{ "glytoucan_ac": "G25541YH", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/compositions/1084" }, { "database": "PubMed", "id": "24698316", "url": "https://glygen.org/publication/PubMed/24698316" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/compositions/1084" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 3100.13, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 3, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 7, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "293", "site_seq": "IFIFnQTGIEAK", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96J42-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1801", "url": "https://glyconnect.expasy.org/browser/proteins/1801" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "TXNDC15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 360, "chemical_mass": 39885.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96J42-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1801", "url": "https://glyconnect.expasy.org/browser/proteins/1801" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "TXNDC15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 360, "chemical_mass": 39885.0 } ] }, { "start_pos": "293", "site_seq": "IFIFNQTGIEAK", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96J42-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1801", "url": "https://glyconnect.expasy.org/browser/proteins/1801" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "TXNDC15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 360, "chemical_mass": 39885.0 } ] }, { "start_pos": "293", "site_seq": "", "site_lbl": "N293", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "5", "chr_pos": "134896417", "evidence": [ { "id": "rs1445273179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1445273179" }, { "id": "rs1445273179", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1445273179#frequency_tab" }, { "id": "rs1445273179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1445273179" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96J42-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1801", "url": "https://glyconnect.expasy.org/browser/proteins/1801" } ], "protein_name": "Thioredoxin domain-containing protein 15", "gene_name": "TXNDC15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 360, "chemical_mass": 39885.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09172-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1933", "url": "https://glyconnect.expasy.org/browser/proteins/1933" } ], "protein_name": "Dopamine beta-hydroxylase", "gene_name": "DBH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 617, "chemical_mass": 69065.0 } ] }, { "start_pos": "184", "site_seq": "SLEAInGSGLQMGLQR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09172-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1933", "url": "https://glyconnect.expasy.org/browser/proteins/1933" } ], "protein_name": "Dopamine beta-hydroxylase", "gene_name": "DBH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 617, "chemical_mass": 69065.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->TGS).", "chr_id": "9", "chr_pos": "133642271", "evidence": [ { "id": "rs1390277904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1390277904" }, { "id": "rs1390277904", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1390277904" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P09172-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1933", "url": "https://glyconnect.expasy.org/browser/proteins/1933" } ], "protein_name": "Dopamine beta-hydroxylase", "gene_name": "DBH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 617, "chemical_mass": 69065.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "20", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "20", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "20", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "20", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "355", "site_seq": "NLRnMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "N", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "nMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "NMSNQLGLLAVNQR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "355", "site_seq": "", "site_lbl": "N355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "17", "chr_pos": "58277968", "evidence": [ { "id": "rs1970459950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1970459950" }, { "id": "rs1970459950", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1970459950#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05164-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "428", "url": "https://glyconnect.expasy.org/browser/proteins/428" } ], "protein_name": "Myeloperoxidase", "gene_name": "MPO", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 745, "chemical_mass": 83869.0 } ] }, { "start_pos": "118", "site_seq": "QGGVnATQVLIQHLR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "12", "chr_pos": "56361853", "evidence": [ { "id": "rs750714330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750714330" }, { "id": "rs750714330", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750714330" }, { "id": "rs750714330", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750714330#frequency_tab" }, { "id": "rs750714330", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750714330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "209", "site_seq": "N", "site_lbl": "Asn209", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "209", "site_seq": "NVSYNISSTVR", "site_lbl": "Asn209", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 209, "end_pos": 209, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "344", "site_seq": "LEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1Q9-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2826", "url": "https://glyconnect.expasy.org/browser/proteins/2826" } ], "protein_name": "V-type proton ATPase subunit S1", "gene_name": "Atp6ap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 463, "chemical_mass": 51008.0 } ] }, { "start_pos": "181", "site_seq": "N", "site_lbl": "Asn181", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54901-1", "start_pos": 181, "end_pos": 181, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2198", "url": "https://glyconnect.expasy.org/browser/proteins/2198" } ], "protein_name": "OX-2 membrane glycoprotein", "gene_name": "Cd200", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31256.0 } ] }, { "start_pos": "181", "site_seq": "GTGTGIENSTESHFHSNGTTSVTSILR", "site_lbl": "Asn181", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O54901-1", "start_pos": 181, "end_pos": 181, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2198", "url": "https://glyconnect.expasy.org/browser/proteins/2198" } ], "protein_name": "OX-2 membrane glycoprotein", "gene_name": "Cd200", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 278, "chemical_mass": 31256.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] }, { "start_pos": "406", "site_seq": "MVVTLTELPSGNDTSGLENK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23819-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2342", "url": "https://glyconnect.expasy.org/browser/proteins/2342" } ], "protein_name": "Glutamate receptor 2", "gene_name": "Gria2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 883, "chemical_mass": 98662.0 } ] } ], "record_id": "G25541YH" }