{ "glytoucan_ac": "G29184RN", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 2037.74, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 3, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "192", "site_seq": "NnQSLFSK", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95427-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "GPI ethanolamine phosphate transferase 1", "gene_name": "PIGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 931, "chemical_mass": 105810.0 } ] }, { "start_pos": "192", "site_seq": "NNQSLFSK", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95427-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "GPI ethanolamine phosphate transferase 1", "gene_name": "PIGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 931, "chemical_mass": 105810.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95427-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "GPI ethanolamine phosphate transferase 1", "gene_name": "PIGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 931, "chemical_mass": 105810.0 } ] }, { "start_pos": "192", "site_seq": "", "site_lbl": "N192", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "18", "chr_pos": "62148313", "evidence": [ { "id": "O95427", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95427" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95427-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "GPI ethanolamine phosphate transferase 1", "gene_name": "PIGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 931, "chemical_mass": 105810.0 } ] }, { "start_pos": "76", "site_seq": "KALAAAGYDVEKNNSR", "site_lbl": "Asn76", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10412-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Histone H1.4", "gene_name": "H1-4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 219, "chemical_mass": 21865.0 } ] }, { "start_pos": "76", "site_seq": "", "site_lbl": "N76", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 2 out of 6 filters: num. of cancers (3); n-glyco-sequon-loss (NNS->SNS).", "chr_id": "6", "chr_pos": "26156617", "evidence": [ { "id": "P10412", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P10412" }, { "id": "rs771489271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771489271" }, { "id": "rs771489271", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771489271" } ], "disease": [ { "disease_id": "DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas.", "url": "http://disease-ontology.org/term/DOID:1793", "evidence": [ { "id": "1793", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1793" } ] }, { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] }, { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "6", "chr_pos": "26156618", "evidence": [ { "id": "rs563531168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563531168" }, { "id": "rs563531168", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563531168" }, { "id": "rs563531168", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563531168" }, { "id": "rs563531168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs563531168#frequency_tab" }, { "id": "rs563531168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs563531168" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10412-1", "start_pos": 76, "end_pos": 76, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Histone H1.4", "gene_name": "H1-4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 219, "chemical_mass": 21865.0 } ] }, { "start_pos": "515", "site_seq": "GENVSTTEVEGTLSR", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P1M0-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Long-chain fatty acid transport protein 4", "gene_name": "SLC27A4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 643, "chemical_mass": 72064.0 } ] }, { "start_pos": "120", "site_seq": "VEDEGnYTCLFVTFPQGSR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15151-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Poliovirus receptor", "gene_name": "PVR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 45303.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15151-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Poliovirus receptor", "gene_name": "PVR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 45303.0 } ] }, { "start_pos": "120", "site_seq": "VEDEGNYTCLFVTFPQGSR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15151-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Poliovirus receptor", "gene_name": "PVR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 45303.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "19", "chr_pos": "44647503", "evidence": [ { "id": "rs769127402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769127402" }, { "id": "rs769127402", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769127402" }, { "id": "rs769127402", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769127402#frequency_tab" }, { "id": "rs769127402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769127402" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "19", "chr_pos": "44647502", "evidence": [ { "id": "rs747664542", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747664542" }, { "id": "rs747664542", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747664542" }, { "id": "rs747664542", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747664542" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15151-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Poliovirus receptor", "gene_name": "PVR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 45303.0 } ] }, { "start_pos": "210", "site_seq": "NHTLALTDTGSVFAFGENK", "site_lbl": "Asn210", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BK67-1", "start_pos": 210, "end_pos": 210, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein RCC2", "gene_name": "Rcc2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 520, "chemical_mass": 55983.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "158", "site_seq": "LNFGVGNNSEAVISQFYHSPADNK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "9", "chr_pos": "42010495", "evidence": [ { "id": "rs3399490523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3399490523" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O88307-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sortilin-related receptor", "gene_name": "Sorl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2215, "chemical_mass": 247086.0 } ] }, { "start_pos": "398", "site_seq": "FQIYSNQSALESLALIPLQAPLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55065-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "Pltp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 493, "chemical_mass": 54453.