{ "glytoucan_ac": "G29299MO", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "Subsumption", "id": "G87164WU", "url": "https://www.glygen.org/glycan/G87164WU" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10114, "name": "Rattus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G10943MK", "url": "https://www.glygen.org/glycan/G10943MK" }, { "database": "Subsumption", "id": "G29230VB", "url": "https://www.glygen.org/glycan/G29230VB" }, { "database": "Subsumption", "id": "G41441JX", "url": "https://www.glygen.org/glycan/G41441JX" }, { "database": "Subsumption", "id": "G58938QK", "url": "https://www.glygen.org/glycan/G58938QK" }, { "database": "Subsumption", "id": "G68074FW", "url": "https://www.glygen.org/glycan/G68074FW" }, { "database": "Subsumption", "id": "G87164WU", "url": "https://www.glygen.org/glycan/G87164WU" } ], "common_name": "Rattus", "glygen_name": "Rattus", "reference_species": "Rattus [10114]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G27783SY", "url": "https://www.glygen.org/glycan/G27783SY" }, { "database": "Subsumption", "id": "G56555MU", "url": "https://www.glygen.org/glycan/G56555MU" }, { "database": "Subsumption", "id": "G69963GQ", "url": "https://www.glygen.org/glycan/G69963GQ" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 7955, "name": "Danio rerio", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G45252ML", "url": "https://www.glygen.org/glycan/G45252ML" }, { "database": "Subsumption", "id": "G80180LY", "url": "https://www.glygen.org/glycan/G80180LY" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mass": 1729.63, "classification": [ { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Lacto series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Neo-lacto series" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Truncated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 2, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "466", "site_seq": "NQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPR", "site_lbl": "Asn466", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27540-1", "start_pos": 466, "end_pos": 466, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 789, "chemical_mass": 86636.0 } ] }, { "start_pos": "466", "site_seq": "", "site_lbl": "N466", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "150818028", "evidence": [ { "id": "rs1237637333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1237637333" }, { "id": "rs1237637333", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1237637333" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "1", "chr_pos": "150818028", "evidence": [ { "id": "rs1237637333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1237637333" }, { "id": "rs1237637333", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1237637333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27540-1", "start_pos": 466, "end_pos": 466, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 789, "chemical_mass": 86636.0 } ] }, { "start_pos": "1851", "site_seq": "KNDTTSAR", "site_lbl": "Asn1851", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15021-5", "start_pos": 1851, "end_pos": 1851, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Microtubule-associated serine/threonine-protein kinase 4", "gene_name": "MAST4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2623, "chemical_mass": 284097.0 } ] }, { "start_pos": "685", "site_seq": "GLVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPR", "site_lbl": "Asn685", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92729-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase U", "gene_name": "PTPRU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1446, "chemical_mass": 162423.0 } ] }, { "start_pos": "685", "site_seq": "N", "site_lbl": "Asn685", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92729-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase U", "gene_name": "PTPRU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1446, "chemical_mass": 162423.0 } ] }, { "start_pos": "201", "site_seq": "N", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97792-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Coxsackievirus and adenovirus receptor homolog", "gene_name": "Cxadr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 365, "chemical_mass": 39948.0 } ] }, { "start_pos": "201", "site_seq": "NASSEYSGTYSCTVQNR", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97792-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Coxsackievirus and adenovirus receptor homolog", "gene_name": "Cxadr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 365, "chemical_mass": 39948.0 } ] }, { "start_pos": "4019", "site_seq": "SHALLLYNYDNQTGER", "site_lbl": "Asn4019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2PZL6-1", "start_pos": 4019, "end_pos": 4019, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin Fat 4", "gene_name": "Fat4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4981, "chemical_mass": 540316.0 } ] }, { "start_pos": "4019", "site_seq": "N", "site_lbl": "Asn4019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2PZL6-1", "start_pos": 4019, "end_pos": 4019, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin Fat 4", "gene_name": "Fat4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4981, "chemical_mass": 540316.0 } ] }, { "start_pos": "2621", "site_seq": "N", "site_lbl": "Asn2621", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2621, "end_pos": 2621, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "2621", "site_seq": "DGSCIGNSSR", "site_lbl": "Asn2621", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2621, "end_pos": 2621, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "267", "site_seq": "GQVNVTR", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0C605-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "cGMP-dependent protein kinase 1", "gene_name": "Prkg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 671, "chemical_mass": 76350.0 } ] }, { "start_pos": "56", "site_seq": "MVNENVSLVISR", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88544-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "COP9 signalosome