{ "glytoucan_ac": "G36191CD", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "GlyCosmos", "id": "G36191CD", "url": "https://glycosmos.org/glycans/show/G36191CD" }, { "database": "PubMed", "id": "1691598", "url": "https://glygen.org/publication/PubMed/1691598" }, { "database": "PubMed", "id": "1990011", "url": "https://glygen.org/publication/PubMed/1990011" }, { "database": "PubMed", "id": "2138613", "url": "https://glygen.org/publication/PubMed/2138613" }, { "database": "PubMed", "id": "7513972", "url": "https://glygen.org/publication/PubMed/7513972" }, { "database": "PubMed", "id": "7540902", "url": "https://glygen.org/publication/PubMed/7540902" }, { "database": "PubMed", "id": "7682847", "url": "https://glygen.org/publication/PubMed/7682847" }, { "database": "PubMed", "id": "7690196", "url": "https://glygen.org/publication/PubMed/7690196" }, { "database": "PubMed", "id": "8299354", "url": "https://glygen.org/publication/PubMed/8299354" }, { "database": "GlyGen", "id": "GLY_001497", "url": "https://data.glygen.org/GLY_001497" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "PubMed", "id": "1841682", "url": "https://glygen.org/publication/PubMed/1841682" }, { "database": "PubMed", "id": "33737529", "url": "https://glygen.org/publication/PubMed/33737529" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1016/0009-8981(90)90201-3", "url": "https://glygen.org/publication/DOI/10.1016/0009-8981(90)90201-3" }, { "database": "DOI", "id": "10.1016/s0065-2318(08)60059-1", "url": "https://glygen.org/publication/DOI/10.1016/s0065-2318(08)60059-1" }, { "database": "DOI", "id": "10.1021/bi00617a021", "url": "https://glygen.org/publication/DOI/10.1021/bi00617a021" }, { "database": "DOI", "id": "10.1111/j.1432-1033.1981.tb06300.x", "url": "https://glygen.org/publication/DOI/10.1111/j.1432-1033.1981.tb06300.x" }, { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "GlyCosmos", "id": "G36191CD", "url": "https://glycosmos.org/glycans/show/G36191CD" }, { "database": "GlyGen", "id": "GLY_001412", "url": "https://data.glygen.org/GLY_001412" }, { "database": "PubMed", "id": "10024660", "url": "https://glygen.org/publication/PubMed/10024660" }, { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" }, { "database": "PubMed", "id": "10211705", "url": "https://glygen.org/publication/PubMed/10211705" }, { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "PubMed", "id": "10764830", "url": "https://glygen.org/publication/PubMed/10764830" }, { "database": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" }, { "database": "PubMed", "id": "10821673", "url": "https://glygen.org/publication/PubMed/10821673" }, { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "PubMed", "id": "10918037", "url": "https://glygen.org/publication/PubMed/10918037" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "11180632", "url": "https://glygen.org/publication/PubMed/11180632" }, { "database": "PubMed", "id": "11500028", "url": "https://glygen.org/publication/PubMed/11500028" }, { "database": "PubMed", "id": "11676606", "url": "https://glygen.org/publication/PubMed/11676606" }, { "database": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" }, { "database": "PubMed", "id": "12021773", "url": "https://glygen.org/publication/PubMed/12021773" }, { "database": "PubMed", "id": "12652077", "url": "https://glygen.org/publication/PubMed/12652077" }, { "database": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" }, { "database": "PubMed", "id": "1375510", "url": "https://glygen.org/publication/PubMed/1375510" }, { "database": "PubMed", "id": "14520616", "url": "https://glygen.org/publication/PubMed/14520616" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" }, { "database": "PubMed", "id": "14693913", "url": "https://glygen.org/publication/PubMed/14693913" }, { "database": "PubMed", "id": "15079052", "url": "https://glygen.org/publication/PubMed/15079052" }, { "database": "PubMed", "id": "15316280", "url": "https://glygen.org/publication/PubMed/15316280" }, { "database": "PubMed", "id": "1555586", "url": "https://glygen.org/publication/PubMed/1555586" }, { "database": "PubMed", "id": "15589826", "url": "https://glygen.org/publication/PubMed/15589826" }, { "database": "PubMed", "id": "1577715", "url": "https://glygen.org/publication/PubMed/1577715" }, { "database": "PubMed", "id": "1637829", "url": "https://glygen.org/publication/PubMed/1637829" }, { "database": "PubMed", "id": "1694115", "url": "https://glygen.org/publication/PubMed/1694115" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "PubMed", "id": "1899031", "url": "https://glygen.org/publication/PubMed/1899031" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" }, { "database": "PubMed", "id": "1967025", "url": "https://glygen.org/publication/PubMed/1967025" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" }, { "database": "PubMed", "id": "20578731", "url": "https://glygen.org/publication/PubMed/20578731" }, { "database": "PubMed", "id": "2059624", "url": "https://glygen.org/publication/PubMed/2059624" }, { "database": "PubMed", "id": "2065054", "url": "https://glygen.org/publication/PubMed/2065054" }, { "database": "PubMed", "id": "2110822", "url": "https://glygen.org/publication/PubMed/2110822" }, { "database": "PubMed", "id": "2138613", "url": "https://glygen.org/publication/PubMed/2138613" }, { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "PubMed", "id": "2297756", "url": "https://glygen.org/publication/PubMed/2297756" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "PubMed", "id": "2386787", "url": "https://glygen.org/publication/PubMed/2386787" }, { "database": "PubMed", "id": "2387072", "url": "https