{ "glytoucan_ac": "G25079LO", "species": [ { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G10562QT", "url": "https://www.glygen.org/glycan/G10562QT" }, { "database": "Subsumption", "id": "G24292VT", "url": "https://www.glygen.org/glycan/G24292VT" }, { "database": "Subsumption", "id": "G33279YE", "url": "https://www.glygen.org/glycan/G33279YE" }, { "database": "Subsumption", "id": "G37783EW", "url": "https://www.glygen.org/glycan/G37783EW" }, { "database": "Subsumption", "id": "G39029JR", "url": "https://www.glygen.org/glycan/G39029JR" }, { "database": "Subsumption", "id": "G44996SV", "url": "https://www.glygen.org/glycan/G44996SV" }, { "database": "Subsumption", "id": "G48584BU", "url": "https://www.glygen.org/glycan/G48584BU" }, { "database": "Subsumption", "id": "G48837AB", "url": "https://www.glygen.org/glycan/G48837AB" }, { "database": "Subsumption", "id": "G54411RI", "url": "https://www.glygen.org/glycan/G54411RI" }, { "database": "Subsumption", "id": "G70812GK", "url": "https://www.glygen.org/glycan/G70812GK" }, { "database": "Subsumption", "id": "G72698LT", "url": "https://www.glygen.org/glycan/G72698LT" }, { "database": "Subsumption", "id": "G84423SZ", "url": "https://www.glygen.org/glycan/G84423SZ" }, { "database": "Subsumption", "id": "G91513OX", "url": "https://www.glygen.org/glycan/G91513OX" }, { "database": "Subsumption", "id": "G94027HD", "url": "https://www.glygen.org/glycan/G94027HD" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G48584BU", "url": "https://www.glygen.org/glycan/G48584BU" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" }, { "database": "GlyCosmos", "id": "G25079LO", "url": "https://glycosmos.org/glycans/show/G25079LO" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G48584BU", "url": "https://www.glygen.org/glycan/G48584BU" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G48584BU", "url": "https://www.glygen.org/glycan/G48584BU" }, { "database": "Subsumption", "id": "G19370RO", "url": "https://www.glygen.org/glycan/G19370RO" }, { "database": "Subsumption", "id": "G36171DC", "url": "https://www.glygen.org/glycan/G36171DC" }, { "database": "Subsumption", "id": "G74311PB", "url": "https://www.glygen.org/glycan/G74311PB" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G48584BU", "url": "https://www.glygen.org/glycan/G48584BU" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" }, { "taxid": 10114, "name": "Rattus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G54411RI", "url": "https://www.glygen.org/glycan/G54411RI" }, { "database": "Subsumption", "id": "G09130LO", "url": "https://www.glygen.org/glycan/G09130LO" } ], "common_name": "Rattus", "glygen_name": "Rattus", "reference_species": "Rattus [10114]" } ], "mass": 1884.7, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 4, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "63", "site_seq": "SAEFFnYTVR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "SAEFFNYTVR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101216707", "evidence": [ { "id": "rs145886391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145886391" }, { "id": "rs145886391", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145886391" }, { "id": "rs145886391", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145886391#frequency_tab" }, { "id": "rs145886391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145886391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101216708", "evidence": [ { "id": "rs1249409241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1249409241" }, { "id": "rs1249409241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1249409241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 63, "end_pos": 63, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "615", "site_seq": "N", "site_lbl": "Asn615", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 615, "end_pos": 615, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "615", "site_seq": "TAADTTGLQPILNQFTPAnISR", "site_lbl": "Asn615", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 615, "end_pos": 615, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "2528", "site_seq": "MLEAYnLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "N", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "IEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "N", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "EAGnITTDGYEILGK", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "EAGNITTDGYEILGK", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "", "site_lbl": "N2528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "6", "chr_pos": "75115897", "evidence": [ { "id": "rs2149361441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2149361441" }, { "id": "rs2149361441", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2149361441" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "6", "chr_pos": "75115898", "evidence": [ { "id": "rs1168175119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168175119" }, { "id": "rs1168175119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168175119#frequency_tab" }, { "id": "rs1168175119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1168175119" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "", "site_lbl": "N2679", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->HIT).", "chr_id": "6", "chr_pos": "75109083", "evidence": [ { "id": "Q99715", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q99715" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "6", "chr_pos": "75109082", "evidence": [ { "id": "rs1232271738", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1232271738" }, { "id": "rs1232271738", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1232271738" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "140", "site_seq": "GTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALAnMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "140", "site_seq": "RGTFTDCALANMTEQIR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 140, "end_pos": 140, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "222", "site_seq": "DInTTAQNIMFYDMGSGSTVCTIVTYQMVK", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "N", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "DINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK", "site_lbl": "Asn222", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "222", "site_seq": "", "site_lbl": "N222", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "11", "chr_pos": "119054508", "evidence": [ { "id": "rs2133605388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133605388" }, { "id": "rs2133605388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133605388" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "11", "chr_pos": "119054507", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 222, "end_pos": 222, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "", "site_lbl": "N862", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "11", "chr_pos": "119047745", "evidence": [ { "id": "rs1944168165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1944168165" }, { "id": "rs1944168165", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1944168165" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "119047744", "evidence": [ { "id": "rs534349629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534349629" }, { "id": "rs534349629", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534349629" }, { "id": "rs534349629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs534349629#frequency_tab" }, { "id": "rs2133557957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2133557957" }, { "id": "rs2133557957", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133557957" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "1178", "site_seq": "N", "site_lbl": "Asn1178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1178, "end_pos": 1178, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1178", "site_seq": "VYCnLSAAHTFEDLK", "site_lbl": "Asn1178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1178, "end_pos": 1178, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1178", "site_seq": "", "site_lbl": "N1178", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "2", "chr_pos": "1648246", "evidence": [ { "id": "Q92626", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92626" } ], "disease": [ { "disease_id": "DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary.", "url": "http://disease-ontology.org/term/DOID:2394", "evidence": [ { "id": "2394", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "2", "chr_pos": "1648247", "evidence": [ { "id": "rs770735162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770735162" }, { "id": "rs770735162", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770735162" }, { "id": "rs770735162", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770735162#frequency_tab" }, { "id": "rs770735162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770735162" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1178, "end_pos": 1178, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "997", "site_seq": "LWnSTFLEEYSK", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "N", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "LWNSTFLEEYSK", "site_lbl": "Asn997", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "997", "site_seq": "", "site_lbl": "N997", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "172491316", "evidence": [ { "id": "rs771270575", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771270575" }, { "id": "rs771270575", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771270575#frequency_tab" }, { "id": "rs771270575", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771270575" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "2", "chr_pos": "172491315", "evidence": [ { "id": "rs113510867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113510867" }, { "id": "rs113510867", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs113510867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 997, "end_pos": 997, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 130, "end_pos": 130, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "130", "site_seq": "SWEAFSNLSYYTR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 130, "end_pos": 130, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 53, "end_pos": 53, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "53", "site_seq": "TGFYGENCSTPEFLTR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 53, "end_pos": 53, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "1", "chr_pos": "186678329", "evidence": [ { "id": "rs1665817271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1665817271" }, { "id": "rs1665817271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1665817271" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 130, "end_pos": 130, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "1", "chr_pos": "186679333", "evidence": [ { "id": "P35354", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35354" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->YCS).", "chr_id": "1", "chr_pos": "186679334", "evidence": [ { "id": "rs1665835342", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1665835342" }, { "id": "rs1665835342", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1665835342#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35354-1", "start_pos": 53, "end_pos": 53, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 604, "chemical_mass": 68996.0 } ] }, { "start_pos": "1312", "site_seq": "N", "site_lbl": "Asn1312", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1312, "end_pos": 1312, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1312", "site_seq": "MnFTGGDTCHK", "site_lbl": "Asn1312", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1312, "end_pos": 1312, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1312", "site_seq": "MNFTGGDTCHK", "site_lbl": "Asn1312", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1312, "end_pos": 1312, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "46", "site_seq": "N", "site_lbl": "Asn46", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "46", "site_seq": "", "site_lbl": "N46", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "14", "chr_pos": "105856083", "evidence": [ { "id": "rs1229938382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229938382" }, { "id": "rs1229938382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1229938382#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "286", "site_seq": "YHYnGTLLDGTLFDSSYSR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "7", "chr_pos": "32980517", "evidence": [ { "id": "rs745809844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745809844" }, { "id": "rs745809844", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745809844" }, { "id": "rs745809844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745809844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95302-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP9", "gene_name": "FKBP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 