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55065-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "Pltp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 493, "chemical_mass": 54453.0 } ] }, { "start_pos": "98", "site_seq": "NASVPNLR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CWE0-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mitochondrial fission regulator 1-like", "gene_name": "Mtfr1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 289, "chemical_mass": 31726.0 } ] }, { "start_pos": "366", "site_seq": "QLSNSSLASR", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WU02-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasopressin V1b receptor", "gene_name": "Avpr1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 421, "chemical_mass": 46539.0 } ] }, { "start_pos": "474", "site_seq": "N", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "474", "site_seq": "QCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDK", "site_lbl": "Asn474", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 474, "end_pos": 474, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "1554", "site_seq": "NYSGRDTLDECGLRYLLAMR", "site_lbl": "Asn1554", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BPN8-1", "start_pos": 1554, "end_pos": 1554, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "DmX-like protein 2", "gene_name": "Dmxl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3032, "chemical_mass": 338209.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "675", "site_seq": "ISDnNTEFLLNFNEFIDRK", "site_lbl": "Asn675", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 675, "end_pos": 675, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "675", "site_seq": "N", "site_lbl": "Asn675", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 675, "end_pos": 675, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "675", "site_seq": "ISDNNTEFLLNFNEFIDRK", "site_lbl": "Asn675", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 675, "end_pos": 675, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "781", "site_seq": "SLDNDNYVFTAPYFnK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "781", "site_seq": "SLDNDNYVFTAPYFNK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "675", "site_seq": "", "site_lbl": "N675", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "7", "chr_pos": "81974520", "evidence": [ { "id": "rs2484672946", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2484672946" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 675, "end_pos": 675, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "7", "chr_pos": "81969882", "evidence": [ { "id": "rs762644552", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762644552" }, { "id": "rs762644552", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762644552" }, { "id": "rs762644552", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762644552" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P54289-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-1", "gene_name": "CACNA2D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1103, "chemical_mass": 124568.0 } ] }, { "start_pos": "142", "site_seq": "SnDTAASEYK", "site_lbl": "Asn142", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12913-1", "start_pos": 142, "end_pos": 142, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "PTPRJ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1337, "chemical_mass": 145941.0 } ] }, { "start_pos": "142", "site_seq": "SNDTAASEYK", "site_lbl": "Asn142", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12913-1", "start_pos": 142, "end_pos": 142, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "PTPRJ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1337, "chemical_mass": 145941.0 } ] }, { "start_pos": "142", "site_seq": "N", "site_lbl": "Asn142", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12913-1", "start_pos": 142, "end_pos": 142, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "PTPRJ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1337, "chemical_mass": 145941.0 } ] }, { "start_pos": "142", "site_seq": "", "site_lbl": "N142", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "11", "chr_pos": "48121075", "evidence": [ { "id": "rs773616848", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773616848" }, { "id": "rs773616848", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773616848" }, { "id": "rs773616848", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773616848" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "11", "chr_pos": "48121074", "evidence": [ { "id": "rs1191890865", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1191890865" }, { "id": "rs1191890865", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1191890865#frequency_tab" }, { "id": "rs1191890865", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1191890865" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12913-1", "start_pos": 142, "end_pos": 142, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "PTPRJ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1337, "chemical_mass": 145941.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "31948926", "evidence": [ { "id": "rs757587163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757587163" }, { "id": "rs757587163", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs757587163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "347", "site_seq": "DnFTLIPEGTNGTEER", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16555-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dihydropyrimidinase-related protein 2", "gene_name": "DPYSL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 62294.0 } ] }, { "start_pos": "347", "site_seq": "", "site_lbl": "N347", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "8", "chr_pos": "26644021", "evidence": [ { "id": "rs1803109153", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803109153" }, { "id": "rs1803109153", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1803109153" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16555-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dihydropyrimidinase-related protein 2", "gene_name": "DPYSL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 62294.