://glygen.org/publication/PubMed/2387072" }, { "database": "PubMed", "id": "23999306", "url": "https://glygen.org/publication/PubMed/23999306" }, { "database": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" }, { "database": "PubMed", "id": "26673890", "url": "https://glygen.org/publication/PubMed/26673890" }, { "database": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" }, { "database": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" }, { "database": "PubMed", "id": "2839526", "url": "https://glygen.org/publication/PubMed/2839526" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "29853186", "url": "https://glygen.org/publication/PubMed/29853186" }, { "database": "PubMed", "id": "31747749", "url": "https://glygen.org/publication/PubMed/31747749" }, { "database": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" }, { "database": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" }, { "database": "PubMed", "id": "33383989", "url": "https://glygen.org/publication/PubMed/33383989" }, { "database": "PubMed", "id": "3346214", "url": "https://glygen.org/publication/PubMed/3346214" }, { "database": "PubMed", "id": "34265844", "url": "https://glygen.org/publication/PubMed/34265844" }, { "database": "PubMed", "id": "35273390", "url": "https://glygen.org/publication/PubMed/35273390" }, { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" }, { "database": "PubMed", "id": "37031240", "url": "https://glygen.org/publication/PubMed/37031240" }, { "database": "PubMed", "id": "3718924", "url": "https://glygen.org/publication/PubMed/3718924" }, { "database": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" }, { "database": "PubMed", "id": "518919", "url": "https://glygen.org/publication/PubMed/518919" }, { "database": "PubMed", "id": "6192908", "url": "https://glygen.org/publication/PubMed/6192908" }, { "database": "PubMed", "id": "6643471", "url": "https://glygen.org/publication/PubMed/6643471" }, { "database": "PubMed", "id": "6950933", "url": "https://glygen.org/publication/PubMed/6950933" }, { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" }, { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "PubMed", "id": "728395", "url": "https://glygen.org/publication/PubMed/728395" }, { "database": "PubMed", "id": "7380009", "url": "https://glygen.org/publication/PubMed/7380009" }, { "database": "PubMed", "id": "7462199", "url": "https://glygen.org/publication/PubMed/7462199" }, { "database": "PubMed", "id": "7509658", "url": "https://glygen.org/publication/PubMed/7509658" }, { "database": "PubMed", "id": "7511099", "url": "https://glygen.org/publication/PubMed/7511099" }, { "database": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" }, { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "PubMed", "id": "7655165", "url": "https://glygen.org/publication/PubMed/7655165" }, { "database": "PubMed", "id": "7679920", "url": "https://glygen.org/publication/PubMed/7679920" }, { "database": "PubMed", "id": "7686446", "url": "https://glygen.org/publication/PubMed/7686446" }, { "database": "PubMed", "id": "7785764", "url": "https://glygen.org/publication/PubMed/7785764" }, { "database": "PubMed", "id": "7841792", "url": "https://glygen.org/publication/PubMed/7841792" }, { "database": "PubMed", "id": "7867791", "url": "https://glygen.org/publication/PubMed/7867791" }, { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "8202534", "url": "https://glygen.org/publication/PubMed/8202534" }, { "database": "PubMed", "id": "8206305", "url": "https://glygen.org/publication/PubMed/8206305" }, { "database": "PubMed", "id": "8224606", "url": "https://glygen.org/publication/PubMed/8224606" }, { "database": "PubMed", "id": "8251489", "url": "https://glygen.org/publication/PubMed/8251489" }, { "database": "PubMed", "id": "8344278", "url": "https://glygen.org/publication/PubMed/8344278" }, { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" }, { "database": "PubMed", "id": "8404898", "url": "https://glygen.org/publication/PubMed/8404898" }, { "database": "PubMed", "id": "8404899", "url": "https://glygen.org/publication/PubMed/8404899" }, { "database": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" }, { "database": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" }, { "database": "PubMed", "id": "8620897", "url": "https://glygen.org/publication/PubMed/8620897" }, { "database": "PubMed", "id": "8943402", "url": "https://glygen.org/publication/PubMed/8943402" }, { "database": "PubMed", "id": "8981093", "url": "https://glygen.org/publication/PubMed/8981093" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "9555945", "url": "https://glygen.org/publication/PubMed/9555945" }, { "database": "PubMed", "id": "9666724", "url": "https://glygen.org/publication/PubMed/9666724" }, { "database": "GlyGen", "id": "GLY_001408", "url": "https://data.glygen.org/GLY_001408" }, { "database": "GlyGen", "id": "GLY_001461", "url": "https://data.glygen.org/GLY_001461" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "PubMed", "id": "10406848", "url": "https://glygen.org/publication/PubMed/10406848" }, { "database": "PubMed", "id": "10704521", "url": "https://glygen.org/publication/PubMed/10704521" }, { "database": "PubMed", "id": "1922104", "url": "https://glygen.org/publication/PubMed/1922104" }, { "database": "PubMed", "id": "8507175", "url": "https://glygen.org/publication/PubMed/8507175" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "PubMed", "id": "10782293", "url": "https://glygen.org/publication/PubMed/10782293" }, { "database": "PubMed", "id": "8274017", "url": "https://glygen.org/publication/PubMed/8274017" }, { "database": "PubMed", "id": "8299354", "url": "https://glygen.org/publication/PubMed/8299354" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "3233", "url": "https://glyconnect.expasy.org/browser/structures/3233" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" }, { "database": "PubMed", "id": "33242084", "url": "https://glygen.org/publication/PubMed/33242084" }, { "database": "PubMed", "id": "7263664", "url": "https://glygen.org/publication/PubMed/7263664" }, { "database": "PubMed", "id": "8299354", "url": "https://glygen.org/publication/PubMed/8299354" }, { "database": "PubMed", "id": "8612632", "url": "https://glygen.org/publication/PubMed/8612632" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 