63084.0 } ] }, { "start_pos": "226", "site_seq": "N", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0C0L5-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "Complement C4-B", "gene_name": "C4B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1744, "chemical_mass": 192751.0 } ] }, { "start_pos": "280", "site_seq": "KWGHnITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "WGHnITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "N", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "WGHNITEFQQR", "site_lbl": "Asn280", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "280", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "15136577", "url": "https://glygen.org/publication/PubMed/15136577" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96HE7-1", "start_pos": 280, "end_pos": 280, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G25079LO", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G25079LO" } ], "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 468, "chemical_mass": 54393.0 } ] }, { "start_pos": "575", "site_seq": "YLHTAVIVSGTMLVFGGNTHNDTSMSHGAK", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "575", "site_seq": "YLHTAVIVSGTMLVFGGNTHnDTSMSHGAK", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "575", "site_seq": "", "site_lbl": "N575", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "3563300", "evidence": [ { "id": "rs774235225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774235225" }, { "id": "rs774235225", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774235225" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "20", "chr_pos": "3563301", "evidence": [ { "id": "rs1235297648", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1235297648" }, { "id": "rs1235297648", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1235297648" }, { "id": "rs1235297648", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1235297648" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "467", "site_seq": "PTISWNVNGTASEQDQDPQR", "site_lbl": "Asn467", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "467", "site_seq": "N", "site_lbl": "Asn467", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 467, "end_pos": 467, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "69", "site_seq": "NWTASLLCSAADLPAR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCT7-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 592, "chemical_mass": 64644.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->DWT).", "chr_id": "19", "chr_pos": "2337545", "evidence": [ { "id": "rs767559763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767559763" }, { "id": "rs767559763", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767559763" }, { "id": "rs767559763", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767559763#frequency_tab" }, { "id": "rs767559763", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767559763" }, { "id": "rs1968718504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968718504" }, { "id": "rs1968718504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1968718504" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->IWT).", "chr_id": "19", "chr_pos": "2337546", "evidence": [ { "id": "rs767674879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674879#frequency_tab" }, { "id": "rs767674879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "19", "chr_pos": "2337546", "evidence": [ { "id": "rs767674879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674879#frequency_tab" }, { "id": "rs767674879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674879" }, { "id": "rs1272390374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1272390374" }, { "id": "rs1272390374", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1272390374#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->TWT).", "chr_id": "19", "chr_pos": "2337546", "evidence": [ { "id": "rs767674879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674879" }, { "id": "rs767674879", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674879#frequency_tab" }, { "id": "rs767674879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCT7-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 592, "chemical_mass": 64644.0 } ] }, { "start_pos": "841", "site_seq": "DPQGWVAGNLSAR", "site_lbl": "Asn841", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q04912-1", "start_pos": 841, "end_pos": 841, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Macrophage-stimulating protein receptor", "gene_name": "MST1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1400, "chemical_mass": 152241.0 } ] }, { "start_pos": "841", "site_seq": "N", "site_lbl": "Asn841", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q04912-1", "start_pos": 841, "end_pos": 841, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Macrophage-stimulating protein receptor", "gene_name": "MST1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1400, "chemical_mass": 152241.0 } ] }, { "start_pos": "66", "site_seq": "DSYLTLDEPMNNITTSLGQTAELHCK", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01973-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Inactive tyrosine-protein kinase transmembrane receptor ROR1", "gene_name": "ROR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 937, "chemical_mass": 104283.0 } ] }, { "start_pos": "66", "site_seq": "N", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01973-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Inactive tyrosine-protein kinase transmembrane receptor ROR1", "gene_name": "ROR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 937, "chemical_mass": 104283.0 } ] }, { "start_pos": "313", "site_seq": "VQASDGNNTSFWSEEIK", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17181-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 557, "chemical_mass": 63525.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17181-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 557, "chemical_mass": 63525.0 } ] }, { "start_pos": "286", "site_seq": "ADANPPATEYHWTTLnGSLPK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15223-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Nectin-1", "gene_name": "NECTIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 517, "chemical_mass": 57158.0 } ] }, { "start_pos": "286", "site_seq": "ADANPPATEYHWTTLNGSLPK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15223-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Nectin-1", "gene_name": "NECTIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 517, "chemical_mass": 57158.