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2698", "url": "https://glyconnect.expasy.org/browser/proteins/2698" } ], "protein_name": "Semaphorin-4D", "gene_name": "Sema4d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 861, "chemical_mass": 95640.0 } ] }, { "start_pos": "419", "site_seq": "DVNYTQIVVDR", "site_lbl": "Asn419", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O09126-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2698", "url": "https://glyconnect.expasy.org/browser/proteins/2698" } ], "protein_name": "Semaphorin-4D", "gene_name": "Sema4d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 861, "chemical_mass": 95640.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z123-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2699", "url": "https://glyconnect.expasy.org/browser/proteins/2699" } ], "protein_name": "Semaphorin-4F", "gene_name": "Sema4f", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 777, "chemical_mass": 84490.0 } ] }, { "start_pos": "515", "site_seq": "LYHDWLLVGSHTEVTQVNTSNCGR", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z123-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2699", "url": "https://glyconnect.expasy.org/browser/proteins/2699" } ], "protein_name": "Semaphorin-4F", "gene_name": "Sema4f", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 777, "chemical_mass": 84490.0 } ] }, { "start_pos": "515", "site_seq": "", "site_lbl": "N515", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "6", "chr_pos": "82894420", "evidence": [ { "id": "rs3396979528", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3396979528" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z123-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2699", "url": "https://glyconnect.expasy.org/browser/proteins/2699" } ], "protein_name": "Semaphorin-4F", "gene_name": "Sema4f", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 777, "chemical_mass": 84490.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QUR8-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2702", "url": "https://glyconnect.expasy.org/browser/proteins/2702" } ], "protein_name": "Semaphorin-7A", "gene_name": "Sema7a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 664, "chemical_mass": 74994.0 } ] }, { "start_pos": "256", "site_seq": "NPEAPLNVSR", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QUR8-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2702", "url": "https://glyconnect.expasy.org/browser/proteins/2702" } ], "protein_name": "Semaphorin-7A", "gene_name": "Sema7a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 664, "chemical_mass": 74994.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62086-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2706", "url": "https://glyconnect.expasy.org/browser/proteins/2706" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "Pon2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 354, "chemical_mass": 39617.0 } ] }, { "start_pos": "254", "site_seq": "QPNMNLTQLK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62086-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2706", "url": "https://glyconnect.expasy.org/browser/proteins/2706" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "Pon2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 354, "chemical_mass": 39617.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62086-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2706", "url": "https://glyconnect.expasy.org/browser/proteins/2706" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "Pon2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 354, "chemical_mass": 39617.0 } ] }, { "start_pos": "323", "site_seq": "PSVTTVYINNGSVLQGSSVATIYDR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62086-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2706", "url": "https://glyconnect.expasy.org/browser/proteins/2706" } ], "protein_name": "Serum paraoxonase/arylesterase 2", "gene_name": "Pon2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 354, "chemical_mass": 39617.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64689-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2707", "url": "https://glyconnect.expasy.org/browser/proteins/2707" } ], "protein_name": "Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase ST8SIA3", "gene_name": "St8sia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 43942.0 } ] }, { "start_pos": "113", "site_seq": "QEILQHVDVIKNFSLTK", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64689-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2707", "url": "https://glyconnect.expasy.org/browser/proteins/2707" } ], "protein_name": "Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase ST8SIA3", "gene_name": "St8sia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 43942.0 } ] }, { "start_pos": "206", "site_seq": "N", "site_lbl": "Asn206", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64689-1", "start_pos": 206, "end_pos": 206, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2707", "url": "https://glyconnect.expasy.org/browser/proteins/2707" } ], "protein_name": "Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase ST8SIA3", "gene_name": "St8sia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 43942.0 } ] }, { "start_pos": "206", "site_seq": "KTNLTTFNPSILEK", "site_lbl": "Asn206", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64689-1", "start_pos": 206, "end_pos": 206, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2707", "url": "https://glyconnect.expasy.org/browser/proteins/2707" } ], "protein_name": "Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase ST8SIA3", "gene_name": "St8sia3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 43942.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6AXF6-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2711", "url": "https://glyconnect.expasy.org/browser/proteins/2711" } ], "protein_name": "SID1 transmembrane family member 1", "gene_name": "Sidt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 827, "chemical_mass": 93896.0 } ] }, { "start_pos": "83", "site_seq": "VHVNSSSDNLDYPVLVVVR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6AXF6-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2711", "url": "https://glyconnect.expasy.org/browser/proteins/2711" } ], "protein_name": "SID1 transmembrane family member 1", "gene_name": "Sidt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 827, "chemical_mass": 93896.0 } ] }, { "start_pos": "780", "site_seq": "N", "site_lbl": "Asn780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NZL8-1", "start_pos": 780, "end_pos": 780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2712", "url": "https://glyconnect.expasy.org/browser/proteins/2712" } ], "protein_name": "Signal peptide, CUB and EGF-like domain-containing protein 1", "gene_name": "Scube1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1018, "chemical_mass": 111606.0 } ] }, { "start_pos": "780", "site_seq": "VHCSPGHHYNTTTHR", "site_lbl": "Asn780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NZL8-1", "start_pos": 780, "end_pos": 780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2712", "url": "https://glyconnect.expasy.org/browser/proteins/2712" } ], "protein_name": "Signal peptide, CUB and EGF-like domain-containing protein 1", "gene_name": "Scube1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1018, "chemical_mass": 111606.0 } ] }, { "start_pos": "168", "site_seq": "N", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "168", "site_seq": "VNFTCKSHGFSPR", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "246", "site_seq": "N", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "246", "site_seq": "GIANLSNFIR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "VTQQSPTSMNQVNLTCR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "312", "site_seq": "NTDGTYNYTSLFLVNSSAHR", "site_lbl": "Asn312", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 312, "end_pos": 312, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "312", "site_seq": "N", "site_lbl": "Asn312", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 312, "end_pos": 312, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "460", "site_seq": "N", "site_lbl": "Asn460", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 460, "end_pos": 460, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "2", "chr_pos": "129458196", "evidence": [ { "id": "rs3388588006", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388588006" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42232-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2715", "url": "https://glyconnect.expasy.org/browser/proteins/2715" } ], "protein_name": "Signal transducer and activator of transcription 5B", "gene_name": "Stat5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 786, "chemical_mass": 90002.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97952-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2720", "url": "https://glyconnect.expasy.org/browser/proteins/2720" } ], "protein_name": "Sodium channel regulatory subunit beta-1", "gene_name": "Scn1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 218, "chemical_mass": 24650.0 } ] }, { "start_pos": "135", "site_seq": "LLFFDNYEHNTSVVKK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97952-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2720", "url": "https://glyconnect.expasy.org/browser/proteins/2720" } ], "protein_name": "Sodium channel regulatory subunit beta-1", "gene_name": "Scn1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 218, "chemical_mass": 24650.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97952-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2720", "url": "https://glyconnect.expasy.org/browser/proteins/2720" } ], "protein_name": "Sodium channel regulatory subunit beta-1", "gene_name": "Scn1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 218, "chemical_mass": 24650.0 } ] }, { "start_pos": "93", "site_seq": "VVWNGSR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97952-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2720", "url": "https://glyconnect.expasy.org/browser/proteins/2720" } ], "protein_name": "Sodium channel regulatory subunit beta-1", "gene_name": "Scn1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 218, "chemical_mass": 24650.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7M729-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2721", "url": "https://glyconnect.expasy.org/browser/proteins/2721" } ], "protein_name": "Sodium channel regulatory subunit beta-4", "gene_name": "Scn4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 228, "chemical_mass": 25192.0 } ] }, { "start_pos": "113", "site_seq": "EKTNNISILLSDLEFSDTGR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7M729-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2721", "url": "https://glyconnect.expasy.org/browser/proteins/2721" } ], "protein_name": "Sodium channel regulatory subunit beta-4", "gene_name": "Scn4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 228, "chemical_mass": 25192.0 } ] }, { "start_pos": "71", "site_seq": "WSYNNSETSR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7M729-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2721", "url": "https://glyconnect.expasy.org/browser/proteins/2721" } ], "protein_name": "Sodium channel regulatory subunit beta-4", "gene_name": "Scn4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 228, "chemical_mass": 25192.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7M729-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2721", "url": "https://glyconnect.expasy.org/browser/proteins/2721" } ], "protein_name": "Sodium channel regulatory subunit beta-4", "gene_name": "Scn4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 228, "chemical_mass": 25192.0 } ] }, { "start_pos": "393", "site_seq": "DLIPPHVNFSHLTTK", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJI1-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2722", "url": "https://glyconnect.expasy.org/browser/proteins/2722" } ], "protein_name": "Sodium-dependent neutral amino acid transporter SLC6A17", "gene_name": "Slc6a17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81071.0 } ] }, { "start_pos": "393", "site_seq": "N", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJI1-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2722", "url": "https://glyconnect.expasy.org/browser/proteins/2722" } ], "protein_name": "Sodium-dependent neutral amino acid transporter SLC6A17", "gene_name": "Slc6a17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81071.0 } ] }, { "start_pos": "193", "site_seq": "N", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2727", "url": "https://glyconnect.expasy.org/browser/proteins/2727" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "193", "site_seq": "PKPPKNESLETYPLMMK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2727", "url": "https://glyconnect.expasy.org/browser/proteins/2727" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "118", "site_seq": "FLEPYNDSIQAQK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "153", "site_seq": "RACQFNR", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "VINFYAGANQSMNVTCVGK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "VINFYAGANQSMNVTCVGKRPQHYR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "238", "site_seq": "KFHVNYTQPLVAVK", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "96", "site_seq": "N", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "96", "site_seq": "TENLDVIVNISDTESWGQHVQK", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97370-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2729", "url": "https://glyconnect.expasy.org/browser/proteins/2729" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "Atp1b3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31776.0 } ] }, { "start_pos": "197", "site_seq": "EENATIATYPEFGVLDLK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97370-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2729", "url": "https://glyconnect.expasy.org/browser/proteins/2729" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "Atp1b3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31776.0 } ] }, { "start_pos": "351", "site_seq": "N", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V14-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2730", "url": "https://glyconnect.expasy.org/browser/proteins/2730" } ], "protein_name": "Solute carrier family 12 member 5", "gene_name": "Slc12a5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1138, "chemical_mass": 126271.0 } ] }, { "start_pos": "351", "site_seq": "LLNATCDEYFTR", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V14-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2730", "url": "https://glyconnect.expasy.org/browser/proteins/2730" } ], "protein_name": "Solute carrier family 12 member 5", "gene_name": "Slc12a5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1138, "chemical_mass": 126271.0 } ] }, { "start_pos": "1895", "site_seq": "SVTTSLHNK", "site_lbl": "Asn1895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 1895, "end_pos": 1895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2735", "url": "https://glyconnect.expasy.org/browser/proteins/2735" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "1895", "site_seq": "N", "site_lbl": "Asn1895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 1895, "end_pos": 1895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2735", "url": "https://glyconnect.expasy.org/browser/proteins/2735" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "2011", "site_seq": "N", "site_lbl": "Asn2011", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 2011, "end_pos": 2011, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2735", "url": "https://glyconnect.expasy.org/browser/proteins/2735" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "2011", "site_seq": "YHIIVQLGNMSK", "site_lbl": "Asn2011", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 2011, "end_pos": 2011, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2735", "url": "https://glyconnect.expasy.org/browser/proteins/2735" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "1051", "site_seq": "N", "site_lbl": "Asn1051", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16546-1", "start_pos": 1051, "end_pos": 1051, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2738", "url": "https://glyconnect.expasy.org/browser/proteins/2738" } ], "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "Sptan1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2472, "chemical_mass": 284597.0 } ] }, { "start_pos": "171", "site_seq": "N", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70302-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2741", "url": "https://glyconnect.expasy.org/browser/proteins/2741" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "Stim1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 685, "chemical_mass": 77567.0 } ] }, { "start_pos": "171", "site_seq": "LAVTNTTMTGTVLK", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70302-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2741", "url": "https://glyconnect.expasy.org/browser/proteins/2741" } ], "protein_name": "Stromal interaction molecule 1", "gene_name": "Stim1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 685, "chemical_mass": 77567.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R0F3-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2742", "url": "https://glyconnect.expasy.org/browser/proteins/2742" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "Sumf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 372, "chemical_mass": 40659.0 } ] }, { "start_pos": "139", "site_seq": "FVNSTGYLTEAEK", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R0F3-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2742", "url": "https://glyconnect.expasy.org/browser/proteins/2742" } ], "protein_name": "Formylglycine-generating enzyme", "gene_name": "Sumf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 372, "chemical_mass": 40659.0 } ] }, { "start_pos": "529", "site_seq": "N", "site_lbl": "Asn529", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C341-1", "start_pos": 529, "end_pos": 529, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2743", "url": "https://glyconnect.expasy.org/browser/proteins/2743" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "Suco", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1250, "chemical_mass": 139169.0 } ] }, { "start_pos": "529", "site_seq": "SISENATATTEPK", "site_lbl": "Asn529", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C341-1", "start_pos": 529, "end_pos": 529, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2743", "url": "https://glyconnect.expasy.org/browser/proteins/2743" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "Suco", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1250, "chemical_mass": 139169.0 } ] }, { "start_pos": "834", "site_seq": "N", "site_lbl": "Asn834", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D666-1", "start_pos": 834, "end_pos": 834, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2744", "url": "https://glyconnect.expasy.org/browser/proteins/2744" } ], "protein_name": "SUN domain-containing protein 1", "gene_name": "Sun1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 913, "chemical_mass": 101976.0 } ] }, { "start_pos": "834", "site_seq": "TLSPTGNISSAPK", "site_lbl": "Asn834", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D666-1", "start_pos": 834, "end_pos": 834, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2744", "url": "https://glyconnect.expasy.org/browser/proteins/2744" } ], "protein_name": "SUN domain-containing protein 1", "gene_name": "Sun1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 913, "chemical_mass": 101976.0 } ] }, { "start_pos": "573", "site_seq": "N", "site_lbl": "Asn573", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JIS5-1", "start_pos": 573, "end_pos": 573, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2746", "url": "https://glyconnect.expasy.org/browser/proteins/2746" } ], "protein_name": "Synaptic vesicle glycoprotein 2A", "gene_name": "Sv2a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 742, "chemical_mass": 82647.0 } ] }, { "start_pos": "573", "site_seq": "LVNSTFLHNK", "site_lbl": "Asn573", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JIS5-1", "start_pos": 573, "end_pos": 573, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2746", "url": "https://glyconnect.expasy.org/browser/proteins/2746" } ], "protein_name": "Synaptic vesicle glycoprotein 2A", "gene_name": "Sv2a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 742, "chemical_mass": 82647.0 } ] }, { "start_pos": "24", "site_seq": "MVSASRPEALAAPVTTVATLVPHNATEPASPGEGK", "site_lbl": "Asn24", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P46096-1", "start_pos": 24, "end_pos": 24, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2750", "url": "https://glyconnect.expasy.org/browser/proteins/2750" } ], "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 421, "chemical_mass": 47418.0 } ] }, { "start_pos": "24", "site_seq": "N", "site_lbl": "Asn24", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P46096-1", "start_pos": 24, "end_pos": 24, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2750", "url": "https://glyconnect.expasy.org/browser/proteins/2750" } ], "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 421, "chemical_mass": 47418.0 } ] }, { "start_pos": "1983", "site_seq": "N", "site_lbl": "Asn1983", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 1983, "end_pos": 1983, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2756", "url": "https://glyconnect.expasy.org/browser/proteins/2756" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "2638", "site_seq": "VLESGVNVTVSQPTLLVNGR", "site_lbl": "Asn2638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 2638, "end_pos": 2638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2756", "url": "https://glyconnect.expasy.org/browser/proteins/2756" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "2638", "site_seq": "N", "site_lbl": "Asn2638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 2638, "end_pos": 2638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2756", "url": "https://glyconnect.expasy.org/browser/proteins/2756" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "915", "site_seq": "N", "site_lbl": "Asn915", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 915, "end_pos": 915, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2756", "url": "https://glyconnect.expasy.org/browser/proteins/2756" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "915", "site_seq": "DSTHIIPGDNPFNSSLVSLIR", "site_lbl": "Asn915", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 915, "end_pos": 915, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2756", "url": "https://glyconnect.expasy.org/browser/proteins/2756" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "225", "site_seq": "N", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER58-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2758", "url": "https://glyconnect.expasy.org/browser/proteins/2758" } ], "protein_name": "Testican-2", "gene_name": "Spock2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 46863.0 } ] }, { "start_pos": "225", "site_seq": "QNGSANSATNPAGLDK", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER58-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2758", "url": "https://glyconnect.expasy.org/browser/proteins/2758" } ], "protein_name": "Testican-2", "gene_name": "Spock2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 46863.