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "102", "site_seq": "AMEPCLDGWVYnSTK", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCC7-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 59856.0 } ] }, { "start_pos": "102", "site_seq": "N", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCC7-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 59856.0 } ] }, { "start_pos": "102", "site_seq": "", "site_lbl": "N102", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "63014654", "evidence": [ { "id": "Q8TCC7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8TCC7" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCC7-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 59856.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSRR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQNMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "22", "chr_pos": "50287693", "evidence": [ { "id": "rs920837059", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs920837059" }, { "id": "rs920837059", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs920837059" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "110", "site_seq": "AVIFFGDQEHPnVTEFAVGPLPGPCYMR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "7", "chr_pos": "150856800", "evidence": [ { "id": "P19801", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19801" }, { "id": "rs373164869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" }, { "id": "rs373164869", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373164869#frequency_tab" }, { "id": "rs373164869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373164869" }, { "id": "rs373164869", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "54", "site_seq": "nVSCLWCNTNK", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "54", "site_seq": "N", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "54", "site_seq": "", "site_lbl": "N54", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "21", "chr_pos": "44865401", "evidence": [ { "id": "rs372701822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372701822" }, { "id": "rs372701822", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372701822" }, { "id": "rs372701822", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372701822#frequency_tab" }, { "id": "rs372701822", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372701822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53801-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pituitary tumor-transforming gene 1 protein-interacting protein", "gene_name": "PTTG1IP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20324.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILnETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "N", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILNETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "N520", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "162016776", "evidence": [ { "id": "rs199543870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199543870" }, { "id": "rs199543870", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199543870" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "162016777", "evidence": [ { "id": "P27487", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27487" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not inhibit dipeptidyl peptidase activity, interaction with ADA and homodimer formation.", "evidence": [ { "database": "UniProtKB", "id": "P27487", "url": "https://www.uniprot.org/uniprotkb/P27487" }, { "database": "PubMed", "id": "14691230", "url": "https://glygen.org/publication/PubMed/14691230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWnTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "N", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "DYGSQEDFTQVWNTTMK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "N141", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "1", "chr_pos": "46184868", "evidence": [ { "id": "rs1657392644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657392644" }, { "id": "rs1657392644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657392644#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "1", "chr_pos": "46184867", "evidence": [ { "id": "rs765158447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765158447" }, { "id": "rs765158447", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765158447#frequency_tab" }, { "id": "rs765158447", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765158447" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "141", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "", "site_lbl": "N346", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "7", "chr_pos": "29064162", "evidence": [ { "id": "rs774430947", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774430947" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "7", "chr_pos": "29064161", "evidence": [ { "id": "rs535663848", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs535663848" }, { "id": "rs535663848", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs535663848" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "945", "site_seq": "ENQnHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "SLLWTETFMNKENQnHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "N", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "ENQNHSYSLK", "site_lbl": "Asn945", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "945", "site_seq": "", "site_lbl": "N945", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->SHS); n-glyco-sequon-gain (NQN->NQS).", "chr_id": "2", "chr_pos": "186675833", "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P06756" }, { "id": "rs200733186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200733186" }, { "id": "rs200733186", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200733186" }, { "id": "rs200733186", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200733186" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 945, "end_pos": 945, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "261", "site_seq": "GDDLYTnVTISLVESLVGFEMDITHLDGHK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS4-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DnaJ homolog subfamily B member 11", "gene_name": "DNAJB11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 40514.0 } ] }, { "start_pos": "261", "site_seq": "RGDDLYTNVTISLVESLVGFEMDITHLDGHK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS4-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DnaJ homolog subfamily B member 11", "gene_name": "DNAJB11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 40514.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS4-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DnaJ homolog subfamily B member 11", "gene_name": "DNAJB11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 40514.