complex subunit 4", "gene_name": "Cops4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 406, "chemical_mass": 46285.0 } ] }, { "start_pos": "398", "site_seq": "GCLQCLAVLNLSR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EDY6-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "F-actin-uncapping protein LRRC16A", "gene_name": "Carmil1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1374, "chemical_mass": 151860.0 } ] }, { "start_pos": "3400", "site_seq": "LDNMNVSR", "site_lbl": "Asn3400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TMY8-1", "start_pos": 3400, "end_pos": 3400, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "E3 ubiquitin-protein ligase HUWE1", "gene_name": "Huwe1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4377, "chemical_mass": 482635.0 } ] }, { "start_pos": "553", "site_seq": "HRPHPVKPMNTTATK", "site_lbl": "Asn553", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D620-1", "start_pos": 553, "end_pos": 553, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Rab11 family-interacting protein 1", "gene_name": "Rab11fip1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 645, "chemical_mass": 70684.0 } ] }, { "start_pos": "205", "site_seq": "QSILHVLGILNNSKFLR", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R151-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NFX1-type zinc finger-containing protein 1", "gene_name": "Znfx1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1909, "chemical_mass": 218828.0 } ] }, { "start_pos": "66", "site_seq": "RQAALSFLTNISLDGR", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ESJ1-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "Cables1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 568, "chemical_mass": 61429.0 } ] }, { "start_pos": "165", "site_seq": "INETLKLPPR", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EPC1-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Alpha-parvin", "gene_name": "Parva", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 372, "chemical_mass": 42330.0 } ] }, { "start_pos": "161", "site_seq": "YDLPASINFILnK", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "N", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "YDLPASINFILNK", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "161", "site_seq": "", "site_lbl": "N161", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "10", "chr_pos": "89226952", "evidence": [ { "id": "rs1842777596", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842777596" }, { "id": "rs1842777596", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1842777596" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "89226952", "evidence": [ { "id": "rs762559980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762559980" }, { "id": "21963785", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21963785" } ], "disease": [ { "disease_id": "DOID:0080217", "name": "lysosomal acid lipase deficiency", "description": "A lipid storage disease characterized by dyslipidemia and accumulation of cholesteryl esters and triglycerides within various organs that has_material_basis_in homozygous or compound heterozygous mutation in the LIPA gene on chromosome 10q23.31.", "url": "http://disease-ontology.org/term/DOID:0080217", "evidence": [ { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" }, { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" } ] }, { "disease_id": "DOID:0080217", "name": "lysosomal acid lipase deficiency", "description": "A lipid storage disease characterized by dyslipidemia and accumulation of cholesteryl esters and triglycerides within various organs that has_material_basis_in homozygous or compound heterozygous mutation in the LIPA gene on chromosome 10q23.31.", "url": "http://disease-ontology.org/term/DOID:0080217", "evidence": [ { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" }, { "id": "0080217", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080217" } ] }, { "disease_id": "DOID:14502", "name": "cholesterol ester storage disease", "description": "A lysosomal acid lipase deficiency characterized by onset in childhood or later of progressive accumulation of cholesteryl esters and triglycerides primarily in the liver and spleen.", "url": "http://disease-ontology.org/term/DOID:14502", "evidence": [ { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" }, { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" } ] }, { "disease_id": "DOID:14502", "name": "cholesterol ester storage disease", "description": "A lysosomal acid lipase deficiency characterized by onset in childhood or later of progressive accumulation of cholesteryl esters and triglycerides primarily in the liver and spleen.", "url": "http://disease-ontology.org/term/DOID:14502", "evidence": [ { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" }, { "id": "14502", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14502" } ] }, { "disease_id": "DOID:14497", "name": "Wolman disease", "description": "A lysosomal acid lipase deficiency characterized by infantile onset of rapidly progressive accumulation of cholesteryl esters and triglycerides throughout the body, resulting in hepatosplenomegaly, severe malnutrition, jaundice, vomiting, diarrhea, steatorrhea. Death usually occurs within the first year of life.", "url": "http://disease-ontology.org/term/DOID:14497", "evidence": [ { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" }, { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" } ] }, { "disease_id": "DOID:14497", "name": "Wolman disease", "description": "A lysosomal acid lipase deficiency characterized by infantile onset of rapidly progressive accumulation of cholesteryl esters and triglycerides throughout the body, resulting in hepatosplenomegaly, severe malnutrition, jaundice, vomiting, diarrhea, steatorrhea. Death usually occurs within the first year of life.", "url": "http://disease-ontology.org/term/DOID:14497", "evidence": [ { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" }, { "id": "14497", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14497" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P38571-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal acid lipase/cholesteryl ester hydrolase", "gene_name": "LIPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 45419.