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "9", "chr_pos": "56053849", "evidence": [ { "id": "rs3389050652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389050652" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P6J9-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2764", "url": "https://glyconnect.expasy.org/browser/proteins/2764" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "Txndc15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 38146.0 } ] }, { "start_pos": "149", "site_seq": "EEEYYAEPGVTEAEPVATEDANSTDSLK", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P6J9-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2764", "url": "https://glyconnect.expasy.org/browser/proteins/2764" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "Txndc15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 38146.0 } ] }, { "start_pos": "1457", "site_seq": "N", "site_lbl": "Asn1457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4U0-1", "start_pos": 1457, "end_pos": 1457, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2768", "url": "https://glyconnect.expasy.org/browser/proteins/2768" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 7B", "gene_name": "Thsd7b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 179309.0 } ] }, { "start_pos": "1457", "site_seq": "SDGLNVTGGCSPQAR", "site_lbl": "Asn1457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4U0-1", "start_pos": 1457, "end_pos": 1457, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2768", "url": "https://glyconnect.expasy.org/browser/proteins/2768" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 7B", "gene_name": "Thsd7b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 179309.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "94", "site_seq": "VLTLANFTTK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJ83-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2771", "url": "https://glyconnect.expasy.org/browser/proteins/2771" } ], "protein_name": "TM2 domain-containing protein 3", "gene_name": "Tm2d3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 261, "chemical_mass": 28880.0 } ] }, { "start_pos": "183", "site_seq": "DHIHCLGNR", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJ83-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2771", "url": "https://glyconnect.expasy.org/browser/proteins/2771" } ], "protein_name": "TM2 domain-containing protein 3", "gene_name": "Tm2d3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 261, "chemical_mass": 28880.0 } ] }, { "start_pos": "411", "site_seq": "HLNSSLPR", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q921T2-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2772", "url": "https://glyconnect.expasy.org/browser/proteins/2772" } ], "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "Tor1aip1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 595, "chemical_mass": 66781.0 } ] }, { "start_pos": "411", "site_seq": "N", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q921T2-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2772", "url": "https://glyconnect.expasy.org/browser/proteins/2772" } ], "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "Tor1aip1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 595, "chemical_mass": 66781.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER41-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2774", "url": "https://glyconnect.expasy.org/browser/proteins/2774" } ], "protein_name": "Torsin-1B", "gene_name": "Tor1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 336, "chemical_mass": 37818.0 } ] }, { "start_pos": "64", "site_seq": "FTECCHEERPLNTSALK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER41-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2774", "url": "https://glyconnect.expasy.org/browser/proteins/2774" } ], "protein_name": "Torsin-1B", "gene_name": "Tor1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 336, "chemical_mass": 37818.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER38-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2775", "url": "https://glyconnect.expasy.org/browser/proteins/2775" } ], "protein_name": "Torsin-3A", "gene_name": "Tor3a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 385, "chemical_mass": 43814.0 } ] }, { "start_pos": "110", "site_seq": "FQDCCSGGGDCRISNNLTGLESDLR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ER38-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2775", "url": "https://glyconnect.expasy.org/browser/proteins/2775" } ], "protein_name": "Torsin-3A", "gene_name": "Tor3a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 385, "chemical_mass": 43814.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CY50-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2779", "url": "https://glyconnect.expasy.org/browser/proteins/2779" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "Ssr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 286, "chemical_mass": 32065.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CY50-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2779", "url": "https://glyconnect.expasy.org/browser/proteins/2779" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "Ssr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 286, "chemical_mass": 32065.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW5-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2780", "url": "https://glyconnect.expasy.org/browser/proteins/2780" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "Ssr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20019.0 } ] }, { "start_pos": "104", "site_seq": "AGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW5-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2780", "url": "https://glyconnect.expasy.org/browser/proteins/2780" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "Ssr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20019.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW5-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2780", "url": "https://glyconnect.expasy.org/browser/proteins/2780" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "Ssr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20019.0 } ] }, { "start_pos": "88", "site_seq": "HLFFILNPWASASNVSHTVVLRPLK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW5-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2780", "url": "https://glyconnect.expasy.org/browser/proteins/2780" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "Ssr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20019.0 } ] }, { "start_pos": "88", "site_seq": "IAPASNVSHTVVLRPLK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW5-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2780", "url": "https://glyconnect.expasy.org/browser/proteins/2780" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "Ssr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20019.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BRH0-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2781", "url": "https://glyconnect.expasy.org/browser/proteins/2781" } ], "protein_name": "Protein O-mannosyl-transferase TMTC3", "gene_name": "Tmtc3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 920, "chemical_mass": 104198.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BG19-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2782", "url": "https://glyconnect.expasy.org/browser/proteins/2782" } ], "protein_name": "Protein O-mannosyl-transferase TMTC4", "gene_name": "Tmtc4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 82963.0 } ] }, { "start_pos": "497", "site_seq": "NLADQGNQTAAIK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BG19-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2782", "url": "https://glyconnect.expasy.org/browser/proteins/2782" } ], "protein_name": "Protein O-mannosyl-transferase TMTC4", "gene_name": "Tmtc4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 741, "chemical_mass": 82963.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R1V4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2783", "url": "https://glyconnect.expasy.org/browser/proteins/2783" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "Tmed4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 227, "chemical_mass": 26022.0 } ] }, { "start_pos": "117", "site_seq": "FTFTSHTPGDHQICLHSNSTR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R1V4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2783", "url": "https://glyconnect.expasy.org/browser/proteins/2783" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "Tmed4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 227, "chemical_mass": 26022.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99KF1-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2784", "url": "https://glyconnect.expasy.org/browser/proteins/2784" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "Tmed9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 235, "chemical_mass": 27127.0 } ] }, { "start_pos": "125", "site_seq": "FTFTSHTPGEHQICLHSNSTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99KF1-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2784", "url": "https://glyconnect.expasy.org/browser/proteins/2784" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "Tmed9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 235, "chemical_mass": 27127.0 } ] }, { "start_pos": "349", "site_seq": "N", "site_lbl": "Asn349", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BG58-1", "start_pos": 349, "end_pos": 349, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2785", "url": "https://glyconnect.expasy.org/browser/proteins/2785" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4htm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 503, "chemical_mass": 57049.0 } ] }, { "start_pos": "349", "site_seq": "LVANESVPFETSCR", "site_lbl": "Asn349", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BG58-1", "start_pos": 349, "end_pos": 349, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2785", "url": "https://glyconnect.expasy.org/browser/proteins/2785" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4htm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 503, "chemical_mass": 57049.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80X71-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2786", "url": "https://glyconnect.expasy.org/browser/proteins/2786" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "Tmem106b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 275, "chemical_mass": 31172.0 } ] }, { "start_pos": "184", "site_seq": "LNNITNIGPLDMK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80X71-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2786", "url": "https://glyconnect.expasy.org/browser/proteins/2786" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "Tmem106b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 275, "chemical_mass": 31172.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O70472-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2788", "url": "https://glyconnect.expasy.org/browser/proteins/2788" } ], "protein_name": "Transmembrane protein 131", "gene_name": "Tmem131", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1877, "chemical_mass": 204651.0 } ] }, { "start_pos": "288", "site_seq": "EADNHTAFIR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O70472-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2788", "url": "https://glyconnect.expasy.org/browser/proteins/2788" } ], "protein_name": "Transmembrane protein 131", "gene_name": "Tmem131", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1877, "chemical_mass": 204651.0 } ] }, { "start_pos": "1234", "site_seq": "N", "site_lbl": "Asn1234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5FWI3-1", "start_pos": 1234, "end_pos": 1234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2793", "url": "https://glyconnect.expasy.org/browser/proteins/2793" } ], "protein_name": "Cell surface hyaluronidase", "gene_name": "Cemip2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1383, "chemical_mass": 153801.0 } ] }, { "start_pos": "1234", "site_seq": "GDPSIISVNGTDFTFR", "site_lbl": "Asn1234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5FWI3-1", "start_pos": 1234, "end_pos": 1234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2793", "url": "https://glyconnect.expasy.org/browser/proteins/2793" } ], "protein_name": "Cell surface hyaluronidase", "gene_name": "Cemip2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1383, "chemical_mass": 153801.0 } ] }, { "start_pos": "636", "site_seq": "NSSMCTVMR", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5FWI3-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2793", "url": "https://glyconnect.expasy.org/browser/proteins/2793" } ], "protein_name": "Cell surface hyaluronidase", "gene_name": "Cemip2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1383, "chemical_mass": 153801.0 } ] }, { "start_pos": "636", "site_seq": "N", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5FWI3-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2793", "url": "https://glyconnect.expasy.org/browser/proteins/2793" } ], "protein_name": "Cell surface hyaluronidase", "gene_name": "Cemip2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1383, "chemical_mass": 153801.0 } ] }, { "start_pos": "223", "site_seq": "N", "site_lbl": "Asn223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXJ9-1", "start_pos": 223, "end_pos": 223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2796", "url": "https://glyconnect.expasy.org/browser/proteins/2796" } ], "protein_name": "Transmembrane protein 62", "gene_name": "Tmem62", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 643, "chemical_mass": 72862.0 } ] }, { "start_pos": "38", "site_seq": "N", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CR23-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2799", "url": "https://glyconnect.expasy.org/browser/proteins/2799" } ], "protein_name": "Proton-transporting V-type ATPase complex assembly regulator TMEM9", "gene_name": "Tmem9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20633.0 } ] }, { "start_pos": "38", "site_seq": "NISGHIYNQNVSQK", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CR23-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2799", "url": "https://glyconnect.expasy.org/browser/proteins/2799" } ], "protein_name": "Proton-transporting V-type ATPase complex assembly regulator TMEM9", "gene_name": "Tmem9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 183, "chemical_mass": 20633.0 } ] }, { "start_pos": "209", "site_seq": "N", "site_lbl": "Asn209", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89023-1", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2800", "url": "https://glyconnect.expasy.org/browser/proteins/2800" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "Tpp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 562, "chemical_mass": 61342.0 } ] }, { "start_pos": "209", "site_seq": "QRYNLTAK", "site_lbl": "Asn209", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89023-1", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2800", "url": "https://glyconnect.expasy.org/browser/proteins/2800" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "Tpp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 562, "chemical_mass": 61342.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89023-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2800", "url": "https://glyconnect.expasy.org/browser/proteins/2800" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "Tpp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 562, "chemical_mass": 61342.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L0-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2801", "url": "https://glyconnect.expasy.org/browser/proteins/2801" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "Tpbg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 426, "chemical_mass": 46451.0 } ] }, { "start_pos": "124", "site_seq": "QPPLADLEALNLSGNHLK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L0-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2801", "url": "https://glyconnect.expasy.org/browser/proteins/2801" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "Tpbg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 426, "chemical_mass": 46451.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L0-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2801", "url": "https://glyconnect.expasy.org/browser/proteins/2801" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "Tpbg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 426, "chemical_mass": 46451.0 } ] }, { "start_pos": "249", "site_seq": "NNSLVSLTYASFRNLTHLESLHLEDNALK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L0-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2801", "url": "https://glyconnect.expasy.org/browser/proteins/2801" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "Tpbg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 426, "chemical_mass": 46451.0 } ] }, { "start_pos": "202", "site_seq": "N", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60805-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2804", "url": "https://glyconnect.expasy.org/browser/proteins/2804" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "Mertk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 994, "chemical_mass": 110157.0 } ] }, { "start_pos": "202", "site_seq": "QPESVNVTR", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60805-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2804", "url": "https://glyconnect.expasy.org/browser/proteins/2804" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "Mertk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 994, "chemical_mass": 110157.0 } ] }, { "start_pos": "388", "site_seq": "NALGTANQTINGHFLK", "site_lbl": "Asn388", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6VNS1-1", "start_pos": 388, "end_pos": 388, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2805", "url": "https://glyconnect.expasy.org/browser/proteins/2805" } ], "protein_name": "NT-3 growth factor receptor", "gene_name": "Ntrk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 825, "chemical_mass": 92760.0 } ] }, { "start_pos": "388", "site_seq": "N", "site_lbl": "Asn388", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6VNS1-1", "start_pos": 388, "end_pos": 388, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2805", "url": "https://glyconnect.expasy.org/browser/proteins/2805" } ], "protein_name": "NT-3 growth factor receptor", "gene_name": "Ntrk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 825, "chemical_mass": 92760.0 } ] }, { "start_pos": "742", "site_seq": "N", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6A4J8-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2806", "url": "https://glyconnect.expasy.org/browser/proteins/2806" } ], "protein_name": "Ubiquitin carboxyl-terminal hydrolase 7", "gene_name": "Usp7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 128475.0 } ] }, { "start_pos": "510", "site_seq": "N", "site_lbl": "Asn510", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q69ZQ1-1", "start_pos": 510, "end_pos": 510, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2810", "url": "https://glyconnect.expasy.org/browser/proteins/2810" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "Myorg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 716, "chemical_mass": 81362.0 } ] }, { "start_pos": "510", "site_seq": "VGYQSQNISCFFR", "site_lbl": "Asn510", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q69ZQ1-1", "start_pos": 510, "end_pos": 510, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2810", "url": "https://glyconnect.expasy.org/browser/proteins/2810" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "Myorg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 716, "chemical_mass": 81362.0 } ] }, { "start_pos": "715", "site_seq": "N", "site_lbl": "Asn715", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UZV7-1", "start_pos": 715, "end_pos": 715, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2813", "url": "https://glyconnect.expasy.org/browser/proteins/2813" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator family member 2", "gene_name": "Elapor2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113660.0 } ] }, { "start_pos": "715", "site_seq": "YFHFFNISLCGHEGR", "site_lbl": "Asn715", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UZV7-1", "start_pos": 715, "end_pos": 715, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2813", "url": "https://glyconnect.expasy.org/browser/proteins/2813" } ], "protein_name": "Endosome/lysosome-associated apoptosis and autophagy regulator family member 2", "gene_name": "Elapor2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113660.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBH5-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2819", "url": "https://glyconnect.expasy.org/browser/proteins/2819" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "Lman2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 358, "chemical_mass": 40430.0 } ] }, { "start_pos": "185", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBH5-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2819", "url": "https://glyconnect.expasy.org/browser/proteins/2819" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "Lman2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 358, "chemical_mass": 40430.0 } ] }, { "start_pos": "185", "site_seq": "", "site_lbl": "N185", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->TGS).", "chr_id": "13", "chr_pos": "55499320", "evidence": [ { "id": "rs3389296582", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389296582" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBH5-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2819", "url": "https://glyconnect.expasy.org/browser/proteins/2819" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "Lman2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 358, "chemical_mass": 40430.