10114, "name": "Rattus", "annotation_category": "direct", "evidence": [ { "database": "GlyCosmos", "id": "G36191CD", "url": "https://glycosmos.org/glycans/show/G36191CD" } ], "common_name": "Rattus", "glygen_name": "Rattus", "reference_species": "Rattus [10114]" } ], "mass": 1640.59, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 4, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [ { "id": "GGM.000001", "name": "Type 2 LN", "synonym": "N-acetyllactosamine", "keywords": "LacNAc; N-acetyllactosamine; N-acetyllactosamine type 2" } ], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02771-1", "start_pos": 251, "end_pos": 251, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7679920", "url": "https://glygen.org/publication/PubMed/7679920" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1694115", "url": "https://glygen.org/publication/PubMed/1694115" }, { "database": "PubMed", "id": "6192908", "url": "https://glygen.org/publication/PubMed/6192908" }, { "database": "PubMed", "id": "7686446", "url": "https://glygen.org/publication/PubMed/7686446" }, { "database": "PubMed", "id": "7511099", "url": "https://glygen.org/publication/PubMed/7511099" }, { "database": "GlyConnect", "id": "41", "url": "https://glyconnect.expasy.org/browser/proteins/41" } ], "protein_name": "Alpha-fetoprotein", "gene_name": "AFP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 609, "chemical_mass": 68678.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19835-1", "start_pos": 207, "end_pos": 207, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8404899", "url": "https://glygen.org/publication/PubMed/8404899" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "14693913", "url": "https://glygen.org/publication/PubMed/14693913" }, { "database": "PubMed", "id": "10024660", "url": "https://glygen.org/publication/PubMed/10024660" }, { "database": "GlyConnect", "id": "74", "url": "https://glyconnect.expasy.org/browser/proteins/74" } ], "protein_name": "Bile salt-activated lipase", "gene_name": "CEL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 753, "chemical_mass": 79322.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01588-1", "start_pos": 110, "end_pos": 110, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" }, { "database": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" }, { "database": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" }, { "database": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" }, { "database": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" }, { "database": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" } ], "protein_name": "Erythropoietin", "gene_name": "EPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21307.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01588-1", "start_pos": 51, "end_pos": 51, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" }, { "database": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" }, { "database": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" }, { "database": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" }, { "database": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" }, { "database": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" } ], "protein_name": "Erythropoietin", "gene_name": "EPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21307.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01588-1", "start_pos": 65, "end_pos": 65, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" }, { "database": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" }, { "database": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" }, { "database": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" }, { "database": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" }, { "database": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" } ], "protein_name": "Erythropoietin", "gene_name": "EPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21307.0 } ] }, { "start_pos": "65", "site_seq": "", "site_lbl": "N65", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT); n-glyco-sequon-gain (NEN->NES).", "chr_id": "7", "chr_pos": "100721996", "evidence": [ { "id": "rs1806747968", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1806747968" }, { "id": "rs1806747968", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1806747968#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT); n-glyco-sequon-gain (NEN->NET).", "chr_id": "7", "chr_pos": "100721996", "evidence": [ { "id": "rs1806747968", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1806747968" }, { "id": "rs1806747968", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1806747968#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01588-1", "start_pos": 65, "end_pos": 65, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" }, { "database": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" }, { "database": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" }, { "database": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" }, { "database": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" }, { "database": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" } ], "protein_name": "Erythropoietin", "gene_name": "EPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21307.