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "TELFSSSCPGGIMLnETGQGYQR", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "", "site_lbl": "N135", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "31657440", "evidence": [ { "id": "rs552461480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs552461480" }, { "id": "rs552461480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs552461480#frequency_tab" }, { "id": "rs552461480", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs552461480" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O95445", "url": "https://www.uniprot.org/uniprotkb/O95445" }, { "database": "PubMed", "id": "11418126", "url": "https://glygen.org/publication/PubMed/11418126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "804", "site_seq": "nVTAQICIDK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "N", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "NVTAQICIDKK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "", "site_lbl": "N804", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "21", "chr_pos": "46002687", "evidence": [ { "id": "rs750677189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750677189#frequency_tab" }, { "id": "rs750677189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750677189" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGnASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGNASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "53", "site_seq": "DVnCSVMGPQEK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "DVNCSVMGPQEKK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "88337514", "evidence": [ { "id": "rs1857833438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1857833438" }, { "id": "rs1857833438", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1857833438#frequency_tab" }, { "id": "rs1857833438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1857833438" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "11", "chr_pos": "88337515", "evidence": [ { "id": "rs766806566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766806566" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "186602056", "evidence": [ { "id": "rs1686923072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686923072" }, { "id": "rs1686923072", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1686923072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "17", "chr_pos": "66216813", "evidence": [ { "id": "rs1307136735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307136735" }, { "id": "rs1307136735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1307136735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "SCPACPGSnITIR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "483", "site_seq": "SYnDSVDPR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "483", "site_seq": "SYNDSVDPR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "17", "chr_pos": "58278062", "evidence": [ { "id": "P05164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05164" }, { "id": "rs1197536833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197536833" }, { "id": "rs1197536833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1197536833" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "17", "chr_pos": "58278063", "evidence": [ { "id": "rs200234386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234386" }, { "id": "rs200234386", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200234386#frequency_tab" }, { "id": "rs200234386", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200234386" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "483", "site_seq": "", "site_lbl": "N483", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "17", "chr_pos": "58273588", "evidence": [ { "id": "rs1970396284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1970396284" }, { "id": "rs1970396284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1970396284#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "17", "chr_pos": "58273587", "evidence": [ { "id": "rs370533452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370533452" }, { "id": "rs370533452", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370533452" }, { "id": "rs370533452", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370533452#frequency_tab" }, { "id": "rs370533452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370533452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "645", "site_seq": "YIRTLMSSGQMAPSSSnK", "site_lbl": "Asn645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5VYK3-1", "start_pos": 645, "end_pos": 645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Proteasome adapter and scaffold protein ECM29", "gene_name": "ECPAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1845, "chemical_mass": 204291.0 } ] }, { "start_pos": "645", "site_seq": "TLMSSGQMAPSSSNK", "site_lbl": "Asn645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5VYK3-1", "start_pos": 645, "end_pos": 645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Proteasome adapter and scaffold protein ECM29", "gene_name": "ECPAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1845, "chemical_mass": 204291.