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59481-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2820", "url": "https://glyconnect.expasy.org/browser/proteins/2820" } ], "protein_name": "VIP36-like protein", "gene_name": "Lman2l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 347, "chemical_mass": 39881.0 } ] }, { "start_pos": "180", "site_seq": "RYSPGVQRVFPYISAMVNNGSLSYDHER", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59481-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2820", "url": "https://glyconnect.expasy.org/browser/proteins/2820" } ], "protein_name": "VIP36-like protein", "gene_name": "Lman2l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 347, "chemical_mass": 39881.0 } ] }, { "start_pos": "180", "site_seq": "VFPYISAMVNNGSLSYDHER", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59481-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2820", "url": "https://glyconnect.expasy.org/browser/proteins/2820" } ], "protein_name": "VIP36-like protein", "gene_name": "Lman2l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 347, "chemical_mass": 39881.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "164", "site_seq": "LNASLPALLLIR", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "255", "site_seq": "N", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "255", "site_seq": "QLLQTQVASPAIHPPVSYNDTAPR", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "255", "site_seq": "LGASPLHVARDITMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPR", "site_lbl": "Asn255", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 255, "end_pos": 255, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "919", "site_seq": "N", "site_lbl": "Asn919", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PDJ1-1", "start_pos": 919, "end_pos": 919, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2827", "url": "https://glyconnect.expasy.org/browser/proteins/2827" } ], "protein_name": "VWFA and cache domain-containing protein 1", "gene_name": "Cachd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1288, "chemical_mass": 143812.0 } ] }, { "start_pos": "919", "site_seq": "FNTSLVGDLTNLVHGSHCSK", "site_lbl": "Asn919", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PDJ1-1", "start_pos": 919, "end_pos": 919, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2827", "url": "https://glyconnect.expasy.org/browser/proteins/2827" } ], "protein_name": "VWFA and cache domain-containing protein 1", "gene_name": "Cachd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1288, "chemical_mass": 143812.0 } ] }, { "start_pos": "748", "site_seq": "N", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "CLYGEAYPSCSSGNTSTAEEELCR", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "1261", "site_seq": "N", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYI9-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "590", "url": "https://glyconnect.expasy.org/browser/proteins/590" } ], "protein_name": "Tenascin-R", "gene_name": "Tnr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1358, "chemical_mass": 149589.0 } ] }, { "start_pos": "1261", "site_seq": "IGSYNGTAGDSLSYHQGR", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYI9-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "590", "url": "https://glyconnect.expasy.org/browser/proteins/590" } ], "protein_name": "Tenascin-R", "gene_name": "Tnr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1358, "chemical_mass": 149589.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05769-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "11258925", "url": "https://glygen.org/publication/PubMed/11258925" }, { "database": "GlyConnect", "id": "514", "url": "https://glyconnect.expasy.org/browser/proteins/514" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "Ptgs2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 604, "chemical_mass": 69013.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05769-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "11258925", "url": "https://glygen.org/publication/PubMed/11258925" }, { "database": "GlyConnect", "id": "514", "url": "https://glyconnect.expasy.org/browser/proteins/514" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "Ptgs2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 604, "chemical_mass": 69013.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64676-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2096", "url": "https://glyconnect.expasy.org/browser/proteins/2096" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "Ugt8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 541, "chemical_mass": 61249.0 } ] }, { "start_pos": "442", "site_seq": "LSEIHKDQPGHPVNR", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64676-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2096", "url": "https://glyconnect.expasy.org/browser/proteins/2096" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "Ugt8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 541, "chemical_mass": 61249.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D136-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2097", "url": "https://glyconnect.expasy.org/browser/proteins/2097" } ], "protein_name": "2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3", "gene_name": "Ogfod3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 315, "chemical_mass": 35385.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV54-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2101", "url": "https://glyconnect.expasy.org/browser/proteins/2101" } ], "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 394, "chemical_mass": 44670.0 } ] }, { "start_pos": "341", "site_seq": "CLNHTTQKNLSFATIYDVLSTKPVLNK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV54-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2101", "url": "https://glyconnect.expasy.org/browser/proteins/2101" } ], "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 394, "chemical_mass": 44670.0 } ] }, { "start_pos": "347", "site_seq": "N", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV54-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2101", "url": "https://glyconnect.expasy.org/browser/proteins/2101" } ], "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 394, "chemical_mass": 44670.0 } ] }, { "start_pos": "347", "site_seq": "CLNHTTQKNLSFATIYDVLSTKPVLNK", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV54-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2101", "url": "https://glyconnect.expasy.org/browser/proteins/2101" } ], "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 394, "chemical_mass": 44670.0 } ] }, { "start_pos": "243", "site_seq": "N", "site_lbl": "Asn243", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TNS7-1", "start_pos": 243, "end_pos": 243, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2102", "url": "https://glyconnect.expasy.org/browser/proteins/2102" } ], "protein_name": "Acid-sensing ion channel 4", "gene_name": "Asic4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 59216.0 } ] }, { "start_pos": "243", "site_seq": "ETNETSFEAGIR", "site_lbl": "Asn243", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TNS7-1", "start_pos": 243, "end_pos": 243, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2102", "url": "https://glyconnect.expasy.org/browser/proteins/2102" } ], "protein_name": "Acid-sensing ion channel 4", "gene_name": "Asic4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 59216.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70158-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2103", "url": "https://glyconnect.expasy.org/browser/proteins/2103" } ], "protein_name": "Cyclic GMP-AMP phosphodiesterase SMPDL3A", "gene_name": "Smpdl3a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 445, "chemical_mass": 49858.0 } ] }, { "start_pos": "219", "site_seq": "IISLNTNLYYGPNIMTLNK", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70158-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2103", "url": "https://glyconnect.expasy.org/browser/proteins/2103" } ], "protein_name": "Cyclic GMP-AMP phosphodiesterase SMPDL3A", "gene_name": "Smpdl3a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 445, "chemical_mass": 49858.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0Q6-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2106", "url": "https://glyconnect.expasy.org/browser/proteins/2106" } ], "protein_name": "Actin-related protein 2/3 complex subunit 1A", "gene_name": "Arpc1a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 370, "chemical_mass": 41626.0 } ] }, { "start_pos": "676", "site_seq": "N", "site_lbl": "Asn676", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TT36-1", "start_pos": 676, "end_pos": 676, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2107", "url": "https://glyconnect.expasy.org/browser/proteins/2107" } ], "protein_name": "Adhesion G protein-coupled receptor A3", "gene_name": "Adgra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1310, "chemical_mass": 144697.0 } ] }, { "start_pos": "676", "site_seq": "IDGATVDTHHIPVNVTLR", "site_lbl": "Asn676", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TT36-1", "start_pos": 676, "end_pos": 676, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2107", "url": "https://glyconnect.expasy.org/browser/proteins/2107" } ], "protein_name": "Adhesion G protein-coupled receptor A3", "gene_name": "Adgra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1310, "chemical_mass": 144697.0 } ] }, { "start_pos": "636", "site_seq": "N", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CGM1-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2108", "url": "https://glyconnect.expasy.org/browser/proteins/2108" } ], "protein_name": "Adhesion G protein-coupled receptor B2", "gene_name": "Adgrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1561, "chemical_mass": 169863.0 } ] }, { "start_pos": "636", "site_seq": "RTYYSGDLLFSVDILRNVTDTFK", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CGM1-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2108", "url": "https://glyconnect.expasy.org/browser/proteins/2108" } ], "protein_name": "Adhesion G protein-coupled receptor B2", "gene_name": "Adgrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1561, "chemical_mass": 169863.0 } ] }, { "start_pos": "526", "site_seq": "N", "site_lbl": "Asn526", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TR1-1", "start_pos": 526, "end_pos": 526, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2111", "url": "https://glyconnect.expasy.org/browser/proteins/2111" } ], "protein_name": "Adhesion G protein-coupled receptor L1", "gene_name": "Adgrl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1466, "chemical_mass": 161686.0 } ] }, { "start_pos": "526", "site_seq": "GPDLSNCTSPWVNQVAQK", "site_lbl": "Asn526", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TR1-1", "start_pos": 526, "end_pos": 526, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2111", "url": "https://glyconnect.expasy.org/browser/proteins/2111" } ], "protein_name": "Adhesion G protein-coupled receptor L1", "gene_name": "Adgrl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1466, "chemical_mass": 161686.0 } ] }, { "start_pos": "821", "site_seq": "N", "site_lbl": "Asn821", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TR1-1", "start_pos": 821, "end_pos": 821, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2111", "url": "https://glyconnect.expasy.org/browser/proteins/2111" } ], "protein_name": "Adhesion G protein-coupled receptor L1", "gene_name": "Adgrl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1466, "chemical_mass": 161686.0 } ] }, { "start_pos": "159", "site_seq": "AGPNGTLFVVDAYK", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D7N9-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2112", "url": "https://glyconnect.expasy.org/browser/proteins/2112" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "Apmap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 46434.0 } ] }, { "start_pos": "159", "site_seq": "N", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D7N9-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2112", "url": "https://glyconnect.expasy.org/browser/proteins/2112" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "Apmap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 46434.0 } ] }, { "start_pos": "104", "site_seq": "NPCNITR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56528-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2113", "url": "https://glyconnect.expasy.org/browser/proteins/2113" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1", "gene_name": "Cd38", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 34408.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56528-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2113", "url": "https://glyconnect.expasy.org/browser/proteins/2113" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1", "gene_name": "Cd38", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 34408.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61282-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2114", "url": "https://glyconnect.expasy.org/browser/proteins/2114" } ], "protein_name": "Aggrecan core protein", "gene_name": "Acan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2132, "chemical_mass": 221941.0 } ] }, { "start_pos": "126", "site_seq": "SNDSGIYR", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61282-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2114", "url": "https://glyconnect.expasy.org/browser/proteins/2114" } ], "protein_name": "Aggrecan core protein", "gene_name": "Acan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2132, "chemical_mass": 221941.0 } ] }, { "start_pos": "9", "site_seq": "N", "site_lbl": "Asn9", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BS35-1", "start_pos": 9, "end_pos": 9, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2117", "url": "https://glyconnect.expasy.org/browser/proteins/2117" } ], "protein_name": "Alkylglycerol monooxygenase", "gene_name": "Agmo", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 447, "chemical_mass": 51778.0 } ] }, { "start_pos": "9", "site_seq": "SPGAQDNVSVSQGMR", "site_lbl": "Asn9", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BS35-1", "start_pos": 9, "end_pos": 9, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2117", "url": "https://glyconnect.expasy.org/browser/proteins/2117" } ], "protein_name": "Alkylglycerol monooxygenase", "gene_name": "Agmo", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 447, "chemical_mass": 51778.0 } ] }, { "start_pos": "314", "site_seq": "DWMPNNHSVILIDDFESPQK", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHC9-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2118", "url": "https://glyconnect.expasy.org/browser/proteins/2118" } ], "protein_name": "GDP-fucose protein O-fucosyltransferase 4", "gene_name": "Fut11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 489, "chemical_mass": 55533.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHC9-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2118", "url": "https://glyconnect.expasy.org/browser/proteins/2118" } ], "protein_name": "GDP-fucose protein O-fucosyltransferase 4", "gene_name": "Fut11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 489, "chemical_mass": 55533.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55302-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2121", "url": "https://glyconnect.expasy.org/browser/proteins/2121" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "Lrpap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 360, "chemical_mass": 42215.0 } ] }, { "start_pos": "271", "site_seq": "VIDLWDLAQSANFTEK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55302-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2121", "url": "https://glyconnect.expasy.org/browser/proteins/2121" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "Lrpap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 360, "chemical_mass": 42215.0 } ] }, { "start_pos": "326", "site_seq": "N", "site_lbl": "Asn326", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48441-1", "start_pos": 326, "end_pos": 326, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2122", "url": "https://glyconnect.expasy.org/browser/proteins/2122" } ], "protein_name": "Alpha-L-iduronidase", "gene_name": "Idua", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 634, "chemical_mass": 71254.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48441-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2122", "url": "https://glyconnect.expasy.org/browser/proteins/2122" } ], "protein_name": "Alpha-L-iduronidase", "gene_name": "Idua", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 634, "chemical_mass": 71254.0 } ] }, { "start_pos": "362", "site_seq": "FQVNNTHPPHVQLLR", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48441-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2122", "url": "https://glyconnect.expasy.org/browser/proteins/2122" } ], "protein_name": "Alpha-L-iduronidase", "gene_name": "Idua", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 634, "chemical_mass": 71254.0 } ] }, { "start_pos": "501", "site_seq": "N", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88325-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2124", "url": "https://glyconnect.expasy.org/browser/proteins/2124" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "Naglu", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 82596.0 } ] }, { "start_pos": "501", "site_seq": "SVYNCSGEACSGHNR", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88325-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2124", "url": "https://glyconnect.expasy.org/browser/proteins/2124" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "Naglu", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 82596.0 } ] }, { "start_pos": "547", "site_seq": "N", "site_lbl": "Asn547", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88325-1", "start_pos": 547, "end_pos": 547, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2124", "url": "https://glyconnect.expasy.org/browser/proteins/2124" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "Naglu", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 82596.0 } ] }, { "start_pos": "547", "site_seq": "LLLTAAPNLTTSPAFR", "site_lbl": "Asn547", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88325-1", "start_pos": 547, "end_pos": 547, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2124", "url": "https://glyconnect.expasy.org/browser/proteins/2124" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "Naglu", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 82596.0 } ] }, { "start_pos": "501", "site_seq": "", "site_lbl": "N501", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "11", "chr_pos": "100967552", "evidence": [ { "id": "rs3389138151", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389138151" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O88325-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2124", "url": "https://glyconnect.expasy.org/browser/proteins/2124" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "Naglu", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 82596.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97449-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2126", "url": "https://glyconnect.expasy.org/browser/proteins/2126" } ], "protein_name": "Aminopeptidase N", "gene_name": "Anpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 966, "chemical_mass": 109651.0 } ] }, { "start_pos": "106", "site_seq": "PYLTPNNQGLYIFQGNSTVR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97449-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2126", "url": "https://glyconnect.expasy.org/browser/proteins/2126" } ], "protein_name": "Aminopeptidase N", "gene_name": "Anpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 966, "chemical_mass": 109651.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97449-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2126", "url": "https://glyconnect.expasy.org/browser/proteins/2126" } ], "protein_name": "Aminopeptidase N", "gene_name": "Anpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 966, "chemical_mass": 109651.0 } ] }, { "start_pos": "128", "site_seq": "KLNYTLK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97449-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2126", "url": "https://glyconnect.expasy.org/browser/proteins/2126" } ], "protein_name": "Aminopeptidase N", "gene_name": "Anpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 966, "chemical_mass": 109651.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "79491683", "evidence": [ { "id": "rs3545905022", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3545905022" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P97449-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2126", "url": "https://glyconnect.expasy.org/browser/proteins/2126" } ], "protein_name": "Aminopeptidase N", "gene_name": "Anpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 966, "chemical_mass": 109651.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2129", "url": "https://glyconnect.expasy.org/browser/proteins/2129" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "514", "site_seq": "NETHFDAGAK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2129", "url": "https://glyconnect.expasy.org/browser/proteins/2129" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "719", "site_seq": "N", "site_lbl": "Asn719", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 719, "end_pos": 719, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2129", "url": "https://glyconnect.expasy.org/browser/proteins/2129" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "719", "site_seq": "TFDVSNFQNSSIK", "site_lbl": "Asn719", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 719, "end_pos": 719, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2129", "url": "https://glyconnect.expasy.org/browser/proteins/2129" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "280", "site_seq": "IYAGMVSLMDEAVGNVTK", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50429-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2134", "url": "https://glyconnect.expasy.org/browser/proteins/2134" } ], "protein_name": "Arylsulfatase B", "gene_name": "Arsb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 534, "chemical_mass": 59647.0 } ] }, { "start_pos": "280", "site_seq": "N", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50429-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2134", "url": "https://glyconnect.expasy.org/browser/proteins/2134" } ], "protein_name": "Arylsulfatase B", "gene_name": "Arsb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 534, "chemical_mass": 59647.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TYD4-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2135", "url": "https://glyconnect.expasy.org/browser/proteins/2135" } ], "protein_name": "Arylsulfatase G", "gene_name": "Arsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 525, "chemical_mass": 57434.0 } ] }, { "start_pos": "497", "site_seq": "ALADVLQDIADDNSSR", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TYD4-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2135", "url": "https://glyconnect.expasy.org/browser/proteins/2135" } ], "protein_name": "Arylsulfatase G", "gene_name": "Arsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 525, "chemical_mass": 57434.