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "186583906", "evidence": [ { "id": "rs1202180338", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1202180338" }, { "id": "rs1202180338", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1202180338" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBS4-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DnaJ homolog subfamily B member 11", "gene_name": "DNAJB11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 358, "chemical_mass": 40514.0 } ] }, { "start_pos": "79", "site_seq": "nATSYPPMCTQDPK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23141-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Liver carboxylesterase 1", "gene_name": "CES1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62521.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23141-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Liver carboxylesterase 1", "gene_name": "CES1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62521.0 } ] }, { "start_pos": "79", "site_seq": "", "site_lbl": "N79", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "16", "chr_pos": "55828789", "evidence": [ { "id": "rs773058212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773058212" }, { "id": "rs773058212", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773058212" }, { "id": "rs773058212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773058212" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23141-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Liver carboxylesterase 1", "gene_name": "CES1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62521.0 } ] }, { "start_pos": "79", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Abolishes glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P23141", "url": "https://www.uniprot.org/uniprotkb/P23141" }, { "database": "PubMed", "id": "12022871", "url": "https://glygen.org/publication/PubMed/12022871" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23141-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Liver carboxylesterase 1", "gene_name": "CES1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 567, "chemical_mass": 62521.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "417", "site_seq": "NYIVPILWLnETGTIGDEK", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "RNYIVPILWLnETGTIGDEK", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "N", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "", "site_lbl": "N417", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "7", "chr_pos": "80673405", "evidence": [ { "id": "rs947550070", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs947550070" }, { "id": "rs947550070", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs947550070" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "7", "chr_pos": "80673363_80673405", "evidence": [ { "id": "rs774967939", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774967939" }, { "id": "rs774967939", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774967939" }, { "id": "rs774967939", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774967939" }, { "id": "rs773534827", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773534827" }, { "id": "rs773534827", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773534827" }, { "id": "rs773534827", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773534827" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "93", "site_seq": "VQAVLTSDSPALVGSnITFAVNLIFPR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "714", "site_seq": "N", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "714", "site_seq": "FDVNQLQnTTIK", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "714", "site_seq": "KFDVNQLQnTTIK", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "714", "site_seq": "KFDVNQLQNTTIK", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "714", "site_seq": "", "site_lbl": "N714", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "17", "chr_pos": "63486640", "evidence": [ { "id": "rs778987310", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778987310" }, { "id": "rs778987310", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778987310" }, { "id": "rs778987310", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778987310#frequency_tab" }, { "id": "rs778987310", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778987310" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "150", "site_seq": "HVGPGVLSMANAGPNTnGSQFFICTIK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30405-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase F, mitochondrial", "gene_name": "PPIF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 22040.0 } ] }, { "start_pos": "150", "site_seq": "HVGPGVLSMANAGPNTNGSQFFICTIK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30405-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase F, mitochondrial", "gene_name": "PPIF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 22040.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS); n-glyco-sequon-gain (NTN->NTS).", "chr_id": "10", "chr_pos": "79352353", "evidence": [ { "id": "rs774159432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774159432" }, { "id": "rs774159432", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774159432" }, { "id": "rs774159432", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774159432#frequency_tab" }, { "id": "rs774159432", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774159432" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "10", "chr_pos": "79352353", "evidence": [ { "id": "rs774159432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774159432" }, { "id": "rs774159432", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774159432" }, { "id": "rs774159432", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774159432#frequency_tab" }, { "id": "rs774159432", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774159432" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "10", "chr_pos": "79352354", "evidence": [ { "id": "rs61851434", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61851434" }, { "id": "rs61851434", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61851434" }, { "id": "rs61851434", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61851434" }, { "id": "rs61851434", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61851434#frequency_tab" }, { "id": "rs61851434", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61851434" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30405-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase F, mitochondrial", "gene_name": "PPIF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 22040.