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "", "site_lbl": "N94", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "8", "chr_pos": "120162501", "evidence": [ { "id": "rs1815713404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1815713404" }, { "id": "rs1815713404", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1815713404#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "19", "chr_pos": "10284819", "evidence": [ { "id": "rs368566175", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368566175" }, { "id": "rs368566175", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368566175#frequency_tab" }, { "id": "rs368566175", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368566175" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "328", "site_seq": "GTAEAAHECLPCnCSGR", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N6-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "LAMC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1575, "chemical_mass": 171227.0 } ] }, { "start_pos": "328", "site_seq": "GTAEAAHECLPCNCSGR", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N6-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "LAMC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1575, "chemical_mass": 171227.0 } ] }, { "start_pos": "328", "site_seq": "N", "site_lbl": "Asn328", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N6-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "LAMC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1575, "chemical_mass": 171227.0 } ] }, { "start_pos": "328", "site_seq": "", "site_lbl": "N328", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "9", "chr_pos": "131038871", "evidence": [ { "id": "rs1260484614", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1260484614" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N6-1", "start_pos": 328, "end_pos": 328, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "LAMC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1575, "chemical_mass": 171227.0 } ] }, { "start_pos": "83", "site_seq": "EQYTIInR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "83", "site_seq": "EQYTIINR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "5", "chr_pos": "55969671", "evidence": [ { "id": "rs768511842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768511842" }, { "id": "rs768511842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768511842" }, { "id": "rs768511842", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768511842#frequency_tab" }, { "id": "rs768511842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768511842" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "5", "chr_pos": "55969672", "evidence": [ { "id": "rs1413376396", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413376396" }, { "id": "rs1413376396", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1413376396#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGnVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "N", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGNVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "7", "chr_pos": "23260501", "evidence": [ { "id": "rs769718537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769718537#frequency_tab" }, { "id": "rs769718537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769718537" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "110", "site_seq": "AVIFFGDQEHPnVTEFAVGPLPGPCYMR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "7", "chr_pos": "150856800", "evidence": [ { "id": "P19801", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19801" }, { "id": "rs373164869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" }, { "id": "rs373164869", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373164869#frequency_tab" }, { "id": "rs373164869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373164869" }, { "id": "rs373164869", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "162", "site_seq": "SELVnETR", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "SELVNETR", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "162", "site_seq": "", "site_lbl": "N162", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "22", "chr_pos": "24184180", "evidence": [ { "id": "rs2047344904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047344904" }, { "id": "rs2047344904", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2047344904#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "22", "chr_pos": "24184181", "evidence": [ { "id": "rs2148865551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148865551" }, { "id": "rs2148865551", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148865551" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGT4-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sushi domain-containing protein 2", "gene_name": "SUSD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 90208.0 } ] }, { "start_pos": "165", "site_seq": "LnLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LNLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "", "site_lbl": "N165", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "16", "chr_pos": "74508902", "evidence": [ { "id": "rs1567491667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567491667" }, { "id": "rs1567491667", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567491667" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "74508903", "evidence": [ { "id": "Q92896", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92896" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "111", "site_seq": "SDAVSHTGnYTCEVTELTR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "111", "site_seq": "SDAVSHTGNYTCEVTELTR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "3", "chr_pos": "108080058", "evidence": [ { "id": "Q08722", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q08722" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "157", "site_seq": "FVnDTK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "N157", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "2", "chr_pos": "9527935", "evidence": [ { "id": "rs1664592938", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1664592938" }, { "id": "rs1664592938", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1664592938" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "411", "site_seq": "LnDTTLQVLNTWYTK", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "411", "site_seq": "N", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "411", "site_seq": "", "site_lbl": "N411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "13", "chr_pos": "53050470", "evidence": [ { "id": "Q6UX06", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6UX06" }, { "id": "rs928073819", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928073819" }, { "id": "rs928073819", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs928073819#frequency_tab" }, { "id": "rs928073819", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs928073819" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "598", "site_seq": "nLSVVILGASDK", "site_lbl": "Asn598", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "598", "site_seq": "N", "site_lbl": "Asn598", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "598", "site_seq": "", "site_lbl": "N598", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "16", "chr_pos": "83780080", "evidence": [ { "id": "rs1181604361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181604361" }, { "id": "rs1181604361", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1181604361#frequency_tab" }, { "id": "rs1181604361", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181604361" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "655", "site_seq": "NYnNTWTR", "site_lbl": "Asn655", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75054-1", "start_pos": 655, "end_pos": 655, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 3", "gene_name": "IGSF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1194, "chemical_mass": 135196.0 } ] }, { "start_pos": "655", "site_seq": "NYNNTWTR", "site_lbl": "Asn655", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75054-1", "start_pos": 655, "end_pos": 655, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 3", "gene_name": "IGSF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1194, "chemical_mass": 135196.0 } ] }, { "start_pos": "655", "site_seq": "N", "site_lbl": "Asn655", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75054-1", "start_pos": 655, "end_pos": 655, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 3", "gene_name": "IGSF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1194, "chemical_mass": 135196.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWnTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "N", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWNTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "N141", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "1", "chr_pos": "46184868", "evidence": [ { "id": "rs1657392644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657392644" }, { "id": "rs1657392644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657392644#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "1", "chr_pos": "46184867", "evidence": [ { "id": "rs765158447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765158447#frequency_tab" }, { "id": "rs765158447", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765158447" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "98", "site_seq": "LAnNTHQHVFDDLR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "98", "site_seq": "LANNTHQHVFDDLR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "766", "site_seq": "LnQTEPVAGNYYPVNTR", "site_lbl": "Asn766", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "766", "site_seq": "LNQTEPVAGNYYPVNTR", "site_lbl": "Asn766", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "766", "site_seq": "N", "site_lbl": "Asn766", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "36", "site_seq": "SIVLEPIYWnSSNSK", "site_lbl": "Asn36", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52799-1", "start_pos": 36, "end_pos": 36, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ephrin-B2", "gene_name": "EFNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 36923.0 } ] }, { "start_pos": "36", "site_seq": "N", "site_lbl": "Asn36", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52799-1", "start_pos": 36, "end_pos": 36, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ephrin-B2", "gene_name": "EFNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 36923.0 } ] }, { "start_pos": "36", "site_seq": "SIVLEPIYWNSSNSK", "site_lbl": "Asn36", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P52799-1", "start_pos": 36, "end_pos": 36, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ephrin-B2", "gene_name": "EFNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 333, "chemical_mass": 36923.0 } ] }, { "start_pos": "173", "site_seq": "LWNVETnTSTVLIEGK", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42658-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "DPP6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97588.0 } ] }, { "start_pos": "173", "site_seq": "N", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42658-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "DPP6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97588.0 } ] }, { "start_pos": "173", "site_seq": "", "site_lbl": "N173", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "7", "chr_pos": "154803949", "evidence": [ { "id": "rs769205185", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769205185" }, { "id": "rs769205185", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769205185" }, { "id": "rs769205185", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769205185" }, { "id": "rs1380941321", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1380941321" }, { "id": "rs1380941321", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1380941321" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P42658-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "DPP6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97588.0 } ] }, { "start_pos": "966", "site_seq": "YQTLnCSVNVNCVNIR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "YQTLNCSVNVNCVNIR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "966", "site_seq": "", "site_lbl": "N966", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "2", "chr_pos": "172491222", "evidence": [ { "id": "rs111722287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs111722287" }, { "id": "rs111722287", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs111722287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "FYFGGSPISAQYAnFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "KFYFGGSPISAQYANFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "171", "site_seq": "N", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "171", "site_seq": "FVnVTVTPEDQCRPNNVCTGVLTR", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "171", "site_seq": "", "site_lbl": "N171", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "19", "chr_pos": "830860", "evidence": [ { "id": "rs141614223", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141614223" }, { "id": "rs141614223", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141614223" }, { "id": "rs141614223", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141614223" }, { "id": "rs141614223", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141614223#frequency_tab" }, { "id": "rs141614223", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141614223" }, { "id": "rs141614223", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141614223" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "830859", "evidence": [ { "id": "rs556744148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556744148" }, { "id": "rs556744148", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556744148" }, { "id": "rs556744148", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556744148" }, { "id": "rs556744148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556744148#frequency_tab" }, { "id": "rs556744148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556744148" }, { "id": "rs556744148", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556744148" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "508", "site_seq": "TLFPNYFnGSEIIIAGK", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "508", "site_seq": "N", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "508", "site_seq": "", "site_lbl": "N508", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "10", "chr_pos": "7576907", "evidence": [ { "id": "Q86UX2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86UX2" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "7576908", "evidence": [ { "id": "rs765900247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765900247" }, { "id": "rs765900247", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765900247" }, { "id": "rs765900247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765900247" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "89637535", "evidence": [ { "id": "P16444", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16444" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "458", "site_seq": "ESIVnASK", "site_lbl": "Asn458", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 458, "end_pos": 458, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "6586092", "evidence": [ { "id": "rs147009720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147009720#frequency_tab" }, { "id": "rs147009720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147009720" }, { "id": "rs147009720", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs147009720" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreased expression and decreased binding to CD27.", "evidence": [ { "database": "UniProtKB", "id": "P32970", "url": "https://www.uniprot.org/uniprotkb/P32970" }, { "database": "PubMed", "id": "34419446", "url": "https://glygen.org/publication/PubMed/34419446" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "618", "site_seq": "N", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "618", "site_seq": "IQMLSFAGEPLPQnSSMAR", "site_lbl": "Asn618", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "618", "site_seq": "", "site_lbl": "N618", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "17", "chr_pos": "42854699", "evidence": [ { "id": "rs1346229438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1346229438" }, { "id": "rs1346229438", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1346229438#frequency_tab" }, { "id": "rs1346229438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1346229438" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 618, "end_pos": 618, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "263", "site_seq": "LDGSTnFTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "7", "chr_pos": "77196811", "evidence": [ { "id": "Q14314", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14314" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "801", "site_seq": "YGMQNSGNEISWnYTLEQYQK", "site_lbl": "Asn801", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 801, "end_pos": 801, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "801", "site_seq": "N", "site_lbl": "Asn801", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 801, "end_pos": 801, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "481", "site_seq": "IADDKYNDTFWK", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "481", "site_seq": "IADDKYnDTFWK", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "481", "site_seq": "N", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "481", "site_seq": "", "site_lbl": "N481", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "12", "chr_pos": "103942594", "evidence": [ { "id": "rs748255104", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748255104" }, { "id": "rs748255104", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748255104" }, { "id": "rs748255104", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748255104#frequency_tab" }, { "id": "rs748255104", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748255104" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTEnK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTENK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "7", "chr_pos": "106099194", "evidence": [ { "id": "rs775964331", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775964331" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "333", "site_seq": "AIGGIDWDSHPFGYnLTLQAK", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "333", "site_seq": "AIGGIDWDSHPFGYNLTLQAK", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "4", "chr_pos": "186708831", "evidence": [ { "id": "rs2126699395", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126699395" }, { "id": "rs2126699395", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126699395" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "4", "chr_pos": "186708831", "evidence": [ { "id": "rs2126699395", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126699395" }, { "id": "rs2126699395", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126699395" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "4", "chr_pos": "186708830", "evidence": [ { "id": "rs1374100735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374100735" }, { "id": "rs1374100735", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374100735#frequency_tab" }, { "id": "rs1374100735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374100735" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "4", "chr_pos": "186708829", "evidence": [ { "id": "rs2126699375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126699375" }, { "id": "rs2126699375", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126699375" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "186708830", "evidence": [ { "id": "rs1374100735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374100735" }, { "id": "rs1374100735", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374100735#frequency_tab" }, { "id": "rs1374100735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374100735" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "186708830", "evidence": [ { "id": "rs1374100735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374100735" }, { "id": "rs1374100735", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374100735#frequency_tab" }, { "id": "rs1374100735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374100735" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "4", "chr_pos": "186708831", "evidence": [ { "id": "rs2126699395", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126699395" }, { "id": "rs2126699395", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126699395" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "69", "site_seq": "VTPACnTSLPAQR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "VTPACNTSLPAQR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "17", "chr_pos": "62664635", "evidence": [ { "id": "rs1276394239", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1276394239" }, { "id": "rs1276394239", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1276394239#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "464", "site_seq": "NNVITLnITGK", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "NNVITLNITGK", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "464", "site_seq": "", "site_lbl": "N464", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "33016797", "evidence": [ { "id": "P16278", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16278" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "925", "site_seq": "N", "site_lbl": "Asn925", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 925, "end_pos": 925, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "925", "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "site_lbl": "Asn925", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 925, "end_pos": 925, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "925", "site_seq": "VTVLGVATAPQQVLSNGVPVSNFTYSPDTK", "site_lbl": "Asn925", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 925, "end_pos": 925, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "69", "site_seq": "ALGFEnATQALGR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "17", "chr_pos": "78976002", "evidence": [ { "id": "rs770079138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770079138#frequency_tab" }, { "id": "rs770079138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770079138" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "173", "site_seq": "N", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08246-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 267, "chemical_mass": 28518.0 } ] }, { "start_pos": "173", "site_seq": "GIASVLQELnVTVVTSLCR", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08246-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 267, "chemical_mass": 28518.0 } ] }, { "start_pos": "173", "site_seq": "", "site_lbl": "N173", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "19", "chr_pos": "855714", "evidence": [ { "id": "rs1358943684", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358943684" }, { "id": "rs1358943684", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1358943684#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "19", "chr_pos": "855716", "evidence": [ { "id": "rs200393776", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393776" }, { "id": "rs200393776", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393776" }, { "id": "rs200393776", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393776#frequency_tab" }, { "id": "rs200393776", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393776" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "855715", "evidence": [ { "id": "rs748345928", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748345928" }, { "id": "rs748345928", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs748345928" }, { "id": "rs748345928", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748345928" }, { "id": "rs748345928", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748345928#frequency_tab" }, { "id": "rs748345928", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748345928" } ], "disease": [ { "disease_id": "DOID:5339", "name": "cyclic hematopoiesis", "description": "", "url": "http://disease-ontology.org/term/DOID:5339", "evidence": [ { "id": "162800", "database": "MIM", "url": "https://www.omim.org/entry/162800" }, { "id": "5339", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5339" } ] }, { "disease_id": "DOID:5339", "name": "cyclic hematopoiesis", "description": "", "url": "http://disease-ontology.org/term/DOID:5339", "evidence": [ { "id": "162800", "database": "MIM", "url": "https://www.omim.org/entry/162800" }, { "id": "5339", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5339" } ] }, { "disease_id": "DOID:5339", "name": "cyclic hematopoiesis", "description": "", "url": "http://disease-ontology.org/term/DOID:5339", "evidence": [ { "id": "162800", "database": "MIM", "url": "https://www.omim.org/entry/162800" }, { "id": "5339", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5339" } ] }, { "disease_id": "DOID:5339", "name": "cyclic hematopoiesis", "description": "", "url": "http://disease-ontology.org/term/DOID:5339", "evidence": [ { "id": "162800", "database": "MIM", "url": "https://www.omim.org/entry/162800" }, { "id": "5339", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5339" } ] }, { "disease_id": "DOID:5339", "name": "cyclic hematopoiesis", "description": "", "url": "http://disease-ontology.org/term/DOID:5339", "evidence": [ { "id": "162800", "database": "MIM", "url": "https://www.omim.org/entry/162800" }, { "id": "5339", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5339" } ] }, { "disease_id": "DOID:0050590", "name": "severe congenital neutropenia", "description": "A neutropenia characterized by a maturation arrest of granulopoiesis at the level or promyelocytes and early onset of severe bacterial infections.", "url": "http://disease-ontology.org/term/DOID:0050590", "evidence": [ { "id": "0050590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050590" } ] }, { "disease_id": "DOID:0050590", "name": "severe congenital neutropenia", "description": "A neutropenia characterized by a maturation arrest of granulopoiesis at the level or promyelocytes and early onset of severe bacterial infections.", "url": "http://disease-ontology.org/term/DOID:0050590", "evidence": [ { "id": "0050590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050590" } ] }, { "disease_id": "DOID:0050590", "name": "severe congenital neutropenia", "description": "A neutropenia characterized by a maturation arrest of granulopoiesis at the level or promyelocytes and early onset of severe bacterial infections.", "url": "http://disease-ontology.org/term/DOID:0050590", "evidence": [ { "id": "0050590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050590" } ] }, { "disease_id": "DOID:0050590", "name": "severe congenital neutropenia", "description": "A neutropenia characterized by a maturation arrest of granulopoiesis at the level or promyelocytes and early onset of severe bacterial infections.", "url": "http://disease-ontology.org/term/DOID:0050590", "evidence": [ { "id": "0050590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050590" } ] }, { "disease_id": "DOID:0050590", "name": "severe congenital neutropenia", "description": "A neutropenia characterized by a maturation arrest of granulopoiesis at the level or promyelocytes and early onset of severe bacterial infections.", "url": "http://disease-ontology.org/term/DOID:0050590", "evidence": [ { "id": "0050590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050590" } ] }, { "disease_id": "DOID:0080625", "name": "severe congenital neutropenia 1", "description": "A severe congenital neutropenia that has_material_basis_in heterozygous mutation in the neutrophil elastase gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0080625", "evidence": [ { "id": "202700", "database": "MIM", "url": "https://www.omim.org/entry/202700" }, { "id": "0080625", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080625" } ] }, { "disease_id": "DOID:0080625", "name": "severe congenital neutropenia 1", "description": "A severe congenital neutropenia that has_material_basis_in heterozygous mutation in the neutrophil elastase gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0080625", "evidence": [ { "id": "202700", "database": "MIM", "url": "https://www.omim.org/entry/202700" }, { "id": "0080625", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080625" } ] }, { "disease_id": "DOID:0080625", "name": "severe congenital neutropenia 1", "description": "A severe congenital neutropenia that has_material_basis_in heterozygous mutation in the neutrophil elastase gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0080625", "evidence": [ { "id": "202700", "database": "MIM", "url": "https://www.omim.org/entry/202700" }, { "id": "0080625", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080625" } ] }, { "disease_id": "DOID:0080625", "name": "severe congenital neutropenia 1", "description": "A severe congenital neutropenia that has_material_basis_in heterozygous mutation in the neutrophil elastase gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0080625", "evidence": [ { "id": "202700", "database": "MIM", "url": "https://www.omim.org/entry/202700" }, { "id": "0080625", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080625" } ] }, { "disease_id": "DOID:0080625", "name": "severe congenital neutropenia 1", "description": "A severe congenital neutropenia that has_material_basis_in heterozygous mutation in the neutrophil elastase gene on chromosome 19p13.", "url": "http://disease-ontology.org/term/DOID:0080625", "evidence": [ { "id": "202700", "database": "MIM", "url": "https://www.omim.org/entry/202700" }, { "id": "0080625", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080625" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08246-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 267, "chemical_mass": 28518.0 } ] }, { "start_pos": "439", "site_seq": "TQnFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "TQNFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "", "site_lbl": "N439", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "NC_000019.10", "chr_pos": "44818862", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILnETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "N", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILNETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "N520", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "162016776", "evidence": [ { "id": "rs199543870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199543870" }, { "id": "rs199543870", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199543870" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "162016777", "evidence": [ { "id": "P27487", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27487" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not inhibit dipeptidyl peptidase activity, interaction with ADA and homodimer formation.", "evidence": [ { "database": "UniProtKB", "id": "P27487", "url": "https://www.uniprot.org/uniprotkb/P27487" }, { "database": "PubMed", "id": "14691230", "url": "https://glygen.org/publication/PubMed/14691230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] } ], "record_id": "G29299MO" }