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Faster electrophoretic migration typical of a size reduction probably due to glycosylation loss. Abolishes proteolytic cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q3TYD4", "url": "https://www.uniprot.org/uniprotkb/Q3TYD4" }, { "database": "PubMed", "id": "25135642", "url": "https://glygen.org/publication/PubMed/25135642" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q3TYD4-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2135", "url": "https://glyconnect.expasy.org/browser/proteins/2135" } ], "protein_name": "Arylsulfatase G", "gene_name": "Arsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 525, "chemical_mass": 57434.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41234-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2140", "url": "https://glyconnect.expasy.org/browser/proteins/2140" } ], "protein_name": "ATP-binding cassette sub-family A member 2", "gene_name": "Abca2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2434, "chemical_mass": 270509.0 } ] }, { "start_pos": "432", "site_seq": "RGNMSSLGFTSK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41234-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2140", "url": "https://glyconnect.expasy.org/browser/proteins/2140" } ], "protein_name": "ATP-binding cassette sub-family A member 2", "gene_name": "Abca2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2434, "chemical_mass": 270509.0 } ] }, { "start_pos": "236", "site_seq": "N", "site_lbl": "Asn236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZ42-1", "start_pos": 236, "end_pos": 236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2143", "url": "https://glyconnect.expasy.org/browser/proteins/2143" } ], "protein_name": "ATP-dependent (S)-NAD(P)H-hydrate dehydratase", "gene_name": "Naxd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 343, "chemical_mass": 36717.0 } ] }, { "start_pos": "236", "site_seq": "LSQALGNITVVQK", "site_lbl": "Asn236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZ42-1", "start_pos": 236, "end_pos": 236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2143", "url": "https://glyconnect.expasy.org/browser/proteins/2143" } ], "protein_name": "ATP-dependent (S)-NAD(P)H-hydrate dehydratase", "gene_name": "Naxd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 343, "chemical_mass": 36717.0 } ] }, { "start_pos": "1053", "site_seq": "N", "site_lbl": "Asn1053", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU60-1", "start_pos": 1053, "end_pos": 1053, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2145", "url": "https://glyconnect.expasy.org/browser/proteins/2145" } ], "protein_name": "Attractin", "gene_name": "Atrn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1428, "chemical_mass": 158058.0 } ] }, { "start_pos": "1053", "site_seq": "YNWSFIHCPACQCNGHSK", "site_lbl": "Asn1053", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU60-1", "start_pos": 1053, "end_pos": 1053, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2145", "url": "https://glyconnect.expasy.org/browser/proteins/2145" } ], "protein_name": "Attractin", "gene_name": "Atrn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1428, "chemical_mass": 158058.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU60-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2145", "url": "https://glyconnect.expasy.org/browser/proteins/2145" } ], "protein_name": "Attractin", "gene_name": "Atrn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1428, "chemical_mass": 158058.0 } ] }, { "start_pos": "427", "site_seq": "N", "site_lbl": "Asn427", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU60-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2145", "url": "https://glyconnect.expasy.org/browser/proteins/2145" } ], "protein_name": "Attractin", "gene_name": "Atrn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1428, "chemical_mass": 158058.0 } ] }, { "start_pos": "427", "site_seq": "VFHIHNESWVLLTPK", "site_lbl": "Asn427", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU60-1", "start_pos": 427, "end_pos": 427, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2145", "url": "https://glyconnect.expasy.org/browser/proteins/2145" } ], "protein_name": "Attractin", "gene_name": "Atrn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1428, "chemical_mass": 158058.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "270", "site_seq": "TSDTGEEEAITNSTEANGK", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "241", "site_seq": "HMNETSHTQGSLR", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "95", "site_seq": "N", "site_lbl": "Asn95", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 95, "end_pos": 95, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "95", "site_seq": "NLTIVDSGLK", "site_lbl": "Asn95", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 95, "end_pos": 95, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->YFT).", "chr_id": "13", "chr_pos": "58990691", "evidence": [ { "id": "rs3404240899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3404240899" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHT6-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2149", "url": "https://glyconnect.expasy.org/browser/proteins/2149" } ], "protein_name": "Beta-1,3-glucosyltransferase", "gene_name": "B3glct", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 489, "chemical_mass": 55358.0 } ] }, { "start_pos": "327", "site_seq": "FLNHSHNK", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHT6-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2149", "url": "https://glyconnect.expasy.org/browser/proteins/2149" } ], "protein_name": "Beta-1,3-glucosyltransferase", "gene_name": "B3glct", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 489, "chemical_mass": 55358.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "149670013", "evidence": [ { "id": "rs3388813070", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388813070" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "149670012", "evidence": [ { "id": "rs3388812939", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388812939" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHT6-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2149", "url": "https://glyconnect.expasy.org/browser/proteins/2149" } ], "protein_name": "Beta-1,3-glucosyltransferase", "gene_name": "B3glct", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 489, "chemical_mass": 55358.0 } ] }, { "start_pos": "387", "site_seq": "N", "site_lbl": "Asn387", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91YY2-1", "start_pos": 387, "end_pos": 387, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2150", "url": "https://glyconnect.expasy.org/browser/proteins/2150" } ], "protein_name": "Beta-1,4-galactosyltransferase 3", "gene_name": "B4galt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 395, "chemical_mass": 44084.0 } ] }, { "start_pos": "387", "site_seq": "PGPLPTANHTAPR", "site_lbl": "Asn387", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91YY2-1", "start_pos": 387, "end_pos": 387, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2150", "url": "https://glyconnect.expasy.org/browser/proteins/2150" } ], "protein_name": "Beta-1,4-galactosyltransferase 3", "gene_name": "B4galt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 395, "chemical_mass": 44084.0 } ] }, { "start_pos": "96", "site_seq": "N", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CIF4-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2155", "url": "https://glyconnect.expasy.org/browser/proteins/2155" } ], "protein_name": "Biotinidase", "gene_name": "Btd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 520, "chemical_mass": 58154.0 } ] }, { "start_pos": "96", "site_seq": "GVQIIVFPEDGIHGFNFTR", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CIF4-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2155", "url": "https://glyconnect.expasy.org/browser/proteins/2155" } ], "protein_name": "Biotinidase", "gene_name": "Btd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 520, "chemical_mass": 58154.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q920P3-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2157", "url": "https://glyconnect.expasy.org/browser/proteins/2157" } ], "protein_name": "BMP/retinoic acid-inducible neural-specific protein 1", "gene_name": "Brinp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 88641.0 } ] }, { "start_pos": "599", "site_seq": "LQNSQCYNWTLLLGNR", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q920P3-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2157", "url": "https://glyconnect.expasy.org/browser/proteins/2157" } ], "protein_name": "BMP/retinoic acid-inducible neural-specific protein 1", "gene_name": "Brinp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 88641.0 } ] }, { "start_pos": "626", "site_seq": "N", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6DFY8-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2158", "url": "https://glyconnect.expasy.org/browser/proteins/2158" } ], "protein_name": "BMP/retinoic acid-inducible neural-specific protein 2", "gene_name": "Brinp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 783, "chemical_mass": 89228.0 } ] }, { "start_pos": "626", "site_seq": "TNVDAAAQCQNWTITLGNR", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6DFY8-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2158", "url": "https://glyconnect.expasy.org/browser/proteins/2158" } ], "protein_name": "BMP/retinoic acid-inducible neural-specific protein 2", "gene_name": "Brinp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 783, "chemical_mass": 89228.0 } ] }, { "start_pos": "129", "site_seq": "VALPAYPASLTDVSLVLSELRPNDSGVYR", "site_lbl": "Asn129", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61361-1", "start_pos": 129, "end_pos": 129, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2161", "url": "https://glyconnect.expasy.org/browser/proteins/2161" } ], "protein_name": "Brevican core protein", "gene_name": "Bcan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 95815.0 } ] }, { "start_pos": "129", "site_seq": "N", "site_lbl": "Asn129", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61361-1", "start_pos": 129, "end_pos": 129, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2161", "url": "https://glyconnect.expasy.org/browser/proteins/2161" } ], "protein_name": "Brevican core protein", "gene_name": "Bcan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 95815.0 } ] }, { "start_pos": "100", "site_seq": "N", "site_lbl": "Asn100", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 100, "end_pos": 100, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "100", "site_seq": "ELLSNQSEVMLR", "site_lbl": "Asn100", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 100, "end_pos": 100, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "307", "site_seq": "FFHVNGSAFLPR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "61", "site_seq": "QGNASDVILR", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB72-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2162", "url": "https://glyconnect.expasy.org/browser/proteins/2162" } ], "protein_name": "BTB/POZ domain-containing protein 17", "gene_name": "Btbd17", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 478, "chemical_mass": 52602.0 } ] }, { "start_pos": "540", "site_seq": "N", "site_lbl": "Asn540", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55288-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2164", "url": "https://glyconnect.expasy.org/browser/proteins/2164" } ], "protein_name": "Cadherin-11", "gene_name": "Cdh11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 796, "chemical_mass": 88112.0 } ] }, { "start_pos": "540", "site_seq": "FIFSLPPEIMHNPNFTVR", "site_lbl": "Asn540", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55288-1", "start_pos": 540, "end_pos": 540, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2164", "url": "https://glyconnect.expasy.org/browser/proteins/2164" } ], "protein_name": "Cadherin-11", "gene_name": "Cdh11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 796, "chemical_mass": 88112.0 } ] }, { "start_pos": "537", "site_seq": "LAPEAVIKPNFTVHDFR", "site_lbl": "Asn537", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5RJH3-1", "start_pos": 537, "end_pos": 537, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2165", "url": "https://glyconnect.expasy.org/browser/proteins/2165" } ], "protein_name": "Cadherin-12", "gene_name": "Cdh12", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 794, "chemical_mass": 88468.0 } ] }, { "start_pos": "537", "site_seq": "N", "site_lbl": "Asn537", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5RJH3-1", "start_pos": 537, "end_pos": 537, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2165", "url": "https://glyconnect.expasy.org/browser/proteins/2165" } ], "protein_name": "Cadherin-12", "gene_name": "Cdh12", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 794, "chemical_mass": 88468.0 } ] }, { "start_pos": "638", "site_seq": "INNTHALVSLLQNLNK", "site_lbl": "Asn638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 638, "end_pos": 638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "638", "site_seq": "N", "site_lbl": "Asn638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 638, "end_pos": 638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "671", "site_seq": "N", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "671", "site_seq": "ANYNLPIMVTDSGKPPMTNITDLR", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "651", "site_seq": "N", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15116-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2169", "url": "https://glyconnect.expasy.org/browser/proteins/2169" } ], "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 906, "chemical_mass": 99796.0 } ] }, { "start_pos": "651", "site_seq": "RNWTINR", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15116-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2169", "url": "https://glyconnect.expasy.org/browser/proteins/2169" } ], "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 906, "chemical_mass": 99796.0 } ] }, { "start_pos": "658", "site_seq": "N", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P39038-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2170", "url": "https://glyconnect.expasy.org/browser/proteins/2170" } ], "protein_name": "Cadherin-4", "gene_name": "Cdh4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 913, "chemical_mass": 100030.0 } ] }, { "start_pos": "658", "site_seq": "KNWTITR", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P39038-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2170", "url": "https://glyconnect.expasy.org/browser/proteins/2170" } ], "protein_name": "Cadherin-4", "gene_name": "Cdh4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 913, "chemical_mass": 100030.0 } ] }, { "start_pos": "1212", "site_seq": "N", "site_lbl": "Asn1212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0M0-1", "start_pos": 1212, "end_pos": 1212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2174", "url": "https://glyconnect.expasy.org/browser/proteins/2174" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "Celsr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2919, "chemical_mass": 316986.0 } ] }, { "start_pos": "1565", "site_seq": "N", "site_lbl": "Asn1565", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0M0-1", "start_pos": 1565, "end_pos": 1565, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2174", "url": "https://glyconnect.expasy.org/browser/proteins/2174" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "Celsr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2919, "chemical_mass": 316986.0 } ] }, { "start_pos": "1565", "site_seq": "HIDMADFIANNGTVPGCPTK", "site_lbl": "Asn1565", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0M0-1", "start_pos": 1565, "end_pos": 1565, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2174", "url": "https://glyconnect.expasy.org/browser/proteins/2174" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "Celsr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2919, "chemical_mass": 316986.0 } ] }, { "start_pos": "2061", "site_seq": "N", "site_lbl": "Asn2061", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0M0-1", "start_pos": 2061, "end_pos": 2061, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2174", "url": "https://glyconnect.expasy.org/browser/proteins/2174" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "Celsr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2919, "chemical_mass": 316986.0 } ] }, { "start_pos": "2061", "site_seq": "NATQHTSGYFGSDVK", "site_lbl": "Asn2061", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0M0-1", "start_pos": 2061, "end_pos": 2061, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2174", "url": "https://glyconnect.expasy.org/browser/proteins/2174" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "Celsr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2919, "chemical_mass": 316986.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64444-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2181", "url": "https://glyconnect.expasy.org/browser/proteins/2181" } ], "protein_name": "Carbonic anhydrase 4", "gene_name": "Ca4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 305, "chemical_mass": 34351.0 } ] }, { "start_pos": "260", "site_seq": "N", "site_lbl": "Asn260", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O70354-1", "start_pos": 260, "end_pos": 260, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2183", "url": "https://glyconnect.expasy.org/browser/proteins/2183" } ], "protein_name": "Carbonic anhydrase-related protein 11", "gene_name": "Ca11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 328, "chemical_mass": 36051.0 } ] }, { "start_pos": "260", "site_seq": "ALNITSLQMHSLR", "site_lbl": "Asn260", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O70354-1", "start_pos": 260, "end_pos": 260, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2183", "url": "https://glyconnect.expasy.org/browser/proteins/2183" } ], "protein_name": "Carbonic anhydrase-related protein 11", "gene_name": "Ca11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 328, "chemical_mass": 36051.0 } ] }, { "start_pos": "260", "site_seq": "", "site_lbl": "N260", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "7", "chr_pos": "45353021", "evidence": [ { "id": "rs3388892438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388892438" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O70354-1", "start_pos": 260, "end_pos": 260, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2183", "url": "https://glyconnect.expasy.org/browser/proteins/2183" } ], "protein_name": "Carbonic anhydrase-related protein 11", "gene_name": "Ca11", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 328, "chemical_mass": 36051.0 } ] }, { "start_pos": "952", "site_seq": "N", "site_lbl": "Asn952", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89001-1", "start_pos": 952, "end_pos": 952, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2184", "url": "https://glyconnect.expasy.org/browser/proteins/2184" } ], "protein_name": "Carboxypeptidase D", "gene_name": "Cpd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1377, "chemical_mass": 152406.0 } ] }, { "start_pos": "952", "site_seq": "GLVMNYPHITNLTTLGQSVEYR", "site_lbl": "Asn952", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89001-1", "start_pos": 952, "end_pos": 952, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2184", "url": "https://glyconnect.expasy.org/browser/proteins/2184" } ], "protein_name": "Carboxypeptidase D", "gene_name": "Cpd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1377, "chemical_mass": 152406.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIANATISVDGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WVJ3-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2187", "url": "https://glyconnect.expasy.org/browser/proteins/2187" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "Cpq", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 470, "chemical_mass": 51813.0 } ] }, { "start_pos": "394", "site_seq": "EVMNLLQPLNVTK", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WVJ3-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2187", "url": "https://glyconnect.expasy.org/browser/proteins/2187" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "Cpq", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 470, "chemical_mass": 51813.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "134", "site_seq": "NGTSFDIHYGSGSLSGYLSQDTVSVPCK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "YYHGELSYLNVTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "345", "site_seq": "N", "site_lbl": "Asn345", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R013-1", "start_pos": 345, "end_pos": 345, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2191", "url": "https://glyconnect.expasy.org/browser/proteins/2191" } ], "protein_name": "Cathepsin F", "gene_name": "Ctsf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 462, "chemical_mass": 51661.0 } ] }, { "start_pos": "345", "site_seq": "NLGGLETEDDYGYQGHVQTCNFSAQMAKVYINDSVELSR", "site_lbl": "Asn345", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R013-1", "start_pos": 345, "end_pos": 345, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2191", "url": "https://glyconnect.expasy.org/browser/proteins/2191" } ], "protein_name": "Cathepsin F", "gene_name": "Ctsf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 462, "chemical_mass": 51661.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R013-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2191", "url": "https://glyconnect.expasy.org/browser/proteins/2191" } ], "protein_name": "Cathepsin F", "gene_name": "Ctsf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 462, "chemical_mass": 51661.0 } ] }, { "start_pos": "356", "site_seq": "VYINDSVELSR", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R013-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2191", "url": "https://glyconnect.expasy.org/browser/proteins/2191" } ], "protein_name": "Cathepsin F", "gene_name": "Ctsf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 462, "chemical_mass": 51661.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06797-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2192", "url": "https://glyconnect.expasy.org/browser/proteins/2192" } ], "protein_name": "Procathepsin L", "gene_name": "Ctsl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 334, "chemical_mass": 37547.0 } ] }, { "start_pos": "221", "site_seq": "AEFAVANDTGFVDIPQQEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06797-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2192", "url": "https://glyconnect.expasy.org/browser/proteins/2192" } ], "protein_name": "Procathepsin L", "gene_name": "Ctsl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 334, "chemical_mass": 37547.