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DN86-1", "start_pos": 33, "end_pos": 33, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" }, { "database": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" } ], "protein_name": "Choriogonadotropin subunit beta 3", "gene_name": "CGB3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 165, "chemical_mass": 17739.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DN86-1", "start_pos": 50, "end_pos": 50, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" } ], "protein_name": "Choriogonadotropin subunit beta 3", "gene_name": "CGB3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 165, "chemical_mass": 17739.0 } ] }, { "start_pos": "33", "site_seq": "", "site_lbl": "N33", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "49044658", "evidence": [ { "id": "rs1433511248", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1433511248" }, { "id": "rs1433511248", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1433511248#frequency_tab" }, { "id": "rs1433511248", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1433511248" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "49048290", "evidence": [ { "id": "rs1298558119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1298558119" }, { "id": "rs1298558119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1298558119#frequency_tab" }, { "id": "rs1298558119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1298558119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "49048290", "evidence": [ { "id": "rs1298558119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1298558119" }, { "id": "rs1298558119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1298558119#frequency_tab" }, { "id": "rs1298558119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1298558119" }, { "id": "rs1326860146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326860146" }, { "id": "rs1326860146", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1326860146" }, { "id": "rs2039919609", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2039919609" }, { "id": "rs2039919609", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2039919609#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DN86-1", "start_pos": 33, "end_pos": 33, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" }, { "database": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" } ], "protein_name": "Choriogonadotropin subunit beta 3", "gene_name": "CGB3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 165, "chemical_mass": 17739.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "19", "chr_pos": "49044710", "evidence": [ { "id": "rs1292238096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1292238096" }, { "id": "rs1292238096", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1292238096" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "19", "chr_pos": "49023470", "evidence": [ { "id": "rs2039639878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2039639878" }, { "id": "rs2039639878", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2039639878" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DN86-1", "start_pos": 50, "end_pos": 50, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" } ], "protein_name": "Choriogonadotropin subunit beta 3", "gene_name": "CGB3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 165, "chemical_mass": 17739.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "MAAALNATGR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "201", "site_seq": "VnYSLLADICNLWR", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 201, "end_pos": 201, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "201", "site_seq": "N", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 201, "end_pos": 201, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "359", "site_seq": "N", "site_lbl": "Asn359", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 359, "end_pos": 359, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "359", "site_seq": "YHSSLGQLNFTGSVIYEAQDVYSGDIISGLR", "site_lbl": "Asn359", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 359, "end_pos": 359, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "385", "site_seq": "N", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 385, "end_pos": 385, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42067244", "evidence": [ { "id": "rs374661289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374661289#frequency_tab" }, { "id": "rs374661289", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374661289" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42066778", "evidence": [ { "id": "rs749495971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749495971" }, { "id": "rs749495971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749495971#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 177, "end_pos": 177, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "201", "site_seq": "", "site_lbl": "N201", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42065895", "evidence": [ { "id": "rs1374713161", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374713161" }, { "id": "rs1374713161", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374713161#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 201, "end_pos": 201, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "385", "site_seq": "", "site_lbl": "N385", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42060361", "evidence": [ { "id": "rs1315873565", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1315873565" }, { "id": "rs1315873565", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1315873565#frequency_tab" }, { "id": "rs1315873565", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1315873565" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 385, "end_pos": 385, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "201", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation site; no effect on enzyme activity and stability.", "evidence": [ { "database": "UniProtKB", "id": "P17050", "url": "https://www.uniprot.org/uniprotkb/P17050" }, { "database": "PubMed", "id": "19683538", "url": "https://glygen.org/publication/PubMed/19683538" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 201, "end_pos": 201, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10704524", "url": "https://glygen.org/publication/PubMed/10704524" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "308", "site_seq": "N", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00747-1", "start_pos": 308, "end_pos": 308, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2059624", "url": "https://glygen.org/publication/PubMed/2059624" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1899031", "url": "https://glygen.org/publication/PubMed/1899031" }, { "database": "PubMed", "id": "2065054", "url": "https://glygen.org/publication/PubMed/2065054" }, { "database": "PubMed", "id": "2386787", "url": "https://glygen.org/publication/PubMed/2386787" }, { "database": "GlyConnect", "id": "502", "url": "https://glyconnect.expasy.org/browser/proteins/502" } ], "protein_name": "Plasminogen", "gene_name": "PLG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 810, "chemical_mass": 90569.0 } ] }, { "start_pos": "308", "site_seq": "", "site_lbl": "N308", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->IRT).", "chr_id": "6", "chr_pos": "160718429", "evidence": [ { "id": "rs1228855762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1228855762" }, { "id": "rs1228855762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1228855762#frequency_tab" }, { "id": "rs1228855762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1228855762" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "6", "chr_pos": "160718429", "evidence": [ { "id": "rs1228855762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1228855762" }, { "id": "rs1228855762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1228855762#frequency_tab" }, { "id": "rs1228855762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1228855762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00747-1", "start_pos": 308, "end_pos": 308, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2059624", "url": "https://glygen.org/publication/PubMed/2059624" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1899031", "url": "https://glygen.org/publication/PubMed/1899031" }, { "database": "PubMed", "id": "2065054", "url": "https://glygen.org/publication/PubMed/2065054" }, { "database": "PubMed", "id": "2386787", "url": "https://glygen.org/publication/PubMed/2386787" }, { "database": "GlyConnect", "id": "502", "url": "https://glyconnect.expasy.org/browser/proteins/502" } ], "protein_name": "Plasminogen", "gene_name": "PLG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 810, "chemical_mass": 90569.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "108268", "url": "https://glygen.org/publication/PubMed/108268" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 107, "end_pos": 107, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "6966283", "url": "https://glygen.org/publication/PubMed/6966283" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8390218", "url": "https://glygen.org/publication/PubMed/8390218" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "51", "site_seq": "ESVTDHVNLITPLEKPLQnFTLCFR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02743-1", "start_pos": 51, "end_pos": 51, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8202534", "url": "https://glygen.org/publication/PubMed/8202534" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "560", "url": "https://glyconnect.expasy.org/browser/proteins/560" } ], "protein_name": "Serum amyloid P-component", "gene_name": "APCS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25387.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02743-1", "start_pos": 51, "end_pos": 51, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8202534", "url": "https://glygen.org/publication/PubMed/8202534" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "560", "url": "https://glyconnect.expasy.org/browser/proteins/560" } ], "protein_name": "Serum amyloid P-component", "gene_name": "APCS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25387.0 } ] }, { "start_pos": "51", "site_seq": "", "site_lbl": "N51", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "1", "chr_pos": "159588187", "evidence": [ { "id": "rs1658804384", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1658804384" }, { "id": "rs1658804384", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1658804384" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "1", "chr_pos": "159588189", "evidence": [ { "id": "rs200370168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200370168" }, { "id": "rs200370168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200370168#frequency_tab" }, { "id": "rs200370168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200370168" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02743-1", "start_pos": 51, "end_pos": 51, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "8202534", "url": "https://glygen.org/publication/PubMed/8202534" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "560", "url": "https://glyconnect.expasy.org/browser/proteins/560" } ], "protein_name": "Serum amyloid P-component", "gene_name": "APCS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 223, "chemical_mass": 25387.