{ "glytoucan_ac": "G33609NS", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "PubMed", "id": "447724", "url": "https://glygen.org/publication/PubMed/447724" }, { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "GlyConnect", "id": "2261", "url": "https://glyconnect.expasy.org/browser/structures/2261" }, { "database": "PubMed", "id": "10833030", "url": "https://glygen.org/publication/PubMed/10833030" }, { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "PubMed", "id": "33737529", "url": "https://glygen.org/publication/PubMed/33737529" }, { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 7227, "name": "Drosophila melanogaster", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "17264077", "url": "https://glygen.org/publication/PubMed/17264077" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" }, { "taxid": 10029, "name": "Cricetulus griseus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G20146LZ", "url": "https://www.glygen.org/glycan/G20146LZ" }, { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" }, { "database": "Subsumption", "id": "G76504TU", "url": "https://www.glygen.org/glycan/G76504TU" } ], "common_name": "Chinese hamster", "glygen_name": "Hamster", "reference_species": "Cricetulus griseus [10029]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" }, { "database": "Subsumption", "id": "G77285LE", "url": "https://www.glygen.org/glycan/G77285LE" }, { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "11469797", "url": "https://glygen.org/publication/PubMed/11469797" }, { "database": "PubMed", "id": "11588155", "url": "https://glygen.org/publication/PubMed/11588155" }, { "database": "PubMed", "id": "1555586", "url": "https://glygen.org/publication/PubMed/1555586" }, { "database": "PubMed", "id": "15557177", "url": "https://glygen.org/publication/PubMed/15557177" }, { "database": "PubMed", "id": "15955802", "url": "https://glygen.org/publication/PubMed/15955802" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "PubMed", "id": "25374123", "url": "https://glygen.org/publication/PubMed/25374123" }, { "database": "PubMed", "id": "25685702", "url": "https://glygen.org/publication/PubMed/25685702" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "25824821", "url": "https://glygen.org/publication/PubMed/25824821" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29792883", "url": "https://glygen.org/publication/PubMed/29792883" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "32639750", "url": "https://glygen.org/publication/PubMed/32639750" }, { "database": "PubMed", "id": "32643525", "url": "https://glygen.org/publication/PubMed/32643525" }, { "database": "PubMed", "id": "33135055", "url": "https://glygen.org/publication/PubMed/33135055" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" }, { "database": "PubMed", "id": "39988192", "url": "https://glygen.org/publication/PubMed/39988192" }, { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "PubMed", "id": "7881178", "url": "https://glygen.org/publication/PubMed/7881178" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" }, { "database": "GlyGen", "id": "GLY_001408", "url": "https://data.glygen.org/GLY_001408" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" }, { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 7955, "name": "Danio rerio", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G38297TU", "url": "https://www.glygen.org/glycan/G38297TU" }, { "database": "Subsumption", "id": "G17461UE", "url": "https://www.glygen.org/glycan/G17461UE" }, { "database": "Subsumption", "id": "G35938WG", "url": "https://www.glygen.org/glycan/G35938WG" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G77285LE", "url": "https://www.glygen.org/glycan/G77285LE" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" }, { "database": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" }, { "database": "PubMed", "id": "8612632", "url": "https://glygen.org/publication/PubMed/8612632" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "506", "url": "https://glyconnect.expasy.org/browser/compositions/506" }, { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 1437.51, "classification": [ { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Lacto series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Neo-lacto series" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Monoantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Truncated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "N144", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "", "site_lbl": "N144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "105708020", "evidence": [ { "id": "P01876", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01876" }, { "id": "rs745327941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745327941#frequency_tab" }, { "id": "rs745327941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745327941" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "14", "chr_pos": "105708021", "evidence": [ { "id": "rs1296586332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1296586332" }, { "id": "rs1296586332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1296586332" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "230", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "495", "site_seq": "N", "site_lbl": "Asn495", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 495, "end_pos": 495, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01012-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "GlyConnect", "id": "475", "url": "https://glyconnect.expasy.org/browser/proteins/475" } ], "protein_name": "Ovalbumin", "gene_name": "SERPINB14", "tax_id": 9031, "tax_name": "Gallus gallus", "tax_common_name": "Chicken", "length": 386, "chemical_mass": 42881.0 } ] }, { "start_pos": "220", "site_seq": "ATDVLnK", "site_lbl": "Asn220", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26022-1", "start_pos": 220, "end_pos": 220, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "704", "url": "https://glyconnect.expasy.org/browser/proteins/704" } ], "protein_name": "Pentraxin-related protein PTX3", "gene_name": "PTX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 41976.0 } ] }, { "start_pos": "220", "site_seq": "N", "site_lbl": "Asn220", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26022-1", "start_pos": 220, "end_pos": 220, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "704", "url": "https://glyconnect.expasy.org/browser/proteins/704" } ], "protein_name": "Pentraxin-related protein PTX3", "gene_name": "PTX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 41976.0 } ] }, { "start_pos": "220", "site_seq": "ATDVLNK", "site_lbl": "Asn220", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26022-1", "start_pos": 220, "end_pos": 220, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "704", "url": "https://glyconnect.expasy.org/browser/proteins/704" } ], "protein_name": "Pentraxin-related protein PTX3", "gene_name": "PTX3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 41976.0 } ] }, { "start_pos": "474", "site_seq": "N", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "771", "url": "https://glyconnect.expasy.org/browser/proteins/771" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "474", "site_seq": "", "site_lbl": "N474", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->DHS).", "chr_id": "13", "chr_pos": "28427175", "evidence": [ { "id": "rs2137538179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2137538179" }, { "id": "rs2137538179", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2137538179" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "13", "chr_pos": "28427173", "evidence": [ { "id": "rs200003810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200003810" }, { "id": "rs200003810", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200003810" }, { "id": "rs200003810", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200003810" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "771", "url": "https://glyconnect.expasy.org/browser/proteins/771" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25374123", "url": "https://glygen.org/publication/PubMed/25374123" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25374123", "url": "https://glygen.org/publication/PubMed/25374123" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25374123", "url": "https://glygen.org/publication/PubMed/25374123" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "804", "site_seq": "nVTAQICIDK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "N", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "NVTAQICIDKK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "", "site_lbl": "N804", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "21", "chr_pos": "46002687", "evidence": [ { "id": "rs750677189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750677189#frequency_tab" }, { "id": "rs750677189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750677189" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "MLEAYnLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "N", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "IEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "", "site_lbl": "N1763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "6", "chr_pos": "75137543", "evidence": [ { "id": "rs755536829", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755536829#frequency_tab" }, { "id": "rs755536829", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755536829" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "", "site_lbl": "N2528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "6", "chr_pos": "75115897", "evidence": [ { "id": "rs2149361441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2149361441" }, { "id": "rs2149361441", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2149361441" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "6", "chr_pos": "75115898", "evidence": [ { "id": "rs1168175119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168175119" }, { "id": "rs1168175119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168175119#frequency_tab" }, { "id": "rs1168175119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1168175119" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "140", "site_seq": "GTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALANMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1137", "url": "https://glyconnect.expasy.org/browser/proteins/1137" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "276", "site_seq": "N", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "N1067", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "P35555", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35555" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "15", "chr_pos": "48488375", "evidence": [ { "id": "rs1358163754", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358163754" }, { "id": "rs1358163754", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358163754" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "rs765043727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" }, { "id": "rs765043727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "", "site_lbl": "N1112", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "P35556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35556" }, { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0111595", "name": "congenital contractural arachnodactyly", "description": "A distal arthrogryposis characterized by contractures, arachnodactyly, scoliosis, and crumpled ears that has_material_basis_in heterozygous mutation in the FBN2 gene on chromosome 5q23.3.", "url": "http://disease-ontology.org/term/DOID:0111595", "evidence": [ { "id": "121050", "database": "MIM", "url": "https://www.omim.org/entry/121050" }, { "id": "0111595", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111595" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" }, { "id": "rs1301097230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301097230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "", "site_lbl": "N1025", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "19", "chr_pos": "8123473", "evidence": [ { "id": "rs1725454320", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1725454320" }, { "id": "rs1725454320", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1725454320" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "19", "chr_pos": "8123471", "evidence": [ { "id": "rs2082902690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2082902690" }, { "id": "rs2082902690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2082902690#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "19", "chr_pos": "8123472", "evidence": [ { "id": "rs765206008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765206008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1281", "url": "https://glyconnect.expasy.org/browser/proteins/1281" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "AVLVNnITTGER", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1281", "url": "https://glyconnect.expasy.org/browser/proteins/1281" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "AVLVNNITTGER", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1281", "url": "https://glyconnect.expasy.org/browser/proteins/1281" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "9", "chr_pos": "86052575", "evidence": [ { "id": "rs1833790584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1833790584" }, { "id": "rs1833790584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1833790584#frequency_tab" }, { "id": "rs1833790584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1833790584" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1281", "url": "https://glyconnect.expasy.org/browser/proteins/1281" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "900", "site_seq": "AnVTSENNMPR", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "N", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "ANVTSENNMPR", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "", "site_lbl": "N900", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "16", "chr_pos": "31326927", "evidence": [ { "id": "rs553934657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs553934657" }, { "id": "rs553934657", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs553934657" }, { "id": "rs553934657", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs553934657" }, { "id": "rs553934657", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs553934657#frequency_tab" }, { "id": "rs553934657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs553934657" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "16", "chr_pos": "31326926", "evidence": [ { "id": "rs755367569", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755367569" }, { "id": "rs755367569", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755367569" }, { "id": "rs755367569", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755367569#frequency_tab" }, { "id": "rs755367569", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755367569" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "186602056", "evidence": [ { "id": "rs1686923072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686923072" }, { "id": "rs1686923072", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1686923072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "2007", "site_seq": "ITLHEnR", "site_lbl": "Asn2007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2007", "site_seq": "N", "site_lbl": "Asn2007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "ITVHGnGSLDIR", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "N", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2007", "site_seq": "", "site_lbl": "N2007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "X", "chr_pos": "3317662", "evidence": [ { "id": "rs1921185417", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921185417" }, { "id": "rs1921185417", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921185417#frequency_tab" }, { "id": "rs1921185417", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1921185417" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "", "site_lbl": "N2500", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "23", "chr_pos": "3310703", "evidence": [ { "id": "Q9NR99", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NR99" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->IHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "562", "site_seq": "N", "site_lbl": "Asn562", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95171-1", "start_pos": 562, "end_pos": 562, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1724", "url": "https://glyconnect.expasy.org/browser/proteins/1724" } ], "protein_name": "Sciellin", "gene_name": "SCEL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 688, "chemical_mass": 77552.0 } ] }, { "start_pos": "562", "site_seq": "", "site_lbl": "N562", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "13", "chr_pos": "77628004", "evidence": [ { "id": "rs754106670", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754106670" }, { "id": "rs754106670", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754106670" }, { "id": "rs754106670", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754106670#frequency_tab" }, { "id": "rs754106670", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754106670" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95171-1", "start_pos": 562, "end_pos": 562, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1724", "url": "https://glyconnect.expasy.org/browser/proteins/1724" } ], "protein_name": "Sciellin", "gene_name": "SCEL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 688, "chemical_mass": 77552.0 } ] }, { "start_pos": "530", "site_seq": "SISEnATATAAPK", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "N", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "SISENATATAAPK", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "530", "site_seq": "", "site_lbl": "N530", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "1", "chr_pos": "172585878", "evidence": [ { "id": "rs1285759601", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1285759601" }, { "id": "rs1285759601", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1285759601#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS9-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1775", "url": "https://glyconnect.expasy.org/browser/proteins/1775" } ], "protein_name": "SUN domain-containing ossification factor", "gene_name": "SUCO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1254, "chemical_mass": 139430.0 } ] }, { "start_pos": "162", "site_seq": "SELVnETR", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1780", "url": "https://glyconnect.expasy.org/browser/proteins/1780" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1780", "url": "https://glyconnect.expasy.org/browser/proteins/1780" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "SELVNETR", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1780", "url": "https://glyconnect.expasy.org/browser/proteins/1780" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "", "site_lbl": "N162", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "22", "chr_pos": "24184180", "evidence": [ { "id": "rs2047344904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047344904" }, { "id": "rs2047344904", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2047344904#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "22", "chr_pos": "24184181", "evidence": [ { "id": "rs2148865551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148865551" }, { "id": "rs2148865551", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148865551" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1780", "url": "https://glyconnect.expasy.org/browser/proteins/1780" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "330", "site_seq": "FFAEnETWVVDSCTTCTCK", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1805", "url": "https://glyconnect.expasy.org/browser/proteins/1805" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "330", "site_seq": "N", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1805", "url": "https://glyconnect.expasy.org/browser/proteins/1805" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1847", "url": "https://glyconnect.expasy.org/browser/proteins/1847" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "SCPACPGSnITIR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "17", "chr_pos": "58278062", "evidence": [ { "id": "P05164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05164" }, { "id": "rs1197536833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197536833" }, { "id": "rs1197536833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1197536833" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "17", "chr_pos": "58278063", "evidence": [ { "id": "rs200234386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200234386#frequency_tab" }, { "id": "rs200234386", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200234386" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "131", "site_seq": "VPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLR", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "131", "site_seq": "", "site_lbl": "N131", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "105587789", "evidence": [ { "id": "rs2085474772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085474772" }, { "id": "rs2085474772", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085474772#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "rs1175912363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175912363" }, { "id": "rs1175912363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175912363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "P98160", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "653", "url": "https://glyconnect.expasy.org/browser/proteins/653" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "75566708", "evidence": [ { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "11", "chr_pos": "75566707_75566708insCG", "evidence": [ { "id": "rs1420882595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420882595" }, { "id": "rs1420882595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420882595" }, { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "11", "chr_pos": "75566707", "evidence": [ { "id": "rs1942086877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942086877" }, { "id": "rs1942086877", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1942086877" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "470", "site_seq": "GVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "N", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "RGVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "723", "url": "https://glyconnect.expasy.org/browser/proteins/723" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGnVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "N", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGNVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99650-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1965", "url": "https://glyconnect.expasy.org/browser/proteins/1965" } ], "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 110509.0 } ] }, { "start_pos": "176", "site_seq": "NIQNnVSCYLEGK", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99650-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1965", "url": "https://glyconnect.expasy.org/browser/proteins/1965" } ], "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 110509.0 } ] }, { "start_pos": "176", "site_seq": "NIQNNVSCYLEGK", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99650-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1965", "url": "https://glyconnect.expasy.org/browser/proteins/1965" } ], "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 110509.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "5", "chr_pos": "38883936", "evidence": [ { "id": "rs563322211", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563322211" }, { "id": "rs563322211", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563322211" }, { "id": "rs563322211", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563322211" }, { "id": "rs563322211", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs563322211" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99650-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1965", "url": "https://glyconnect.expasy.org/browser/proteins/1965" } ], "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 110509.0 } ] }, { "start_pos": "1601", "site_seq": "N", "site_lbl": "Asn1601", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03164-1", "start_pos": 1601, "end_pos": 1601, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2046", "url": "https://glyconnect.expasy.org/browser/proteins/2046" } ], "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3969, "chemical_mass": 431764.0 } ] }, { "start_pos": "3411", "site_seq": "N", "site_lbl": "Asn3411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3411", "site_seq": "FVEGSHnSTVSLTTK", "site_lbl": "Asn3411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3411", "site_seq": "", "site_lbl": "N3411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "21006635", "evidence": [ { "id": "P04114", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04114" }, { "id": "rs771372599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771372599" }, { "id": "rs771372599", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771372599" }, { "id": "rs771372599", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771372599#frequency_tab" }, { "id": "rs771372599", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771372599" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary.", "url": "http://disease-ontology.org/term/DOID:2394", "evidence": [ { "id": "2394", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "2", "chr_pos": "21006636", "evidence": [ { "id": "rs773958267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773958267" }, { "id": "rs773958267", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773958267" }, { "id": "rs773958267", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773958267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "410", "site_seq": "N", "site_lbl": "Asn410", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 410, "end_pos": 410, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "410", "site_seq": "", "site_lbl": "N410", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "12", "chr_pos": "9104276", "evidence": [ { "id": "rs766284551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766284551" }, { "id": "rs766284551", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766284551" }, { "id": "rs766284551", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766284551#frequency_tab" }, { "id": "rs766284551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766284551" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 410, "end_pos": 410, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "152", "site_seq": "RCPDGFFSnETSSK", "site_lbl": "Asn152", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00300-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2947", "url": "https://glyconnect.expasy.org/browser/proteins/2947" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 11B", "gene_name": "TNFRSF11B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46026.0 } ] }, { "start_pos": "152", "site_seq": "N", "site_lbl": "Asn152", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00300-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2947", "url": "https://glyconnect.expasy.org/browser/proteins/2947" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 11B", "gene_name": "TNFRSF11B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46026.0 } ] }, { "start_pos": "152", "site_seq": "", "site_lbl": "N152", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "8", "chr_pos": "118928876", "evidence": [ { "id": "rs1475579032", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1475579032" }, { "id": "rs1475579032", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1475579032#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00300-1", "start_pos": 152, "end_pos": 152, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2947", "url": "https://glyconnect.expasy.org/browser/proteins/2947" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 11B", "gene_name": "TNFRSF11B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 46026.0 } ] }, { "start_pos": "151", "site_seq": "LRnVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "N", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "nVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "105855049", "evidence": [ { "id": "rs1555378058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555378058" }, { "id": "rs1555378058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555378058" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "14", "chr_pos": "105855048", "evidence": [ { "id": "rs1248268985", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248268985" }, { "id": "rs1248268985", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1248268985#frequency_tab" }, { "id": "rs1248268985", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248268985" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24706782", "url": "https://glygen.org/publication/PubMed/24706782" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01854-2", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25824821", "url": "https://glygen.org/publication/PubMed/25824821" }, { "database": "GlyConnect", "id": "765", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 