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WUU7-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2193", "url": "https://glyconnect.expasy.org/browser/proteins/2193" } ], "protein_name": "Cathepsin Z", "gene_name": "Ctsz", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 306, "chemical_mass": 33996.0 } ] }, { "start_pos": "186", "site_seq": "ECHTIQNYTLWR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WUU7-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2193", "url": "https://glyconnect.expasy.org/browser/proteins/2193" } ], "protein_name": "Cathepsin Z", "gene_name": "Ctsz", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 306, "chemical_mass": 33996.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24668-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2194", "url": "https://glyconnect.expasy.org/browser/proteins/2194" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6pr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31172.0 } ] }, { "start_pos": "58", "site_seq": "LRPLFNK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24668-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2194", "url": "https://glyconnect.expasy.org/browser/proteins/2194" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6pr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31172.0 } ] }, { "start_pos": "1305", "site_seq": "N", "site_lbl": "Asn1305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 1305, "end_pos": 1305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "1305", "site_seq": "MNYTGGDTCHK", "site_lbl": "Asn1305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 1305, "end_pos": 1305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "1649", "site_seq": "N", "site_lbl": "Asn1649", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 1649, "end_pos": 1649, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "1649", "site_seq": "NGSSIIDLSPLIHR", "site_lbl": "Asn1649", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 1649, "end_pos": 1649, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "395", "site_seq": "HQNQTLR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07113-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2195", "url": "https://glyconnect.expasy.org/browser/proteins/2195" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "Igf2r", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2483, "chemical_mass": 273815.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61490-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2196", "url": "https://glyconnect.expasy.org/browser/proteins/2196" } ], "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 583, "chemical_mass": 65092.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61490-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2196", "url": "https://glyconnect.expasy.org/browser/proteins/2196" } ], "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 583, "chemical_mass": 65092.0 } ] }, { "start_pos": "480", "site_seq": "YYSKIIISPEENVTLTCTAENQLERTVNSLNVSANENR", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61490-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2196", "url": "https://glyconnect.expasy.org/browser/proteins/2196" } ], "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 583, "chemical_mass": 65092.0 } ] }, { "start_pos": "190", "site_seq": "N", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54901-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2198", "url": "https://glyconnect.expasy.org/browser/proteins/2198" } ], "protein_name": "OX-2 membrane glycoprotein", "gene_name": "Cd200", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31256.0 } ] }, { "start_pos": "190", "site_seq": "GTGTGIENSTESHFHSNGTTSVTSILR", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54901-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2198", "url": "https://glyconnect.expasy.org/browser/proteins/2198" } ], "protein_name": "OX-2 membrane glycoprotein", "gene_name": "Cd200", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31256.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q924Z4-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2203", "url": "https://glyconnect.expasy.org/browser/proteins/2203" } ], "protein_name": "Ceramide synthase 2", "gene_name": "Cers2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 45024.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDKDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q924Z4-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2203", "url": "https://glyconnect.expasy.org/browser/proteins/2203" } ], "protein_name": "Ceramide synthase 2", "gene_name": "Cers2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 380, "chemical_mass": 45024.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C172-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2204", "url": "https://glyconnect.expasy.org/browser/proteins/2204" } ], "protein_name": "Ceramide synthase 6", "gene_name": "Cers6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 384, "chemical_mass": 44813.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGU2-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2205", "url": "https://glyconnect.expasy.org/browser/proteins/2205" } ], "protein_name": "Cerebellin-2", "gene_name": "Cbln2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 224, "chemical_mass": 24051.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on its ability to form homohexameric or heteromeric complexes with other CBLN family members. Increased interaction with NRXN1. Total loss of N-glycosylation; when associated with Q-53.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGU2", "url": "https://www.uniprot.org/uniprotkb/Q8BGU2" }, { "database": "PubMed", "id": "17331201", "url": "https://glygen.org/publication/PubMed/17331201" }, { "database": "PubMed", "id": "29782851", "url": "https://glygen.org/publication/PubMed/29782851" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGU2-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2205", "url": "https://glyconnect.expasy.org/browser/proteins/2205" } ], "protein_name": "Cerebellin-2", "gene_name": "Cbln2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 224, "chemical_mass": 24051.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6X893-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2210", "url": "https://glyconnect.expasy.org/browser/proteins/2210" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "Slc44a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 653, "chemical_mass": 73067.0 } ] }, { "start_pos": "134", "site_seq": "FAEINGSALCSYNIK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6X893-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2210", "url": "https://glyconnect.expasy.org/browser/proteins/2210" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "Slc44a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 653, "chemical_mass": 73067.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VBZ3-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2218", "url": "https://glyconnect.expasy.org/browser/proteins/2218" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "Clptm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 664, "chemical_mass": 75291.0 } ] }, { "start_pos": "295", "site_seq": "DYYPINESLASLPLR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VBZ3-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2218", "url": "https://glyconnect.expasy.org/browser/proteins/2218" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "Clptm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 664, "chemical_mass": 75291.0 } ] }, { "start_pos": "230", "site_seq": "N", "site_lbl": "Asn230", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA5-1", "start_pos": 230, "end_pos": 230, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2219", "url": "https://glyconnect.expasy.org/browser/proteins/2219" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "Clptm1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 62183.0 } ] }, { "start_pos": "230", "site_seq": "DLMVINR", "site_lbl": "Asn230", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA5-1", "start_pos": 230, "end_pos": 230, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2219", "url": "https://glyconnect.expasy.org/browser/proteins/2219" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "Clptm1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 62183.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2219", "url": "https://glyconnect.expasy.org/browser/proteins/2219" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "Clptm1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 62183.0 } ] }, { "start_pos": "91", "site_seq": "TVNVSVPK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA5-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2219", "url": "https://glyconnect.expasy.org/browser/proteins/2219" } ], "protein_name": "Lipid scramblase CLPTM1L", "gene_name": "Clptm1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 539, "chemical_mass": 62183.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98086-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2223", "url": "https://glyconnect.expasy.org/browser/proteins/2223" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1qa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 245, "chemical_mass": 25974.0 } ] }, { "start_pos": "146", "site_seq": "VLTNQESPYQNHTGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98086-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2223", "url": "https://glyconnect.expasy.org/browser/proteins/2223" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1qa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 245, "chemical_mass": 25974.0 } ] }, { "start_pos": "258", "site_seq": "N", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "258", "site_seq": "DIYTMMGQNVTLECFALGNPVPDIR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "338", "site_seq": "N", "site_lbl": "Asn338", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 338, "end_pos": 338, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "457", "site_seq": "GTEWLVNSSR", "site_lbl": "Asn457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 457, "end_pos": 457, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "457", "site_seq": "N", "site_lbl": "Asn457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 457, "end_pos": 457, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "593", "site_seq": "N", "site_lbl": "Asn593", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 593, "end_pos": 593, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "593", "site_seq": "YTCTAQTIVDNSSASADLVVR", "site_lbl": "Asn593", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 593, "end_pos": 593, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "935", "site_seq": "N", "site_lbl": "Asn935", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 935, "end_pos": 935, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "935", "site_seq": "YIITWDHVVALSNESTVTGYK", "site_lbl": "Asn935", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 935, "end_pos": 935, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "463", "site_seq": "GTEILGNSTR", "site_lbl": "Asn463", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61330-1", "start_pos": 463, "end_pos": 463, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2225", "url": "https://glyconnect.expasy.org/browser/proteins/2225" } ], "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1040, "chemical_mass": 113217.0 } ] }, { "start_pos": "463", "site_seq": "N", "site_lbl": "Asn463", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61330-1", "start_pos": 463, "end_pos": 463, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2225", "url": "https://glyconnect.expasy.org/browser/proteins/2225" } ], "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1040, "chemical_mass": 113217.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61330-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2225", "url": "https://glyconnect.expasy.org/browser/proteins/2225" } ], "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1040, "chemical_mass": 113217.0 } ] }, { "start_pos": "78", "site_seq": "WKMNGTEMNLEPGSR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61330-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2225", "url": "https://glyconnect.expasy.org/browser/proteins/2225" } ], "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1040, "chemical_mass": 113217.0 } ] }, { "start_pos": "500", "site_seq": "N", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "500", "site_seq": "WGCHSNQTAFHGCMELLK", "site_lbl": "Asn500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 500, "end_pos": 500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "519", "site_seq": "N", "site_lbl": "Asn519", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 519, "end_pos": 519, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "519", "site_seq": "VDGQLVNLTLVEFRK", "site_lbl": "Asn519", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 519, "end_pos": 519, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "764", "site_seq": "GLLTFVDHLPVTQVVVGDTNR", "site_lbl": "Asn764", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 764, "end_pos": 764, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "764", "site_seq": "N", "site_lbl": "Asn764", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 764, "end_pos": 764, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "805", "site_seq": "N", "site_lbl": "Asn805", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 805, "end_pos": 805, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "805", "site_seq": "ANHSLDVSFYFR", "site_lbl": "Asn805", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 805, "end_pos": 805, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "844", "site_seq": "N", "site_lbl": "Asn844", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 844, "end_pos": 844, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "844", "site_seq": "VELNTSR", "site_lbl": "Asn844", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54991-1", "start_pos": 844, "end_pos": 844, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2230", "url": "https://glyconnect.expasy.org/browser/proteins/2230" } ], "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1385, "chemical_mass": 156312.0 } ] }, { "start_pos": "1117", "site_seq": "N", "site_lbl": "Asn1117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 1117, "end_pos": 1117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "1117", "site_seq": "NMANGQPHSVNITR", "site_lbl": "Asn1117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 1117, "end_pos": 1117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "346", "site_seq": "GCMESINYNGVNITDLAR", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "436", "site_seq": "VGVHINNTQTK", "site_lbl": "Asn436", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "436", "site_seq": "N", "site_lbl": "Asn436", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "546", "site_seq": "KPGSFANVTIDMCAIIDR", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50172-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2235", "url": "https://glyconnect.expasy.org/browser/proteins/2235" } ], "protein_name": "11-beta-hydroxysteroid dehydrogenase 1", "gene_name": "Hsd11b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 292, "chemical_mass": 32364.0 } ] }, { "start_pos": "162", "site_seq": "QSNGSIAVISSLAGK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50172-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2235", "url": "https://glyconnect.expasy.org/browser/proteins/2235" } ], "protein_name": "11-beta-hydroxysteroid dehydrogenase 1", "gene_name": "Hsd11b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 292, "chemical_mass": 32364.0 } ] }, { "start_pos": "204", "site_seq": "N", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60571-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2237", "url": "https://glyconnect.expasy.org/browser/proteins/2237" } ], "protein_name": "Corticotropin-releasing factor-binding protein", "gene_name": "Crhbp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 322, "chemical_mass": 36048.0 } ] }, { "start_pos": "204", "site_seq": "TDPNLFPCNVISQTPSGRFTLVVPYQHQNCSFSIIYPVAIK", "site_lbl": "Asn204", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60571-1", "start_pos": 204, "end_pos": 204, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2237", "url": "https://glyconnect.expasy.org/browser/proteins/2237" } ], "protein_name": "Corticotropin-releasing factor-binding protein", "gene_name": "Crhbp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 322, "chemical_mass": 36048.0 } ] }, { "start_pos": "1133", "site_seq": "N", "site_lbl": "Asn1133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64449-1", "start_pos": 1133, "end_pos": 1133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2240", "url": "https://glyconnect.expasy.org/browser/proteins/2240" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "Mrc2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1479, "chemical_mass": 167074.0 } ] }, { "start_pos": "1133", "site_seq": "GTDPSLSPSPAATPPAPGAELSYLNHTFR", "site_lbl": "Asn1133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64449-1", "start_pos": 1133, "end_pos": 1133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2240", "url": "https://glyconnect.expasy.org/browser/proteins/2240" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "Mrc2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1479, "chemical_mass": 167074.0 } ] }, { "start_pos": "1572", "site_seq": "N", "site_lbl": "Asn1572", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 1572, "end_pos": 1572, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "1572", "site_seq": "EACFDPGNIMNGTR", "site_lbl": "Asn1572", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 1572, "end_pos": 1572, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "2795", "site_seq": "N", "site_lbl": "Asn2795", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 2795, "end_pos": 2795, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "2795", "site_seq": "VVNCSDPGSVENAVR", "site_lbl": "Asn2795", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 2795, "end_pos": 2795, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "3086", "site_seq": "N", "site_lbl": "Asn3086", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 3086, "end_pos": 3086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "3086", "site_seq": "DGTWNQSRPLCK", "site_lbl": "Asn3086", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q923L3-1", "start_pos": 3086, "end_pos": 3086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2241", "url": "https://glyconnect.expasy.org/browser/proteins/2241" } ], "protein_name": "CUB and sushi domain-containing protein 1", "gene_name": "Csmd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3564, "chemical_mass": 387862.0 } ] }, { "start_pos": "2711", "site_seq": "N", "site_lbl": "Asn2711", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80T79-3", "start_pos": 2711, "end_pos": 2711, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2242", "url": "https://glyconnect.expasy.org/browser/proteins/2242" } ], "protein_name": "CUB and sushi domain-containing protein 3", "gene_name": "Csmd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3707, "chemical_mass": 405762.0 } ] }, { "start_pos": "2711", "site_seq": "IVNGSHYEYK", "site_lbl": "Asn2711", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80T79-3", "start_pos": 2711, "end_pos": 2711, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2242", "url": "https://glyconnect.expasy.org/browser/proteins/2242" } ], "protein_name": "CUB and sushi domain-containing protein 3", "gene_name": "Csmd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3707, "chemical_mass": 405762.0 } ] }, { "start_pos": "2932", "site_seq": "VVNCSDPGIPANSK", "site_lbl": "Asn2932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80T79-3", "start_pos": 2932, "end_pos": 2932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2242", "url": "https://glyconnect.expasy.org/browser/proteins/2242" } ], "protein_name": "CUB and sushi domain-containing protein 3", "gene_name": "Csmd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3707, "chemical_mass": 405762.0 } ] }, { "start_pos": "2932", "site_seq": "N", "site_lbl": "Asn2932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80T79-3", "start_pos": 2932, "end_pos": 2932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2242", "url": "https://glyconnect.expasy.org/browser/proteins/2242" } ], "protein_name": "CUB and sushi domain-containing protein 3", "gene_name": "Csmd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3707, "chemical_mass": 405762.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21460-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2245", "url": "https://glyconnect.expasy.org/browser/proteins/2245" } ], "protein_name": "Cystatin-C", "gene_name": "Cst3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15531.0 } ] }, { "start_pos": "99", "site_seq": "SQTNLTDCPFHDQPHLMR", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21460-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2245", "url": "https://glyconnect.expasy.org/browser/proteins/2245" } ], "protein_name": "Cystatin-C", "gene_name": "Cst3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15531.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91XD7-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2247", "url": "https://glyconnect.expasy.org/browser/proteins/2247" } ], "protein_name": "Protein disulfide isomerase Creld1", "gene_name": "Creld1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 420, "chemical_mass": 45718.0 } ] }, { "start_pos": "205", "site_seq": "NSSHLVCSACFGPCAR", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91XD7-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2247", "url": "https://glyconnect.expasy.org/browser/proteins/2247" } ], "protein_name": "Protein disulfide isomerase Creld1", "gene_name": "Creld1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 420, "chemical_mass": 45718.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CYA0-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2248", "url": "https://glyconnect.expasy.org/browser/proteins/2248" } ], "protein_name": "Protein disulfide isomerase Creld2", "gene_name": "Creld2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 350, "chemical_mass": 38220.0 } ] }, { "start_pos": "188", "site_seq": "NETHSICSACDESCK", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CYA0-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2248", "url": "https://glyconnect.expasy.org/browser/proteins/2248" } ], "protein_name": "Protein disulfide isomerase Creld2", "gene_name": "Creld2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 350, "chemical_mass": 38220.0 } ] }, { "start_pos": "225", "site_seq": "N", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EPS3-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2253", "url": "https://glyconnect.expasy.org/browser/proteins/2253" } ], "protein_name": "D-glucuronyl C5-epimerase", "gene_name": "Glce", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 618, "chemical_mass": 70089.0 } ] }, { "start_pos": "225", "site_seq": "NLTEKPPHIEVYETAEDRDR", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EPS3-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2253", "url": "https://glyconnect.expasy.org/browser/proteins/2253" } ], "protein_name": "D-glucuronyl C5-epimerase", "gene_name": "Glce", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 618, "chemical_mass": 70089.