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15223-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Nectin-1", "gene_name": "NECTIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 517, "chemical_mass": 57158.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "11", "chr_pos": "119675305", "evidence": [ { "id": "Q15223", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q15223" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "11", "chr_pos": "119675304", "evidence": [ { "id": "rs771733439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771733439" }, { "id": "rs771733439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771733439" }, { "id": "rs771733439", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771733439#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15223-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Nectin-1", "gene_name": "NECTIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 517, "chemical_mass": 57158.0 } ] }, { "start_pos": "353", "site_seq": "NTSGSNQQAFLLENVPCNNASCEEAR", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TB96-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "T-cell immunomodulatory protein", "gene_name": "ITFG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 612, "chemical_mass": 68108.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TB96-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "T-cell immunomodulatory protein", "gene_name": "ITFG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 612, "chemical_mass": 68108.0 } ] }, { "start_pos": "93", "site_seq": "NKTGAAPIIDVVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P46776-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Large ribosomal subunit protein uL15", "gene_name": "RPL27A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 148, "chemical_mass": 16561.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "11", "chr_pos": "8684853", "evidence": [ { "id": "rs1450014448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450014448" }, { "id": "rs1450014448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1450014448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "11", "chr_pos": "8684852", "evidence": [ { "id": "rs562282613", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs562282613" }, { "id": "rs562282613", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs562282613" }, { "id": "rs562282613", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs562282613" }, { "id": "rs562282613", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs562282613" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P46776-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Large ribosomal subunit protein uL15", "gene_name": "RPL27A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 148, "chemical_mass": 16561.0 } ] }, { "start_pos": "342", "site_seq": "SnDTGLLGNVVNIQTGHWVGK", "site_lbl": "Asn342", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92611-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 1", "gene_name": "EDEM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73768.0 } ] }, { "start_pos": "342", "site_seq": "SNDTGLLGNVVNIQTGHWVGK", "site_lbl": "Asn342", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92611-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 1", "gene_name": "EDEM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73768.0 } ] }, { "start_pos": "342", "site_seq": "N", "site_lbl": "Asn342", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92611-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 1", "gene_name": "EDEM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73768.0 } ] }, { "start_pos": "342", "site_seq": "", "site_lbl": "N342", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "5203131", "evidence": [ { "id": "rs2055053652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2055053652" }, { "id": "rs2055053652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2055053652#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "5203132", "evidence": [ { "id": "rs778202869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778202869" }, { "id": "rs778202869", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778202869" }, { "id": "rs778202869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778202869#frequency_tab" }, { "id": "rs778202869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778202869" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92611-1", "start_pos": 342, "end_pos": 342, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ER degradation-enhancing alpha-mannosidase-like protein 1", "gene_name": "EDEM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73768.0 } ] }, { "start_pos": "583", "site_seq": "CTLQQDCTNSSQQHFWTSASEGPSR", "site_lbl": "Asn583", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4D7-1", "start_pos": 583, "end_pos": 583, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1925, "chemical_mass": 212007.0 } ] }, { "start_pos": "583", "site_seq": "N", "site_lbl": "Asn583", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4D7-1", "start_pos": 583, "end_pos": 583, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1925, "chemical_mass": 212007.0 } ] }, { "start_pos": "583", "site_seq": "", "site_lbl": "N583", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "3", "chr_pos": "129586056", "evidence": [ { "id": "rs1560076133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1560076133" }, { "id": "rs1560076133", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1560076133" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4D7-1", "start_pos": 583, "end_pos": 583, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1925, "chemical_mass": 212007.0 } ] }, { "start_pos": "3221", "site_seq": "SQHSDSGNYTCIASNMEGK", "site_lbl": "Asn3221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3221, "end_pos": 3221, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "3221", "site_seq": "N", "site_lbl": "Asn3221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3221, "end_pos": 3221, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "159", "site_seq": "N", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ULI3-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein HEG homolog 1", "gene_name": "HEG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1381, "chemical_mass": 147461.0 } ] }, { "start_pos": "159", "site_seq": "SHAASDAPENLTLLAETADAR", "site_lbl": "Asn159", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9ULI3-1", "start_pos": 