546, "chemical_mass": 59539.0 } ] }, { "start_pos": "1105", "site_seq": "VNSSLHSQISR", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1105", "site_seq": "N", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1393", "site_seq": "RIPAINR", "site_lbl": "Asn1393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1393, "end_pos": 1393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1393", "site_seq": "N", "site_lbl": "Asn1393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1393, "end_pos": 1393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1393", "site_seq": "", "site_lbl": "N1393", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "1", "chr_pos": "153103388", "evidence": [ { "id": "rs3388504092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388504092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1393, "end_pos": 1393, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "215", "site_seq": "DIILHSTGHNISR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C129-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2477", "url": "https://glyconnect.expasy.org/browser/proteins/2477" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "Lnpep", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1025, "chemical_mass": 117304.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "LNKSYIFIYDGNK", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "61", "site_seq": "LNKSYIFIYDGNKNSTTTDQNFTSAK", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "725", "site_seq": "N", "site_lbl": "Asn725", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 725, "end_pos": 725, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2484", "url": "https://glyconnect.expasy.org/browser/proteins/2484" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "725", "site_seq": "VFLNGTHR", "site_lbl": "Asn725", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 725, "end_pos": 725, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2484", "url": "https://glyconnect.expasy.org/browser/proteins/2484" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "115", "site_seq": "GYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11438-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 43865.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "115", "site_seq": "EASHYSIHDIVLSYNTSDSTVFPGAVAK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "202", "site_seq": "N", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKF6-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2528", "url": "https://glyconnect.expasy.org/browser/proteins/2528" } ], "protein_name": "Nectin-1", "gene_name": "Nectin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57035.0 } ] }, { "start_pos": "202", "site_seq": "NPNGTVTVISR", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKF6-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2528", "url": "https://glyconnect.expasy.org/browser/proteins/2528" } ], "protein_name": "Nectin-1", "gene_name": "Nectin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57035.0 } ] }, { "start_pos": "474", "site_seq": "YNCTATNR", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35136-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2536", "url": "https://glyconnect.expasy.org/browser/proteins/2536" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "Ncam2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 837, "chemical_mass": 93204.0 } ] }, { "start_pos": "474", "site_seq": "N", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35136-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2536", "url": "https://glyconnect.expasy.org/browser/proteins/2536" } ], "protein_name": "Neural cell adhesion molecule 2", "gene_name": "Ncam2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 837, "chemical_mass": 93204.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "293", "site_seq": "VIYQNHNK", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "478", "site_seq": "FFPYANGTLSIR", "site_lbl": "Asn478", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 478, "end_pos": 478, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "478", "site_seq": "N", "site_lbl": "Asn478", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 478, "end_pos": 478, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "121", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55066-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2545", "url": "https://glyconnect.expasy.org/browser/proteins/2545" } ], "protein_name": "Neurocan core protein", "gene_name": "Ncan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1268, "chemical_mass": 137200.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55066-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2545", "url": "https://glyconnect.expasy.org/browser/proteins/2545" } ], "protein_name": "Neurocan core protein", "gene_name": "Ncan", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1268, "chemical_mass": 137200.0 } ] }, { "start_pos": "446", "site_seq": "VILYNRTR", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "446", "site_seq": "N", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "866", "site_seq": "YVPFNGTK", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U3-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2547", "url": "https://glyconnect.expasy.org/browser/proteins/2547" } ], "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1240, "chemical_mass": 137975.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "217", "site_seq": "FNHTQTIQQK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "501", "site_seq": "GSALHEDIYVLHDNGTLEIPVAQK", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "501", "site_seq": "N", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2549", "url": "https://glyconnect.expasy.org/browser/proteins/2549" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "305", "site_seq": "LGHTNASIMLFGETLP", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PJ0-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2559", "url": "https://glyconnect.expasy.org/browser/proteins/2559" } ], "protein_name": "Neurotrimin", "gene_name": "Ntm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 37984.0 } ] }, { "start_pos": "305", "site_seq": "N", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PJ0-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2559", "url": "https://glyconnect.expasy.org/browser/proteins/2559" } ], "protein_name": "Neurotrimin", "gene_name": "Ntm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 37984.0 } ] }, { "start_pos": "305", "site_seq": "LGHTNASIMLFGPGAVSEVNNGTSRR", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PJ0-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2559", "url": "https://glyconnect.expasy.org/browser/proteins/2559" } ], "protein_name": "Neurotrimin", "gene_name": "Ntm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 37984.0 } ] }, { "start_pos": "305", "site_seq": "LGHTNASIMLFEVK", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PJ0-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2559", "url": "https://glyconnect.expasy.org/browser/proteins/2559" } ], "protein_name": "Neurotrimin", "gene_name": "Ntm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 37984.0 } ] }, { "start_pos": "305", "site_seq": "LGHTNASIMLFELNEPTSSTLLQEVK", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PJ0-1", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2559", "url": "https://glyconnect.expasy.org/browser/proteins/2559" } ], "protein_name": "Neurotrimin", "gene_name": "Ntm", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 344, "chemical_mass": 37984.0 } ] }, { "start_pos": "473", "site_seq": "N", "site_lbl": "Asn473", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88998-1", "start_pos": 473, "end_pos": 473, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2565", "url": "https://glyconnect.expasy.org/browser/proteins/2565" } ], "protein_name": "Noelin", "gene_name": "Olfm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 485, "chemical_mass": 55398.