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QUN9-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2254", "url": "https://glyconnect.expasy.org/browser/proteins/2254" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "Dkk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 349, "chemical_mass": 38388.0 } ] }, { "start_pos": "106", "site_seq": "VGNNTVHVHQEVHK", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QUN9-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2254", "url": "https://glyconnect.expasy.org/browser/proteins/2254" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "Dkk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 349, "chemical_mass": 38388.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "343", "site_seq": "AQNVSILTLCDATTGVCTK", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "474", "site_seq": "N", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "474", "site_seq": "QCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDK", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "505", "site_seq": "N", "site_lbl": "Asn505", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 505, "end_pos": 505, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "505", "site_seq": "CEGPGVPTVTVHNTTDK", "site_lbl": "Asn505", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 505, "end_pos": 505, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "752", "site_seq": "N", "site_lbl": "Asn752", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 752, "end_pos": 752, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "752", "site_seq": "ANYSLQIYPDESHYFHSVALK", "site_lbl": "Asn752", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 752, "end_pos": 752, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "440", "site_seq": "N", "site_lbl": "Asn440", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35598-1", "start_pos": 440, "end_pos": 440, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2257", "url": "https://glyconnect.expasy.org/browser/proteins/2257" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "Adam10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 749, "chemical_mass": 83968.0 } ] }, { "start_pos": "440", "site_seq": "NISQVLEK", "site_lbl": "Asn440", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35598-1", "start_pos": 440, "end_pos": 440, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2257", "url": "https://glyconnect.expasy.org/browser/proteins/2257" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "Adam10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 749, "chemical_mass": 83968.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V7-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2259", "url": "https://glyconnect.expasy.org/browser/proteins/2259" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 23", "gene_name": "Adam23", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 829, "chemical_mass": 91548.0 } ] }, { "start_pos": "72", "site_seq": "GAAAPSAPHWNETAEK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V7-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2259", "url": "https://glyconnect.expasy.org/browser/proteins/2259" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 23", "gene_name": "Adam23", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 829, "chemical_mass": 91548.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61072-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2260", "url": "https://glyconnect.expasy.org/browser/proteins/2260" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "Adam9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 845, "chemical_mass": 92079.0 } ] }, { "start_pos": "381", "site_seq": "NFSSCSAEDFEK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61072-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2260", "url": "https://glyconnect.expasy.org/browser/proteins/2260" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "Adam9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 845, "chemical_mass": 92079.0 } ] }, { "start_pos": "300", "site_seq": "N", "site_lbl": "Asn300", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91YQ5-1", "start_pos": 300, "end_pos": 300, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2262", "url": "https://glyconnect.expasy.org/browser/proteins/2262" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "Rpn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 608, "chemical_mass": 68528.0 } ] }, { "start_pos": "300", "site_seq": "DEIGNVSTSHLLILDDSVEMEIRPR", "site_lbl": "Asn300", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91YQ5-1", "start_pos": 300, "end_pos": 300, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2262", "url": "https://glyconnect.expasy.org/browser/proteins/2262" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "Rpn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 608, "chemical_mass": 68528.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBG6-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2263", "url": "https://glyconnect.expasy.org/browser/proteins/2263" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "Rpn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 631, "chemical_mass": 69063.0 } ] }, { "start_pos": "106", "site_seq": "SNLDPSNVDSLFYAAQSSQVLSGCEISVSNETK", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBG6-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2263", "url": "https://glyconnect.expasy.org/browser/proteins/2263" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "Rpn2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 631, "chemical_mass": 69063.0 } ] }, { "start_pos": "1345", "site_seq": "N", "site_lbl": "Asn1345", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q4VA61-1", "start_pos": 1345, "end_pos": 1345, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2267", "url": "https://glyconnect.expasy.org/browser/proteins/2267" } ], "protein_name": "Cell adhesion molecule DSCAML1", "gene_name": "Dscaml1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2053, "chemical_mass": 224240.0 } ] }, { "start_pos": "1345", "site_seq": "LIHTNGTLLLR", "site_lbl": "Asn1345", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q4VA61-1", "start_pos": 1345, "end_pos": 1345, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2267", "url": "https://glyconnect.expasy.org/browser/proteins/2267" } ], "protein_name": "Cell adhesion molecule DSCAML1", "gene_name": "Dscaml1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2053, "chemical_mass": 224240.0 } ] }, { "start_pos": "742", "site_seq": "N", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZV5-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2268", "url": "https://glyconnect.expasy.org/browser/proteins/2268" } ], "protein_name": "Dyslexia-associated protein KIAA0319 homolog", "gene_name": "Kiaa0319", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1081, "chemical_mass": 117988.0 } ] }, { "start_pos": "742", "site_seq": "HVLILPNNSITLDGSR", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZV5-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2268", "url": "https://glyconnect.expasy.org/browser/proteins/2268" } ], "protein_name": "Dyslexia-associated protein KIAA0319 homolog", "gene_name": "Kiaa0319", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1081, "chemical_mass": 117988.0 } ] }, { "start_pos": "889", "site_seq": "N", "site_lbl": "Asn889", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K135-1", "start_pos": 889, "end_pos": 889, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2269", "url": "https://glyconnect.expasy.org/browser/proteins/2269" }, { "database": "GlyConnect", "id": "2422", "url": "https://glyconnect.expasy.org/browser/proteins/2422" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "Kiaa0319l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1048, "chemical_mass": 115312.0 } ] }, { "start_pos": "889", "site_seq": "ALEISTVTCQLNCSDHGHCDSFTK", "site_lbl": "Asn889", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K135-1", "start_pos": 889, "end_pos": 889, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2269", "url": "https://glyconnect.expasy.org/browser/proteins/2269" }, { "database": "GlyConnect", "id": "2422", "url": "https://glyconnect.expasy.org/browser/proteins/2422" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "Kiaa0319l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1048, "chemical_mass": 115312.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEM1-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2271", "url": "https://glyconnect.expasy.org/browser/proteins/2271" } ], "protein_name": "E3 ubiquitin-protein ligase RNF130", "gene_name": "Rnf130", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 419, "chemical_mass": 46376.0 } ] }, { "start_pos": "135", "site_seq": "AAFHNAVAVVIYNNK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEM1-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2271", "url": "https://glyconnect.expasy.org/browser/proteins/2271" } ], "protein_name": "E3 ubiquitin-protein ligase RNF130", "gene_name": "Rnf130", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 419, "chemical_mass": 46376.0 } ] }, { "start_pos": "129", "site_seq": "N", "site_lbl": "Asn129", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O55026-1", "start_pos": 129, "end_pos": 129, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2273", "url": "https://glyconnect.expasy.org/browser/proteins/2273" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "Entpd2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 495, "chemical_mass": 54319.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O55026-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2273", "url": "https://glyconnect.expasy.org/browser/proteins/2273" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "Entpd2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 495, "chemical_mass": 54319.0 } ] }, { "start_pos": "404", "site_seq": "N", "site_lbl": "Asn404", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGN3-1", "start_pos": 404, "end_pos": 404, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2277", "url": "https://glyconnect.expasy.org/browser/proteins/2277" } ], "protein_name": "Glycerophosphocholine cholinephosphodiesterase ENPP6", "gene_name": "Enpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 50618.0 } ] }, { "start_pos": "404", "site_seq": "AAPIRSVDVYNIMCHVAGITPLPNNGSWSR", "site_lbl": "Asn404", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BGN3-1", "start_pos": 404, "end_pos": 404, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2277", "url": "https://glyconnect.expasy.org/browser/proteins/2277" } ], "protein_name": "Glycerophosphocholine cholinephosphodiesterase ENPP6", "gene_name": "Enpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 50618.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYW9-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2279", "url": "https://glyconnect.expasy.org/browser/proteins/2279" } ], "protein_name": "EGF domain-specific O-linked N-acetylglucosamine transferase", "gene_name": "Eogt", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 527, "chemical_mass": 61446.0 } ] }, { "start_pos": "354", "site_seq": "LNITQEGPKDGK", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BYW9-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2279", "url": "https://glyconnect.expasy.org/browser/proteins/2279" } ], "protein_name": "EGF domain-specific O-linked N-acetylglucosamine transferase", "gene_name": "Eogt", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 527, "chemical_mass": 61446.0 } ] }, { "start_pos": "20", "site_seq": "N", "site_lbl": "Asn20", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQC4-1", "start_pos": 20, "end_pos": 20, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2280", "url": "https://glyconnect.expasy.org/browser/proteins/2280" } ], "protein_name": "Very long chain fatty acid elongase 4", "gene_name": "Elovl4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 312, "chemical_mass": 36506.0 } ] }, { "start_pos": "20", "site_seq": "", "site_lbl": "N20", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "9", "chr_pos": "83688034", "evidence": [ { "id": "rs3389055010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389055010" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "9", "chr_pos": "83688033", "evidence": [ { "id": "rs3389069982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389069982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQC4-1", "start_pos": 20, "end_pos": 20, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2280", "url": "https://glyconnect.expasy.org/browser/proteins/2280" } ], "protein_name": "Very long chain fatty acid elongase 4", "gene_name": "Elovl4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 312, "chemical_mass": 36506.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "118", "site_seq": "KDDEPLETTGDFNTTK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "216", "site_seq": "N", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "216", "site_seq": "YIINGSHANETR", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "62", "site_seq": "SCNISVTEK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "70", "site_seq": "SNVSVEENVILEKPSHVELK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQH2-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2283", "url": "https://glyconnect.expasy.org/browser/proteins/2283" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "Erap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 930, "chemical_mass": 106599.0 } ] }, { "start_pos": "403", "site_seq": "CFNAMEVDALNSSHPVSTPVENPAQIR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQH2-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2283", "url": "https://glyconnect.expasy.org/browser/proteins/2283" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "Erap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 930, "chemical_mass": 106599.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "217", "site_seq": "VIVTSKHNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "445", "site_seq": "N", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "445", "site_seq": "GVVDSDDLPLNVSR", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "502", "site_seq": "N", "site_lbl": "Asn502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 502, "end_pos": 502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "502", "site_seq": "LGVIEDHSNR", "site_lbl": "Asn502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 502, "end_pos": 502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08113-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2287", "url": "https://glyconnect.expasy.org/browser/proteins/2287" } ], "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 802, "chemical_mass": 92476.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q4PZA2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2289", "url": "https://glyconnect.expasy.org/browser/proteins/2289" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "Ece1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 769, "chemical_mass": 87073.0 } ] }, { "start_pos": "165", "site_seq": "HLLENATASVSEAER", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q4PZA2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2289", "url": "https://glyconnect.expasy.org/browser/proteins/2289" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "Ece1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 769, "chemical_mass": 87073.0 } ] }, { "start_pos": "38", "site_seq": "N", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08545-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2291", "url": "https://glyconnect.expasy.org/browser/proteins/2291" } ], "protein_name": "Ephrin-A3", "gene_name": "Efna3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 230, "chemical_mass": 25632.0 } ] }, { "start_pos": "38", "site_seq": "HAVYWNSSNQHLR", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08545-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2291", "url": "https://glyconnect.expasy.org/browser/proteins/2291" } ], "protein_name": "Ephrin-A3", "gene_name": "Efna3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 230, "chemical_mass": 25632.0 } ] }, { "start_pos": "37", "site_seq": "N", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08543-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2293", "url": "https://glyconnect.expasy.org/browser/proteins/2293" } ], "protein_name": "Ephrin-A5", "gene_name": "Efna5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 228, "chemical_mass": 26339.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01279-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2297", "url": "https://glyconnect.expasy.org/browser/proteins/2297" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "Egfr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1210, "chemical_mass": 134853.0 } ] }, { "start_pos": "352", "site_seq": "DTLSINATNIK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01279-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2297", "url": "https://glyconnect.expasy.org/browser/proteins/2297" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "Egfr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1210, "chemical_mass": 134853.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2HXL6-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2299", "url": "https://glyconnect.expasy.org/browser/proteins/2299" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 3", "gene_name": "Edem3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 931, "chemical_mass": 104200.0 } ] }, { "start_pos": "196", "site_seq": "LLPAFNTTSGLPYPR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2HXL6-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2299", "url": "https://glyconnect.expasy.org/browser/proteins/2299" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 3", "gene_name": "Edem3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 931, "chemical_mass": 104200.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TAS6-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2303", "url": "https://glyconnect.expasy.org/browser/proteins/2303" } ], "protein_name": "ER membrane protein complex subunit 10", "gene_name": "Emc10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 258, "chemical_mass": 27053.0 } ] }, { "start_pos": "182", "site_seq": "GSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIER", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3TAS6-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2303", "url": "https://glyconnect.expasy.org/browser/proteins/2303" } ], "protein_name": "ER membrane protein complex subunit 10", "gene_name": "Emc10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 258, "chemical_mass": 27053.0 } ] }, { "start_pos": "276", "site_seq": "N", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R180-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2304", "url": "https://glyconnect.expasy.org/browser/proteins/2304" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 464, "chemical_mass": 54084.0 } ] }, { "start_pos": "276", "site_seq": "WGHNVTEFQQR", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R180-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2304", "url": "https://glyconnect.expasy.org/browser/proteins/2304" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 464, "chemical_mass": 54084.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43006-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2306", "url": "https://glyconnect.expasy.org/browser/proteins/2306" } ], "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 572, "chemical_mass": 62030.0 } ] }, { "start_pos": "205", "site_seq": "KVLVAPPSEEANTTK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43006-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2306", "url": "https://glyconnect.expasy.org/browser/proteins/2306" } ], "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 572, "chemical_mass": 62030.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43006-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2306", "url": "https://glyconnect.expasy.org/browser/proteins/2306" } ], "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 572, "chemical_mass": 62030.0 } ] }, { "start_pos": "215", "site_seq": "AVISMLNETMNEAPEETK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43006-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2306", "url": "https://glyconnect.expasy.org/browser/proteins/2306" } ], "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 572, "chemical_mass": 62030.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62812-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2320", "url": "https://glyconnect.expasy.org/browser/proteins/2320" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-1", "gene_name": "Gabra1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 455, "chemical_mass": 51754.0 } ] }, { "start_pos": "137", "site_seq": "SVAHNMTMPNK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62812-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2320", "url": "https://glyconnect.expasy.org/browser/proteins/2320" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-1", "gene_name": "Gabra1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 455, "chemical_mass": 51754.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26048-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2321", "url": "https://glyconnect.expasy.org/browser/proteins/2321" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-2", "gene_name": "Gabra2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 451, "chemical_mass": 51139.0 } ] }, { "start_pos": "138", "site_seq": "SVAHNMTMPNKLLRIQDDGTLLYTMR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26048-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2321", "url": "https://glyconnect.expasy.org/browser/proteins/2321" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-2", "gene_name": "Gabra2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 451, "chemical_mass": 51139.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "163", "site_seq": "KSVAHNMTTPNK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "176", "site_seq": "LVDNGTLLYTMR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "63", "site_seq": "HAPDIPDDSTDNITIFTR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26049-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2322", "url": "https://glyconnect.expasy.org/browser/proteins/2322" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-3", "gene_name": "Gabra3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 492, "chemical_mass": 55398.0 } ] }, { "start_pos": "144", "site_seq": "SVSHNMTAPNK", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D6F4-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2323", "url": "https://glyconnect.expasy.org/browser/proteins/2323" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-4", "gene_name": "Gabra4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 60878.