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "105643755", "evidence": [ { "id": "rs1172977375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172977375" }, { "id": "rs1172977375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172977375" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "105643753", "evidence": [ { "id": "rs1411068751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411068751" }, { "id": "rs1411068751", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411068751#frequency_tab" }, { "id": "rs1411068751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411068751" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105643754", "evidence": [ { "id": "rs2087481484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087481484" }, { "id": "rs2087481484", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2087481484" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "21609021", "url": "https://glygen.org/publication/PubMed/21609021" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29965-1", "start_pos": 240, "end_pos": 240, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "11676606", "url": "https://glygen.org/publication/PubMed/11676606" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "CD40 ligand", "gene_name": "CD40LG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 29274.0 } ] }, { "start_pos": "240", "site_seq": "", "site_lbl": "N240", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->nullVT).", "chr_id": "X", "chr_pos": "136659348_136659349", "evidence": [ { "id": "rs786205607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs786205607" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P29965-1", "start_pos": 240, "end_pos": 240, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "11676606", "url": "https://glygen.org/publication/PubMed/11676606" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "CD40 ligand", "gene_name": "CD40LG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 29274.0 } ] }, { "start_pos": "102", "site_seq": "N", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 102, "end_pos": 102, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "RCSB PDB", "id": "1HD4", "url": "https://www.rcsb.org/structure/1HD4" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "102", "site_seq": "VENHTACHCSTCYYHK", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 102, "end_pos": 102, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" }, { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "RCSB PDB", "id": "1HD4", "url": "https://www.rcsb.org/structure/1HD4" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "N", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "NVTSESTCCVAK", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "NVTSESTCCVAK", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "", "site_lbl": "N76", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "6", "chr_pos": "87086296", "evidence": [ { "id": "rs373317335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373317335" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "76", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Increases from 1 to 3 the number of FSH binding a single FSHR receptor.", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprotkb/P01215" }, { "database": "PubMed", "id": "24692546", "url": "https://glygen.org/publication/PubMed/24692546" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01215-1", "start_pos": 76, "end_pos": 76, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ], "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 116, "chemical_mass": 13075.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7107587", "url": "https://glygen.org/publication/PubMed/7107587" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" }, { "database": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" }, { "database": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 221, "end_pos": 221, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "221", "site_seq": "SVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPER", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 221, "end_pos": 221, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "231", "site_seq": "GDNnLTR", "site_lbl": "Asn231", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 231, "end_pos": 231, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "231", "site_seq": "N", "site_lbl": "Asn231", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 231, "end_pos": 231, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "13", "chr_pos": "113144010", "evidence": [ { "id": "P00742", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00742" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 221, "end_pos": 221, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "231", "site_seq": "", "site_lbl": "N231", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "13", "chr_pos": "113144041", "evidence": [ { "id": "rs1415612218", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415612218" }, { "id": "rs1415612218", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415612218" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00742-1", "start_pos": 231, "end_pos": 231, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7620335", "url": "https://glygen.org/publication/PubMed/7620335" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "102", "url": "https://glyconnect.expasy.org/browser/proteins/102" } ], "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 488, "chemical_mass": 54732.