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63912-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2569", "url": "https://glyconnect.expasy.org/browser/proteins/2569" } ], "protein_name": "Oligodendrocyte-myelin glycoprotein", "gene_name": "Omg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 49284.0 } ] }, { "start_pos": "234", "site_seq": "WSCDHKQNITYLLK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63912-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2569", "url": "https://glyconnect.expasy.org/browser/proteins/2569" } ], "protein_name": "Oligodendrocyte-myelin glycoprotein", "gene_name": "Omg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 440, "chemical_mass": 49284.0 } ] }, { "start_pos": "272", "site_seq": "N", "site_lbl": "Asn272", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SUR0-1", "start_pos": 272, "end_pos": 272, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2586", "url": "https://glyconnect.expasy.org/browser/proteins/2586" } ], "protein_name": "Phosphoribosylformylglycinamidine synthase", "gene_name": "Pfas", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1337, "chemical_mass": 144629.0 } ] }, { "start_pos": "31", "site_seq": "N", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "31", "site_seq": "SPLPAAFTANGTHLQHLAR", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CJH3-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2593", "url": "https://glyconnect.expasy.org/browser/proteins/2593" } ], "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2119, "chemical_mass": 231376.0 } ] }, { "start_pos": "735", "site_seq": "N", "site_lbl": "Asn735", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "735", "site_seq": "LSHDGNETLPLHLYVK", "site_lbl": "Asn735", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "735", "site_seq": "", "site_lbl": "N735", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "15", "chr_pos": "89047190", "evidence": [ { "id": "rs3389382028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389382028" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2594", "url": "https://glyconnect.expasy.org/browser/proteins/2594" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "1084", "site_seq": "N", "site_lbl": "Asn1084", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QZC2-1", "start_pos": 1084, "end_pos": 1084, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2596", "url": "https://glyconnect.expasy.org/browser/proteins/2596" } ], "protein_name": "Plexin-C1", "gene_name": "Plxnc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1574, "chemical_mass": 176474.0 } ] }, { "start_pos": "1512", "site_seq": "N", "site_lbl": "Asn1512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1512, "end_pos": 1512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "1512", "site_seq": "WTGHNVTVVQR", "site_lbl": "Asn1512", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 1512, "end_pos": 1512, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3840", "site_seq": "N", "site_lbl": "Asn3840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3840, "end_pos": 3840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3840", "site_seq": "FGTCSQLCNNTK", "site_lbl": "Asn3840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3840, "end_pos": 3840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "724", "site_seq": "N", "site_lbl": "Asn724", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64487-4", "start_pos": 724, "end_pos": 724, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2667", "url": "https://glyconnect.expasy.org/browser/proteins/2667" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase delta", "gene_name": "Ptprd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1912, "chemical_mass": 214410.0 } ] }, { "start_pos": "724", "site_seq": "KVEVEAVNATAVK", "site_lbl": "Asn724", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64487-4", "start_pos": 724, "end_pos": 724, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2667", "url": "https://glyconnect.expasy.org/browser/proteins/2667" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase delta", "gene_name": "Ptprd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1912, "chemical_mass": 214410.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D7G0-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2686", "url": "https://glyconnect.expasy.org/browser/proteins/2686" } ], "protein_name": "Ribose-phosphate pyrophosphokinase 1", "gene_name": "Prps1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 318, "chemical_mass": 34834.0 } ] }, { "start_pos": "164", "site_seq": "NCTIVSPDAGGAK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D7G0-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2686", "url": "https://glyconnect.expasy.org/browser/proteins/2686" } ], "protein_name": "Ribose-phosphate pyrophosphokinase 1", "gene_name": "Prps1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 318, "chemical_mass": 34834.0 } ] }, { "start_pos": "793", "site_seq": "N", "site_lbl": "Asn793", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TPD3-1", "start_pos": 793, "end_pos": 793, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2688", "url": "https://glyconnect.expasy.org/browser/proteins/2688" } ], "protein_name": "Roundabout homolog 2", "gene_name": "Robo2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1470, "chemical_mass": 161190.0 } ] }, { "start_pos": "793", "site_seq": "FHINKTVDAAIR", "site_lbl": "Asn793", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TPD3-1", "start_pos": 793, "end_pos": 793, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2688", "url": "https://glyconnect.expasy.org/browser/proteins/2688" } ], "protein_name": "Roundabout homolog 2", "gene_name": "Robo2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1470, "chemical_mass": 161190.0 } ] }, { "start_pos": "168", "site_seq": "N", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "168", "site_seq": "VNFTCKSHGFSPR", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "246", "site_seq": "N", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "246", "site_seq": "GIANLSNFIR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "473", "site_seq": "VAEIPFNSTNK", "site_lbl": "Asn473", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PIC6-1", "start_pos": 473, "end_pos": 473, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2725", "url": "https://glyconnect.expasy.org/browser/proteins/2725" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-3", "gene_name": "Atp1a3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1013, "chemical_mass": 111692.0 } ] }, { "start_pos": "473", "site_seq": "N", "site_lbl": "Asn473", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PIC6-1", "start_pos": 473, "end_pos": 473, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2725", "url": "https://glyconnect.expasy.org/browser/proteins/2725" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-3", "gene_name": "Atp1a3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1013, "chemical_mass": 111692.0 } ] }, { "start_pos": "118", "site_seq": "FLEPYNDSIQAQK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "153", "site_seq": "RACQFNR", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "238", "site_seq": "KFHVNYTQPLVAVK", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07214-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2736", "url": "https://glyconnect.expasy.org/browser/proteins/2736" } ], "protein_name": "SPARC", "gene_name": "Sparc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 302, "chemical_mass": 34450.0 } ] }, { "start_pos": "115", "site_seq": "VCSNDNKTFDSSCHFFATK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07214-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2736", "url": "https://glyconnect.expasy.org/browser/proteins/2736" } ], "protein_name": "SPARC", "gene_name": "Sparc", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 302, "chemical_mass": 34450.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70663-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2737", "url": "https://glyconnect.expasy.org/browser/proteins/2737" } ], "protein_name": "SPARC-like protein 1", "gene_name": "Sparcl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 650, "chemical_mass": 72287.0 } ] }, { "start_pos": "462", "site_seq": "ILDQACGTDNQTYASSCHLFATK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70663-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2737", "url": "https://glyconnect.expasy.org/browser/proteins/2737" } ], "protein_name": "SPARC-like protein 1", "gene_name": "Sparcl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 650, "chemical_mass": 72287.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "9", "chr_pos": "56053849", "evidence": [ { "id": "rs3389050652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389050652" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9QY33-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2761", "url": "https://glyconnect.expasy.org/browser/proteins/2761" } ], "protein_name": "Tetraspanin-3", "gene_name": "Tspan3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 253, "chemical_mass": 28049.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "118", "site_seq": "DEGDYFCELQVSGANPMSSNK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "1169", "site_seq": "N", "site_lbl": "Asn1169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6KAS7-1", "start_pos": 1169, "end_pos": 1169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2829", "url": "https://glyconnect.expasy.org/browser/proteins/2829" } ], "protein_name": "Zinc finger protein 521", "gene_name": "Znf521", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1311, "chemical_mass": 147666.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P5F6-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2830", "url": "https://glyconnect.expasy.org/browser/proteins/2830" } ], "protein_name": "Zinc transporter ZIP10", "gene_name": "Slc39a10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 833, "chemical_mass": 94394.0 } ] }, { "start_pos": "341", "site_seq": "QHECLNVTQLLK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P5F6-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2830", "url": "https://glyconnect.expasy.org/browser/proteins/2830" } ], "protein_name": "Zinc transporter ZIP10", "gene_name": "Slc39a10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 833, "chemical_mass": 94394.0 } ] }, { "start_pos": "636", "site_seq": "N", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CGM1-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2108", "url": "https://glyconnect.expasy.org/browser/proteins/2108" } ], "protein_name": "Adhesion G protein-coupled receptor B2", "gene_name": "Adgrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1561, "chemical_mass": 169863.0 } ] }, { "start_pos": "636", "site_seq": "RTYYSGDLLFSVDILRNVTDTFK", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CGM1-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2108", "url": "https://glyconnect.expasy.org/browser/proteins/2108" } ], "protein_name": "Adhesion G protein-coupled receptor B2", "gene_name": "Adgrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1561, "chemical_mass": 169863.0 } ] }, { "start_pos": "241", "site_seq": "HMNETSHTQGSLR", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2148", "url": "https://glyconnect.expasy.org/browser/proteins/2148" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "638", "site_seq": "INNTHALVSLLQNLNK", "site_lbl": "Asn638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 638, "end_pos": 638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "638", "site_seq": "N", "site_lbl": "Asn638", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 638, "end_pos": 638, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97326-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2171", "url": "https://glyconnect.expasy.org/browser/proteins/2171" } ], "protein_name": "Cadherin-6", "gene_name": "Cdh6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88355.0 } ] }, { "start_pos": "399", "site_seq": "INTTIGSVAAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97326-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2171", "url": "https://glyconnect.expasy.org/browser/proteins/2171" } ], "protein_name": "Cadherin-6", "gene_name": "Cdh6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88355.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00493-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2185", "url": "https://glyconnect.expasy.org/browser/proteins/2185" } ], "protein_name": "Carboxypeptidase E", "gene_name": "Cpe", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 476, "chemical_mass": 53256.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24668-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2194", "url": "https://glyconnect.expasy.org/browser/proteins/2194" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6pr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31172.0 } ] }, { "start_pos": "58", "site_seq": "LRPLFNK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24668-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2194", "url": "https://glyconnect.expasy.org/browser/proteins/2194" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6pr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31172.