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D6F4-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2323", "url": "https://glyconnect.expasy.org/browser/proteins/2323" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-4", "gene_name": "Gabra4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 60878.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D6F4-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2323", "url": "https://glyconnect.expasy.org/browser/proteins/2323" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-4", "gene_name": "Gabra4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 60878.0 } ] }, { "start_pos": "157", "site_seq": "LFRIMRNGTILYTMR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D6F4-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2323", "url": "https://glyconnect.expasy.org/browser/proteins/2323" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-4", "gene_name": "Gabra4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 60878.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "N157", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "5", "chr_pos": "71798431", "evidence": [ { "id": "rs3388765110", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388765110" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9D6F4-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2323", "url": "https://glyconnect.expasy.org/browser/proteins/2323" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-4", "gene_name": "Gabra4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 60878.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHJ7-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2324", "url": "https://glyconnect.expasy.org/browser/proteins/2324" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-5", "gene_name": "Gabra5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 52274.0 } ] }, { "start_pos": "145", "site_seq": "IWTPDTFFHNGKKSIAHNMTTPNK", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BHJ7-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2324", "url": "https://glyconnect.expasy.org/browser/proteins/2324" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit alpha-5", "gene_name": "Gabra5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 52274.0 } ] }, { "start_pos": "104", "site_seq": "LSYNVIPLNLTLDNR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P63137-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2325", "url": "https://glyconnect.expasy.org/browser/proteins/2325" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit beta-2", "gene_name": "Gabrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 512, "chemical_mass": 59197.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P63137-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2325", "url": "https://glyconnect.expasy.org/browser/proteins/2325" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit beta-2", "gene_name": "Gabrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 512, "chemical_mass": 59197.0 } ] }, { "start_pos": "246", "site_seq": "N", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22723-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2327", "url": "https://glyconnect.expasy.org/browser/proteins/2327" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit gamma-2", "gene_name": "Gabrg2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 474, "chemical_mass": 55099.0 } ] }, { "start_pos": "246", "site_seq": "NTTEVVK", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22723-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2327", "url": "https://glyconnect.expasy.org/browser/proteins/2327" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit gamma-2", "gene_name": "Gabrg2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 474, "chemical_mass": 55099.0 } ] }, { "start_pos": "501", "site_seq": "LEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSR", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV18-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2328", "url": "https://glyconnect.expasy.org/browser/proteins/2328" } ], "protein_name": "Gamma-aminobutyric acid type B receptor subunit 1", "gene_name": "Gabbr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 960, "chemical_mass": 108216.0 } ] }, { "start_pos": "501", "site_seq": "N", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WV18-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2328", "url": "https://glyconnect.expasy.org/browser/proteins/2328" } ], "protein_name": "Gamma-aminobutyric acid type B receptor subunit 1", "gene_name": "Gabbr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 960, "chemical_mass": 108216.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L8-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2330", "url": "https://glyconnect.expasy.org/browser/proteins/2330" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "Ggh", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 317, "chemical_mass": 35470.0 } ] }, { "start_pos": "162", "site_seq": "KLPLNFTEGAR", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L8-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2330", "url": "https://glyconnect.expasy.org/browser/proteins/2330" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "Ggh", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 317, "chemical_mass": 35470.0 } ] }, { "start_pos": "202", "site_seq": "N", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L8-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2330", "url": "https://glyconnect.expasy.org/browser/proteins/2330" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "Ggh", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 317, "chemical_mass": 35470.0 } ] }, { "start_pos": "202", "site_seq": "WSLSVKNFTENEK", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0L8-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2330", "url": "https://glyconnect.expasy.org/browser/proteins/2330" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "Ggh", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 317, "chemical_mass": 35470.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99JP7-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2332", "url": "https://glyconnect.expasy.org/browser/proteins/2332" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "Ggt7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 662, "chemical_mass": 70251.0 } ] }, { "start_pos": "198", "site_seq": "RNESHLIDFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99JP7-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2332", "url": "https://glyconnect.expasy.org/browser/proteins/2332" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "Ggt7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 662, "chemical_mass": 70251.0 } ] }, { "start_pos": "523", "site_seq": "N", "site_lbl": "Asn523", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99JP7-1", "start_pos": 523, "end_pos": 523, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2332", "url": "https://glyconnect.expasy.org/browser/proteins/2332" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "Ggt7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 662, "chemical_mass": 70251.0 } ] }, { "start_pos": "523", "site_seq": "TANHSAPSLENSVQPGK", "site_lbl": "Asn523", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99JP7-1", "start_pos": 523, "end_pos": 523, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2332", "url": "https://glyconnect.expasy.org/browser/proteins/2332" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "Ggt7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 662, "chemical_mass": 70251.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CFX1-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2334", "url": "https://glyconnect.expasy.org/browser/proteins/2334" } ], "protein_name": "GDH/6PGL endoplasmic bifunctional protein", "gene_name": "H6pd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 789, "chemical_mass": 88928.0 } ] }, { "start_pos": "154", "site_seq": "NINSSCRPHPGAWLR", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CFX1-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2334", "url": "https://glyconnect.expasy.org/browser/proteins/2334" } ], "protein_name": "GDH/6PGL endoplasmic bifunctional protein", "gene_name": "H6pd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 789, "chemical_mass": 88928.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZW2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2335", "url": "https://glyconnect.expasy.org/browser/proteins/2335" } ], "protein_name": "GDP-fucose protein O-fucosyltransferase 1", "gene_name": "Pofut1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 393, "chemical_mass": 44688.0 } ] }, { "start_pos": "351", "site_seq": "N", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UHH8-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2338", "url": "https://glyconnect.expasy.org/browser/proteins/2338" } ], "protein_name": "Glucoside xylosyltransferase 1", "gene_name": "Gxylt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 404, "chemical_mass": 46491.0 } ] }, { "start_pos": "351", "site_seq": "NCSLEDDSVR", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UHH8-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2338", "url": "https://glyconnect.expasy.org/browser/proteins/2338" } ], "protein_name": "Glucoside xylosyltransferase 1", "gene_name": "Gxylt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 404, "chemical_mass": 46491.0 } ] }, { "start_pos": "289", "site_seq": "N", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17439-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2339", "url": "https://glyconnect.expasy.org/browser/proteins/2339" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "Gba1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57622.0 } ] }, { "start_pos": "289", "site_seq": "DLGPALANSSHDVK", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17439-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2339", "url": "https://glyconnect.expasy.org/browser/proteins/2339" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "Gba1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57622.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] }, { "start_pos": "256", "site_seq": "IQFGGANVSGFQIVDYDDSLVSK", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] }, { "start_pos": "370", "site_seq": "RINYTINIMELK", "site_lbl": "Asn370", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 370, "end_pos": 370, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] }, { "start_pos": "370", "site_seq": "N", "site_lbl": "Asn370", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 370, "end_pos": 370, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] }, { "start_pos": "260", "site_seq": "N", "site_lbl": "Asn260", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W9-1", "start_pos": 260, "end_pos": 260, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2343", "url": "https://glyconnect.expasy.org/browser/proteins/2343" } ], "protein_name": "Glutamate receptor 3", "gene_name": "Gria3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 100527.0 } ] }, { "start_pos": "260", "site_seq": "VMHGGANITGFQIVNNENPMVQQFIQR", "site_lbl": "Asn260", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W9-1", "start_pos": 260, "end_pos": 260, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2343", "url": "https://glyconnect.expasy.org/browser/proteins/2343" } ], "protein_name": "Glutamate receptor 3", "gene_name": "Gria3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 100527.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W9-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2343", "url": "https://glyconnect.expasy.org/browser/proteins/2343" } ], "protein_name": "Glutamate receptor 3", "gene_name": "Gria3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 100527.0 } ] }, { "start_pos": "374", "site_seq": "TNYTIDVYEMK", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W9-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2343", "url": "https://glyconnect.expasy.org/browser/proteins/2343" } ], "protein_name": "Glutamate receptor 3", "gene_name": "Gria3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 100527.0 } ] }, { "start_pos": "258", "site_seq": "N", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W8-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2344", "url": "https://glyconnect.expasy.org/browser/proteins/2344" } ], "protein_name": "Glutamate receptor 4", "gene_name": "Gria4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 902, "chemical_mass": 100847.0 } ] }, { "start_pos": "258", "site_seq": "FIHGGANVTGFQLVDFNTPMVTKLMDR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W8-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2344", "url": "https://glyconnect.expasy.org/browser/proteins/2344" } ], "protein_name": "Glutamate receptor 4", "gene_name": "Gria4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 902, "chemical_mass": 100847.0 } ] }, { "start_pos": "371", "site_seq": "N", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W8-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2344", "url": "https://glyconnect.expasy.org/browser/proteins/2344" } ], "protein_name": "Glutamate receptor 4", "gene_name": "Gria4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 902, "chemical_mass": 100847.0 } ] }, { "start_pos": "371", "site_seq": "RVNYTMDVFELK", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2W8-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2344", "url": "https://glyconnect.expasy.org/browser/proteins/2344" } ], "protein_name": "Glutamate receptor 4", "gene_name": "Gria4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 902, "chemical_mass": 100847.0 } ] }, { "start_pos": "716", "site_seq": "N", "site_lbl": "Asn716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61625-1", "start_pos": 716, "end_pos": 716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2346", "url": "https://glyconnect.expasy.org/browser/proteins/2346" } ], "protein_name": "Glutamate receptor ionotropic, delta-2", "gene_name": "Grid2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1007, "chemical_mass": 113082.0 } ] }, { "start_pos": "716", "site_seq": "SNGSENNVLESQAGIQK", "site_lbl": "Asn716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61625-1", "start_pos": 716, "end_pos": 716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2346", "url": "https://glyconnect.expasy.org/browser/proteins/2346" } ], "protein_name": "Glutamate receptor ionotropic, delta-2", "gene_name": "Grid2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1007, "chemical_mass": 113082.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P39087-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2347", "url": "https://glyconnect.expasy.org/browser/proteins/2347" } ], "protein_name": "Glutamate receptor ionotropic, kainate 2", "gene_name": "Grik2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 908, "chemical_mass": 102486.0 } ] }, { "start_pos": "378", "site_seq": "ITFNKTNGLR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P39087-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2347", "url": "https://glyconnect.expasy.org/browser/proteins/2347" } ], "protein_name": "Glutamate receptor ionotropic, kainate 2", "gene_name": "Grik2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 908, "chemical_mass": 102486.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B1AS29-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2348", "url": "https://glyconnect.expasy.org/browser/proteins/2348" } ], "protein_name": "Glutamate receptor ionotropic, kainate 3", "gene_name": "Grik3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 919, "chemical_mass": 104051.0 } ] }, { "start_pos": "381", "site_seq": "IVFNKTSGLR", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B1AS29-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2348", "url": "https://glyconnect.expasy.org/browser/proteins/2348" } ], "protein_name": "Glutamate receptor ionotropic, kainate 3", "gene_name": "Grik3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 919, "chemical_mass": 104051.0 } ] }, { "start_pos": "203", "site_seq": "NVTALLMEAR", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "350", "site_seq": "KFANYSIMNLQNR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "368", "site_seq": "KLVQVGIYNGTHVIPNDR", "site_lbl": "Asn368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 368, "end_pos": 368, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "368", "site_seq": "N", "site_lbl": "Asn368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 368, "end_pos": 368, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "440", "site_seq": "N", "site_lbl": "Asn440", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 440, "end_pos": 440, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "440", "site_seq": "KVICTGPNDTSPGSPR", "site_lbl": "Asn440", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 440, "end_pos": 440, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "471", "site_seq": "N", "site_lbl": "Asn471", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 471, "end_pos": 471, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "471", "site_seq": "TMNFTYEVHLVADGK", "site_lbl": "Asn471", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 471, "end_pos": 471, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "491", "site_seq": "N", "site_lbl": "Asn491", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 491, "end_pos": 491, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "491", "site_seq": "TMNFTYEVHLVADGKFGTQERVNNSNK", "site_lbl": "Asn491", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 491, "end_pos": 491, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "771", "site_seq": "N", "site_lbl": "Asn771", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 771, "end_pos": 771, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "771", "site_seq": "QNVSLSILK", "site_lbl": "Asn771", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35438-1", "start_pos": 771, "end_pos": 771, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2349", "url": "https://glyconnect.expasy.org/browser/proteins/2349" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "Grin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 105481.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "341", "site_seq": "YLINVTFEGR", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "348", "site_seq": "NLSFSEDGYQMHPK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "688", "site_seq": "N", "site_lbl": "Asn688", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 688, "end_pos": 688, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "688", "site_seq": "FGTVPNGSTER", "site_lbl": "Asn688", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 688, "end_pos": 688, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2351", "url": "https://glyconnect.expasy.org/browser/proteins/2351" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "168", "site_seq": "N", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JL56-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2355", "url": "https://glyconnect.expasy.org/browser/proteins/2355" } ], "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 331, "chemical_mass": 37629.0 } ] }, { "start_pos": "168", "site_seq": "HNLTIFFDVK", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JL56-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2355", "url": "https://glyconnect.expasy.org/browser/proteins/2355" } ], "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 331, "chemical_mass": 37629.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JL56-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2355", "url": "https://glyconnect.expasy.org/browser/proteins/2355" } ], "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 331, "chemical_mass": 37629.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UUQ7-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2359", "url": "https://glyconnect.expasy.org/browser/proteins/2359" } ], "protein_name": "GPI inositol-deacylase", "gene_name": "Pgap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 922, "chemical_mass": 104578.0 } ] }, { "start_pos": "234", "site_seq": "HINLTTLSVAGGFR", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UUQ7-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2359", "url": "https://glyconnect.expasy.org/browser/proteins/2359" } ], "protein_name": "GPI inositol-deacylase", "gene_name": "Pgap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 922, "chemical_mass": 104578.0 } ] }, { "start_pos": "558", "site_seq": "N", "site_lbl": "Asn558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UUQ7-1", "start_pos": 558, "end_pos": 558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2359", "url": "https://glyconnect.expasy.org/browser/proteins/2359" } ], "protein_name": "GPI inositol-deacylase", "gene_name": "Pgap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 922, "chemical_mass": 104578.0 } ] }, { "start_pos": "558", "site_seq": "LHVAQPENDSHVALLK", "site_lbl": "Asn558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UUQ7-1", "start_pos": 558, "end_pos": 558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2359", "url": "https://glyconnect.expasy.org/browser/proteins/2359" } ], "protein_name": "GPI inositol-deacylase", "gene_name": "Pgap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 922, "chemical_mass": 104578.0 } ] }, { "start_pos": "370", "site_seq": "N", "site_lbl": "Asn370", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PD26-1", "start_pos": 370, "end_pos": 370, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2360", "url": "https://glyconnect.expasy.org/browser/proteins/2360" } ], "protein_name": "GPI-anchor transamidase component PIGS", "gene_name": "Pigs", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 555, "chemical_mass": 61711.0 } ] }, { "start_pos": "370", "site_seq": "IYNASELPVRVEVDMVR", "site_lbl": "Asn370", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PD26-1", "start_pos": 370, "end_pos": 370, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2360", "url": "https://glyconnect.expasy.org/browser/proteins/2360" } ], "protein_name": "GPI-anchor transamidase component PIGS", "gene_name": "Pigs", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 555, "chemical_mass": 61711.0 } ] }, { "start_pos": "289", "site_seq": "N", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEB4-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2363", "url": "https://glyconnect.expasy.org/browser/proteins/2363" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "Pla2g15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 47307.0 } ] }, { "start_pos": "289", "site_seq": "VFVYTPTTNYTLR", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEB4-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2363", "url": "https://glyconnect.expasy.org/browser/proteins/2363" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "Pla2g15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 47307.