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "53", "site_seq": "DVnCSVMGPQEK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "DVNCSVMGPQEKK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "88337514", "evidence": [ { "id": "rs1857833438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1857833438" }, { "id": "rs1857833438", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1857833438#frequency_tab" }, { "id": "rs1857833438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1857833438" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "11", "chr_pos": "88337515", "evidence": [ { "id": "rs766806566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766806566" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "516", "site_seq": "GEDGPAGnGTEGFPGFPGYPGNR", "site_lbl": "Asn516", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 516, "end_pos": 516, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "516", "site_seq": "N", "site_lbl": "Asn516", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 516, "end_pos": 516, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "516", "site_seq": "", "site_lbl": "N516", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "21", "chr_pos": "45998143", "evidence": [ { "id": "rs1420089710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420089710" }, { "id": "rs1420089710", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420089710" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 516, "end_pos": 516, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "18175095", "evidence": [ { "id": "rs1190449225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1190449225" }, { "id": "rs1190449225", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1190449225#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "103", "site_seq": "nESEYTVK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "103", "site_seq": "NESEYTVK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "103", "site_seq": "VVVVDGKnESEYTVK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->KES).", "chr_id": "2", "chr_pos": "9536750", "evidence": [ { "id": "rs761183996", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761183996" }, { "id": "rs761183996", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761183996" }, { "id": "rs761183996", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761183996#frequency_tab" }, { "id": "rs761183996", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761183996" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "2", "chr_pos": "9536751", "evidence": [ { "id": "rs1418977653", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418977653" }, { "id": "rs1418977653", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418977653#frequency_tab" }, { "id": "rs1418977653", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418977653" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "216", "site_seq": "N", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYnVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYNVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "", "site_lbl": "N216", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "1", "chr_pos": "167546113", "evidence": [ { "id": "rs144088168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144088168" }, { "id": "rs144088168", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144088168#frequency_tab" }, { "id": "rs144088168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144088168" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "1", "chr_pos": "167546112", "evidence": [ { "id": "rs748757226", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748757226#frequency_tab" }, { "id": "rs748757226", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748757226" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "1", "chr_pos": "167546114", "evidence": [ { "id": "rs1399559749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399559749" }, { "id": "rs1399559749", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1399559749#frequency_tab" }, { "id": "rs1399559749", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399559749" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTEnK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "GQTEIQVNCPPAVTENK", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "7", "chr_pos": "106099194", "evidence": [ { "id": "rs775964331", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775964331" }, { "id": "rs775964331", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775964331" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16563-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Synaptophysin-like protein 1", "gene_name": "SYPL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 259, "chemical_mass": 28565.0 } ] }, { "start_pos": "625", "site_seq": "AQNDLFSTSGNEWVLLNLnVTGYYR", "site_lbl": "Asn625", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "625", "site_seq": "N", "site_lbl": "Asn625", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "625", "site_seq": "", "site_lbl": "N625", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT); n-glyco-sequon-gain (NLN->NLS).", "chr_id": "15", "chr_pos": "89799505", "evidence": [ { "id": "rs1567158374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567158374" }, { "id": "rs1567158374", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567158374" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "15", "chr_pos": "89799506", "evidence": [ { "id": "rs1894541807", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1894541807" }, { "id": "rs1894541807", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1894541807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "70", "site_seq": "DGYMVVnVSSLSLNEPEDK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5VW38-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein GPR107", "gene_name": "GPR107", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 600, "chemical_mass": 66990.0 } ] }, { "start_pos": "70", "site_seq": "DGYMVVNVSSLSLNEPEDK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5VW38-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein GPR107", "gene_name": "GPR107", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 600, "chemical_mass": 66990.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5VW38-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein GPR107", "gene_name": "GPR107", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 600, "chemical_mass": 66990.0 } ] } ], "record_id": "G29184RN" }