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61490-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2196", "url": "https://glyconnect.expasy.org/browser/proteins/2196" } ], "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 583, "chemical_mass": 65092.0 } ] }, { "start_pos": "494", "site_seq": "N", "site_lbl": "Asn494", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "494", "site_seq": "GKANSTGTLVITNPTR", "site_lbl": "Asn494", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 494, "end_pos": 494, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2224", "url": "https://glyconnect.expasy.org/browser/proteins/2224" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "436", "site_seq": "VGVHINNTQTK", "site_lbl": "Asn436", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "436", "site_seq": "N", "site_lbl": "Asn436", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CPW0-1", "start_pos": 436, "end_pos": 436, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2231", "url": "https://glyconnect.expasy.org/browser/proteins/2231" } ], "protein_name": "Contactin-associated protein-like 2", "gene_name": "Cntnap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1332, "chemical_mass": 148197.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0V8T7-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2234", "url": "https://glyconnect.expasy.org/browser/proteins/2234" } ], "protein_name": "Contactin-associated protein like 5-3", "gene_name": "Cntnap5c", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1305, "chemical_mass": 146242.0 } ] }, { "start_pos": "282", "site_seq": "QANFTVDK", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0V8T7-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2234", "url": "https://glyconnect.expasy.org/browser/proteins/2234" } ], "protein_name": "Contactin-associated protein like 5-3", "gene_name": "Cntnap5c", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1305, "chemical_mass": 146242.0 } ] }, { "start_pos": "258", "site_seq": "LAYATINDSR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "258", "site_seq": "N", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "505", "site_seq": "N", "site_lbl": "Asn505", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 505, "end_pos": 505, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "505", "site_seq": "CEGPGVPTVTVHNTTDK", "site_lbl": "Asn505", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 505, "end_pos": 505, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "258", "site_seq": "", "site_lbl": "N258", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->YDS).", "chr_id": "5", "chr_pos": "27836448", "evidence": [ { "id": "rs3388734770", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388734770" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O55026-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2273", "url": "https://glyconnect.expasy.org/browser/proteins/2273" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "Entpd2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 495, "chemical_mass": 54319.0 } ] }, { "start_pos": "70", "site_seq": "SNVSVEENVILEKPSHVELK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21995-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2281", "url": "https://glyconnect.expasy.org/browser/proteins/2281" } ], "protein_name": "Embigin", "gene_name": "Emb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 37064.0 } ] }, { "start_pos": "654", "site_seq": "N", "site_lbl": "Asn654", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BMI0-1", "start_pos": 654, "end_pos": 654, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2309", "url": "https://glyconnect.expasy.org/browser/proteins/2309" } ], "protein_name": "F-box only protein 38", "gene_name": "Fbxo38", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1194, "chemical_mass": 133928.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16092-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2314", "url": "https://glyconnect.expasy.org/browser/proteins/2314" } ], "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "Fgfr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 822, "chemical_mass": 91981.0 } ] }, { "start_pos": "77", "site_seq": "DGVQLVESNR", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16092-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2314", "url": "https://glyconnect.expasy.org/browser/proteins/2314" } ], "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "Fgfr1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 822, "chemical_mass": 91981.0 } ] }, { "start_pos": "104", "site_seq": "LSYNVIPLNLTLDNR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P63137-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2325", "url": "https://glyconnect.expasy.org/browser/proteins/2325" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit beta-2", "gene_name": "Gabrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 512, "chemical_mass": 59197.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P63137-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2325", "url": "https://glyconnect.expasy.org/browser/proteins/2325" } ], "protein_name": "Gamma-aminobutyric acid receptor subunit beta-2", "gene_name": "Gabrb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 512, "chemical_mass": 59197.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q640R3-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2372", "url": "https://glyconnect.expasy.org/browser/proteins/2372" } ], "protein_name": "Hepatic and glial cell adhesion molecule", "gene_name": "Hepacam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 418, "chemical_mass": 46367.0 } ] }, { "start_pos": "189", "site_seq": "DGKPLLNDSR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q640R3-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2372", "url": "https://glyconnect.expasy.org/browser/proteins/2372" } ], "protein_name": "Hepatic and glial cell adhesion molecule", "gene_name": "Hepacam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 418, "chemical_mass": 46367.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "325", "site_seq": "RIGPGEPLELLCNVSGALPPPGR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "325", "site_seq": "IGPGEPLELLCNVSGALPPPGR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "74", "site_seq": "MFLLVGAPKANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "2", "chr_pos": "83615749", "evidence": [ { "id": "rs3388560273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388560273" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43406-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2402", "url": "https://glyconnect.expasy.org/browser/proteins/2402" } ], "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1044, "chemical_mass": 115360.0 } ] }, { "start_pos": "517", "site_seq": "EICSGNSSQCAPNVHK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2413", "url": "https://glyconnect.expasy.org/browser/proteins/2413" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2413", "url": "https://glyconnect.expasy.org/browser/proteins/2413" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "632", "site_seq": "N", "site_lbl": "Asn632", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 632, "end_pos": 632, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2413", "url": "https://glyconnect.expasy.org/browser/proteins/2413" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "632", "site_seq": "TLNCSGAHVK", "site_lbl": "Asn632", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 632, "end_pos": 632, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2413", "url": "https://glyconnect.expasy.org/browser/proteins/2413" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] } ], "record_id": "G33609NS" }