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEB4-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2363", "url": "https://glyconnect.expasy.org/browser/proteins/2363" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "Pla2g15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 47307.0 } ] }, { "start_pos": "99", "site_seq": "LVYNRTSR", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEB4-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2363", "url": "https://glyconnect.expasy.org/browser/proteins/2363" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "Pla2g15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 47307.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BM72-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2366", "url": "https://glyconnect.expasy.org/browser/proteins/2366" } ], "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "Hspa13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 471, "chemical_mass": 51709.0 } ] }, { "start_pos": "184", "site_seq": "NSTIQAANLAGLK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BM72-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2366", "url": "https://glyconnect.expasy.org/browser/proteins/2366" } ], "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "Hspa13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 471, "chemical_mass": 51709.0 } ] }, { "start_pos": "51", "site_seq": "ELISNSSDALDK", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07901-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2367", "url": "https://glyconnect.expasy.org/browser/proteins/2367" } ], "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "Hsp90aa1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 733, "chemical_mass": 84788.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07901-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2367", "url": "https://glyconnect.expasy.org/browser/proteins/2367" } ], "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "Hsp90aa1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 733, "chemical_mass": 84788.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R3H7-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2370", "url": "https://glyconnect.expasy.org/browser/proteins/2370" } ], "protein_name": "Heparan sulfate 2-O-sulfotransferase 1", "gene_name": "Hs2st1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 356, "chemical_mass": 41813.0 } ] }, { "start_pos": "108", "site_seq": "YHVLHINTTK", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R3H7-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2370", "url": "https://glyconnect.expasy.org/browser/proteins/2370" } ], "protein_name": "Heparan sulfate 2-O-sulfotransferase 1", "gene_name": "Hs2st1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 356, "chemical_mass": 41813.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q640R3-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2372", "url": "https://glyconnect.expasy.org/browser/proteins/2372" } ], "protein_name": "Hepatic and glial cell adhesion molecule", "gene_name": "Hepacam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 418, "chemical_mass": 46367.0 } ] }, { "start_pos": "189", "site_seq": "DGKPLLNDSR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q640R3-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2372", "url": "https://glyconnect.expasy.org/browser/proteins/2372" } ], "protein_name": "Hepatic and glial cell adhesion molecule", "gene_name": "Hepacam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 418, "chemical_mass": 46367.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35632-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2375", "url": "https://glyconnect.expasy.org/browser/proteins/2375" } ], "protein_name": "Hyaluronidase-2", "gene_name": "Hyal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 473, "chemical_mass": 53618.0 } ] }, { "start_pos": "390", "site_seq": "RNPSANTFLHLNASSFR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35632-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2375", "url": "https://glyconnect.expasy.org/browser/proteins/2375" } ], "protein_name": "Hyaluronidase-2", "gene_name": "Hyal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 473, "chemical_mass": 53618.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQNLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "596", "site_seq": "ENGTDAVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "830", "site_seq": "LSALDNLLNHSSIFLK", "site_lbl": "Asn830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 830, "end_pos": 830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "830", "site_seq": "N", "site_lbl": "Asn830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 830, "end_pos": 830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "862", "site_seq": "VINDTWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASAGDQEEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08890-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2377", "url": "https://glyconnect.expasy.org/browser/proteins/2377" } ], "protein_name": "Iduronate 2-sulfatase", "gene_name": "Ids", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 62186.0 } ] }, { "start_pos": "117", "site_seq": "VHSGNFSTIPQYFK", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08890-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2377", "url": "https://glyconnect.expasy.org/browser/proteins/2377" } ], "protein_name": "Iduronate 2-sulfatase", "gene_name": "Ids", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 552, "chemical_mass": 62186.0 } ] }, { "start_pos": "280", "site_seq": "N", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01872-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2379", "url": "https://glyconnect.expasy.org/browser/proteins/2379" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "Ighm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 454, "chemical_mass": 49972.0 } ] }, { "start_pos": "280", "site_seq": "IMESHPNGTFSAK", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01872-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2379", "url": "https://glyconnect.expasy.org/browser/proteins/2379" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "Ighm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 454, "chemical_mass": 49972.0 } ] }, { "start_pos": "407", "site_seq": "N", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TNR6-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2382", "url": "https://glyconnect.expasy.org/browser/proteins/2382" } ], "protein_name": "Immunoglobulin superfamily member 21", "gene_name": "Igsf21", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 468, "chemical_mass": 51937.0 } ] }, { "start_pos": "407", "site_seq": "VPAELNGSMYR", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TNR6-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2382", "url": "https://glyconnect.expasy.org/browser/proteins/2382" } ], "protein_name": "Immunoglobulin superfamily member 21", "gene_name": "Igsf21", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 468, "chemical_mass": 51937.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15208-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2393", "url": "https://glyconnect.expasy.org/browser/proteins/2393" } ], "protein_name": "Insulin receptor", "gene_name": "Insr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1372, "chemical_mass": 155610.0 } ] }, { "start_pos": "242", "site_seq": "ECLGNCSEPDDPTK", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15208-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2393", "url": "https://glyconnect.expasy.org/browser/proteins/2393" } ], "protein_name": "Insulin receptor", "gene_name": "Insr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1372, "chemical_mass": 155610.0 } ] }, { "start_pos": "170", "site_seq": "CYVIPLNTSIVMPPK", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89051-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2394", "url": "https://glyconnect.expasy.org/browser/proteins/2394" } ], "protein_name": "Integral membrane protein 2B", "gene_name": "Itm2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 266, "chemical_mass": 30260.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89051-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2394", "url": "https://glyconnect.expasy.org/browser/proteins/2394" } ], "protein_name": "Integral membrane protein 2B", "gene_name": "Itm2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 266, "chemical_mass": 30260.0 } ] }, { "start_pos": "1102", "site_seq": "N", "site_lbl": "Asn1102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3V3R4-1", "start_pos": 1102, "end_pos": 1102, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2395", "url": "https://glyconnect.expasy.org/browser/proteins/2395" } ], "protein_name": "Integrin alpha-1", "gene_name": "Itga1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1179, "chemical_mass": 130810.0 } ] }, { "start_pos": "1102", "site_seq": "AHFSSLNLTIRGELQSENSSLTLSSSNR", "site_lbl": "Asn1102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3V3R4-1", "start_pos": 1102, "end_pos": 1102, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2395", "url": "https://glyconnect.expasy.org/browser/proteins/2395" } ], "protein_name": "Integrin alpha-1", "gene_name": "Itga1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1179, "chemical_mass": 130810.0 } ] }, { "start_pos": "284", "site_seq": "N", "site_lbl": "Asn284", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61739-1", "start_pos": 284, "end_pos": 284, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2399", "url": "https://glyconnect.expasy.org/browser/proteins/2399" } ], "protein_name": "Integrin alpha-6", "gene_name": "Itga6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 122159.0 } ] }, { "start_pos": "284", "site_seq": "ANHSGAVVLLK", "site_lbl": "Asn284", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61739-1", "start_pos": 284, "end_pos": 284, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2399", "url": "https://glyconnect.expasy.org/browser/proteins/2399" } ], "protein_name": "Integrin alpha-6", "gene_name": "Itga6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 122159.0 } ] }, { "start_pos": "927", "site_seq": "N", "site_lbl": "Asn927", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61739-1", "start_pos": 927, "end_pos": 927, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2399", "url": "https://glyconnect.expasy.org/browser/proteins/2399" } ], "protein_name": "Integrin alpha-6", "gene_name": "Itga6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 122159.0 } ] }, { "start_pos": "927", "site_seq": "KYQTLNCSVNVR", "site_lbl": "Asn927", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61739-1", "start_pos": 927, "end_pos": 927, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2399", "url": "https://glyconnect.expasy.org/browser/proteins/2399" } ], "protein_name": "Integrin alpha-6", "gene_name": "Itga6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 122159.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61738-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2400", "url": "https://glyconnect.expasy.org/browser/proteins/2400" } ], "protein_name": "Integrin alpha-7", "gene_name": "Itga7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1179, "chemical_mass": 129329.0 } ] }, { "start_pos": "944", "site_seq": "N", "site_lbl": "Asn944", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61738-1", "start_pos": 944, "end_pos": 944, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2400", "url": "https://glyconnect.expasy.org/browser/proteins/2400" } ], "protein_name": "Integrin alpha-7", "gene_name": "Itga7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1179, "chemical_mass": 129329.0 } ] }, { "start_pos": "391", "site_seq": "N", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05555-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2401", "url": "https://glyconnect.expasy.org/browser/proteins/2401" } ], "protein_name": "Integrin alpha-M", "gene_name": "Itgam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1153, "chemical_mass": 127481.0 } ] }, { "start_pos": "391", "site_seq": "DKVTFINTTR", "site_lbl": "Asn391", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05555-1", "start_pos": 391, "end_pos": 391, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2401", "url": "https://glyconnect.expasy.org/browser/proteins/2401" } ], "protein_name": "Integrin alpha-M", "gene_name": "Itgam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1153, "chemical_mass": 127481.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "74", "site_seq": "MFLLVGAPKANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "869", "site_seq": "TPEKNDTAAAGQGER", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "941", "site_seq": "N", "site_lbl": "Asn941", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 941, "end_pos": 941, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "941", "site_seq": "ENQNHSYSLK", "site_lbl": "Asn941", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 941, "end_pos": 941, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "941", "site_seq": "", "site_lbl": "N941", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "2", "chr_pos": "83632336", "evidence": [ { "id": "rs3388564025", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388564025" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 941, "end_pos": 941, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "669", "site_seq": "N", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09055-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2403", "url": "https://glyconnect.expasy.org/browser/proteins/2403" } ], "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 798, "chemical_mass": 88231.0 } ] }, { "start_pos": "669", "site_seq": "KDTCAQECSHFNLTK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09055-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2403", "url": "https://glyconnect.expasy.org/browser/proteins/2403" } ], "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 798, "chemical_mass": 88231.0 } ] }, { "start_pos": "644", "site_seq": "N", "site_lbl": "Asn644", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11835-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2404", "url": "https://glyconnect.expasy.org/browser/proteins/2404" } ], "protein_name": "Integrin beta-2", "gene_name": "Itgb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 771, "chemical_mass": 85026.0 } ] }, { "start_pos": "644", "site_seq": "NCSVQCAGMTLQTIPLKK", "site_lbl": "Asn644", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11835-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2404", "url": "https://glyconnect.expasy.org/browser/proteins/2404" } ], "protein_name": "Integrin beta-2", "gene_name": "Itgb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 771, "chemical_mass": 85026.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0VBD0-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2407", "url": "https://glyconnect.expasy.org/browser/proteins/2407" } ], "protein_name": "Integrin beta-8", "gene_name": "Itgb8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 767, "chemical_mass": 84519.0 } ] }, { "start_pos": "402", "site_seq": "VQLENQVHGVHFNITAICPDGAR", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0VBD0-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2407", "url": "https://glyconnect.expasy.org/browser/proteins/2407" } ], "protein_name": "Integrin beta-8", "gene_name": "Itgb8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 767, "chemical_mass": 84519.0 } ] }, { "start_pos": "456", "site_seq": "N", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0VBD0-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2407", "url": "https://glyconnect.expasy.org/browser/proteins/2407" } ], "protein_name": "Integrin beta-8", "gene_name": "Itgb8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 767, "chemical_mass": 84519.0 } ] }, { "start_pos": "456", "site_seq": "NYAIIKPIGFNETTK", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0VBD0-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2407", "url": "https://glyconnect.expasy.org/browser/proteins/2407" } ], "protein_name": "Integrin beta-8", "gene_name": "Itgb8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 767, "chemical_mass": 84519.0 } ] }, { "start_pos": "508", "site_seq": "N", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJD1-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2408", "url": "https://glyconnect.expasy.org/browser/proteins/2408" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "Itih5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 952, "chemical_mass": 106749.0 } ] }, { "start_pos": "508", "site_seq": "TLFPNYFNGSEIVIAGK", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJD1-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2408", "url": "https://glyconnect.expasy.org/browser/proteins/2408" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "Itih5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 952, "chemical_mass": 106749.0 } ] }, { "start_pos": "213", "site_seq": "N", "site_lbl": "Asn213", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59823-1", "start_pos": 213, "end_pos": 213, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2411", "url": "https://glyconnect.expasy.org/browser/proteins/2411" } ], "protein_name": "Interleukin-1 receptor accessory protein-like 1", "gene_name": "Il1rapl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 695, "chemical_mass": 79630.0 } ] }, { "start_pos": "213", "site_seq": "EVKEDDIGNYTCELK", "site_lbl": "Asn213", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P59823-1", "start_pos": 213, "end_pos": 213, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2411", "url": "https://glyconnect.expasy.org/browser/proteins/2411" } ], "protein_name": "Interleukin-1 receptor accessory protein-like 1", "gene_name": "Il1rapl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 695, "chemical_mass": 79630.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "136", "site_seq": "DDLDPERNESEPGSQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "324", "site_seq": "DAVNNITAK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "92", "site_seq": "DIEKLLSNR", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08532-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2415", "url": "https://glyconnect.expasy.org/browser/proteins/2415" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "Cacna2d1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1103, "chemical_mass": 124630.0 } ] }, { "start_pos": "817", "site_seq": "N", "site_lbl": "Asn817", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8JZZ7-1", "start_pos": 817, "end_pos": 817, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2418", "url": "https://glyconnect.expasy.org/browser/proteins/2418" } ], "protein_name": "Adhesion G protein-coupled receptor L2", "gene_name": "Adgrl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1487, "chemical_mass": 166577.0 } ] }, { "start_pos": "817", "site_seq": "", "site_lbl": "N817", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "3", "chr_pos": "148543274", "evidence": [ { "id": "rs3393587122", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3393587122" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8JZZ7-1", "start_pos": 817, "end_pos": 817, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2418", "url": "https://glyconnect.expasy.org/browser/proteins/2418" } ], "protein_name": "Adhesion G protein-coupled receptor L2", "gene_name": "Adgrl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1487, "chemical_mass": 166577.0 } ] }, { "start_pos": "885", "site_seq": "N", "site_lbl": "Asn885", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TS3-1", "start_pos": 885, "end_pos": 885, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2419", "url": "https://glyconnect.expasy.org/browser/proteins/2419" } ], "protein_name": "Adhesion G protein-coupled receptor L3", "gene_name": "Adgrl3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1537, "chemical_mass": 171080.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TS3-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2419", "url": "https://glyconnect.expasy.org/browser/proteins/2419" } ], "protein_name": "Adhesion G protein-coupled receptor L3", "gene_name": "Adgrl3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1537, "chemical_mass": 171080.0 } ] }, { "start_pos": "434", "site_seq": "N", "site_lbl": "Asn434", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30999-1", "start_pos": 434, "end_pos": 434, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2420", "url": "https://glyconnect.expasy.org/browser/proteins/2420" } ], "protein_name": "Catenin delta-1", "gene_name": "Ctnnd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 938, "chemical_mass": 104925.0 } ] }, { "start_pos": "606", "site_seq": "N", "site_lbl": "Asn606", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62470-1", "start_pos": 606, "end_pos": 606, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2423", "url": "https://glyconnect.expasy.org/browser/proteins/2423" } ], "protein_name": "Integrin alpha-3", "gene_name": "Itga3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1053, "chemical_mass": 116745.0 } ] }, { "start_pos": "606", "site_seq": "SLDAYPVLNQAQAMENHTEVHFQK", "site_lbl": "Asn606", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62470-1", "start_pos": 606, "end_pos": 606, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2423", "url": "https://glyconnect.expasy.org/browser/proteins/2423" } ], "protein_name": "Integrin alpha-3", "gene_name": "Itga3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1053, "chemical_mass": 116745.0 } ] }, { "start_pos": "330", "site_seq": "LISNATR", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA0-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2424", "url": "https://glyconnect.expasy.org/browser/proteins/2424" } ], "protein_name": "Leucine-rich repeat and fibronectin type-III domain-containing protein 5", "gene_name": "Lrfn5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 719, "chemical_mass": 79371.0 } ] }, { "start_pos": "330", "site_seq": "N", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BXA0-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2424", "url": "https://glyconnect.expasy.org/browser/proteins/2424" } ], "protein_name": "Leucine-rich repeat and fibronectin type-III domain-containing protein 5", "gene_name": "Lrfn5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 719, "chemical_mass": 79371.0 } ] } ], "record_id": "G39188ZX" }