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01730-1", "start_pos": 296, "end_pos": 296, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "database": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" } ], "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 458, "chemical_mass": 51111.0 } ] }, { "start_pos": "325", "site_seq": "nLTCEVWGPTSPK", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01730-1", "start_pos": 325, "end_pos": 325, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "database": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" } ], "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 458, "chemical_mass": 51111.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01730-1", "start_pos": 325, "end_pos": 325, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "database": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" } ], "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 458, "chemical_mass": 51111.0 } ] }, { "start_pos": "296", "site_seq": "", "site_lbl": "N296", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "12", "chr_pos": "6816334", "evidence": [ { "id": "rs1555117941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555117941" }, { "id": "rs1555117941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555117941" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01730-1", "start_pos": 296, "end_pos": 296, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "database": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" } ], "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 458, "chemical_mass": 51111.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12763-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1691598", "url": "https://glygen.org/publication/PubMed/1691598" }, { "database": "GlyConnect", "id": "22", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "database": "PubMed", "id": "7690196", "url": "https://glygen.org/publication/PubMed/7690196" }, { "database": "PubMed", "id": "7513972", "url": "https://glygen.org/publication/PubMed/7513972" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 359, "chemical_mass": 38419.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12763-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1691598", "url": "https://glygen.org/publication/PubMed/1691598" }, { "database": "GlyConnect", "id": "22", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "database": "PubMed", "id": "7690196", "url": "https://glygen.org/publication/PubMed/7690196" }, { "database": "PubMed", "id": "7513972", "url": "https://glygen.org/publication/PubMed/7513972" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 359, "chemical_mass": 38419.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01861-2", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 43832.0 } ] }, { "start_pos": "177", "site_seq": "EEQFNSTYR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01861-2", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 43832.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "14", "chr_pos": "105625028", "evidence": [ { "id": "rs2086714046", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2086714046" }, { "id": "rs2086714046", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2086714046#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "105625026", "evidence": [ { "id": "P01861", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01861" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01861-2", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 43832.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15907-1", "start_pos": 149, "end_pos": 149, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "4JS1", "url": "https://www.rcsb.org/structure/4JS1" } ], "protein_name": "Beta-galactoside alpha-2,6-sialyltransferase 1", "gene_name": "ST6GAL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46605.0 } ] }, { "start_pos": "149", "site_seq": "", "site_lbl": "N149", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "187043148", "evidence": [ { "id": "rs1366467487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1366467487" }, { "id": "rs1366467487", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1366467487" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15907-1", "start_pos": 149, "end_pos": 149, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "4JS1", "url": "https://www.rcsb.org/structure/4JS1" } ], "protein_name": "Beta-galactoside alpha-2,6-sialyltransferase 1", "gene_name": "ST6GAL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46605.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "7PFP", "url": "https://www.rcsb.org/structure/7PFP" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "7PFP", "url": "https://www.rcsb.org/structure/7PFP" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "7PFP", "url": "https://www.rcsb.org/structure/7PFP" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "4737", "site_seq": "N", "site_lbl": "Asn4737", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02817-1", "start_pos": 4737, "end_pos": 4737, "residue": "ASN", "evidence": [ { "database": "RCSB PDB", "id": "7QCL", "url": "https://www.rcsb.org/structure/7QCL" } ], "protein_name": "Mucin-2", "gene_name": "MUC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5289, "chemical_mass": 550850.0 } ] } ], "record_id": "G36191CD" }