159, "end_pos": 159, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein HEG homolog 1", "gene_name": "HEG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1381, "chemical_mass": 147461.0 } ] }, { "start_pos": "456", "site_seq": "ELSQWHNLTVIAAEINNPK", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N8-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Cadherin-10", "gene_name": "CDH10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 88451.0 } ] }, { "start_pos": "456", "site_seq": "N", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N8-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Cadherin-10", "gene_name": "CDH10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 88451.0 } ] }, { "start_pos": "456", "site_seq": "", "site_lbl": "N456", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "5", "chr_pos": "24505138", "evidence": [ { "id": "Q9Y6N8", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y6N8" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N8-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Cadherin-10", "gene_name": "CDH10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 788, "chemical_mass": 88451.0 } ] }, { "start_pos": "2802", "site_seq": "DCPDGSDELSTAGCAPNNTCDENAFMCHNK", "site_lbl": "Asn2802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZR2-1", "start_pos": 2802, "end_pos": 2802, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "LRP1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4599, "chemical_mass": 515498.0 } ] }, { "start_pos": "2802", "site_seq": "N", "site_lbl": "Asn2802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZR2-1", "start_pos": 2802, "end_pos": 2802, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "LRP1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4599, "chemical_mass": 515498.0 } ] }, { "start_pos": "2802", "site_seq": "", "site_lbl": "N2802", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "140506913", "evidence": [ { "id": "rs1202169171", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1202169171" }, { "id": "rs1202169171", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1202169171" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "2", "chr_pos": "140506912", "evidence": [ { "id": "rs2104907645", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2104907645" }, { "id": "rs2104907645", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2104907645" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "140506911", "evidence": [ { "id": "rs2104907637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2104907637" }, { "id": "rs2104907637", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2104907637" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "140506912", "evidence": [ { "id": "Q9NZR2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NZR2" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZR2-1", "start_pos": 2802, "end_pos": 2802, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "LRP1B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4599, "chemical_mass": 515498.0 } ] }, { "start_pos": "3422", "site_seq": "VNTTTVNIDVSDVNDNAPVFSR", "site_lbl": "Asn3422", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 3422, "end_pos": 3422, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "3422", "site_seq": "N", "site_lbl": "Asn3422", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 3422, "end_pos": 3422, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "3422", "site_seq": "", "site_lbl": "N3422", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "4", "chr_pos": "186606156", "evidence": [ { "id": "rs1244064786", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244064786" }, { "id": "rs1244064786", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244064786" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "4", "chr_pos": "186606156", "evidence": [ { "id": "rs1244064786", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244064786" }, { "id": "rs1244064786", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244064786" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "4", "chr_pos": "186606155", "evidence": [ { "id": "rs2126447977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126447977" }, { "id": "rs2126447977", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126447977" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "4", "chr_pos": "186606154", "evidence": [ { "id": "rs2126447967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126447967" }, { "id": "rs2126447967", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126447967" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "4", "chr_pos": "186606155", "evidence": [ { "id": "rs2126447977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2126447977" }, { "id": "rs2126447977", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2126447977" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "4", "chr_pos": "186606156", "evidence": [ { "id": "rs1244064786", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244064786" }, { "id": "rs1244064786", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244064786" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14517-1", "start_pos": 3422, "end_pos": 3422, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protocadherin Fat 1", "gene_name": "FAT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4588, "chemical_mass": 506273.0 } ] }, { "start_pos": "487", "site_seq": "TSECDVPEYCNGSSQFCQPDVFIQNGYPCQNNK", "site_lbl": "Asn487", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 487, "end_pos": 487, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "487", "site_seq": "N", "site_lbl": "Asn487", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 487, "end_pos": 487, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "487", "site_seq": "", "site_lbl": "N487", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "8", "chr_pos": "39055640", "evidence": [ { "id": "rs2129438797", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2129438797" }, { "id": "rs2129438797", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2129438797" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "8", "chr_pos": "39055641", "evidence": [ { "id": "rs202132858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202132858" }, { "id": "rs202132858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs202132858" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "8", "chr_pos": "39055641", "evidence": [ { "id": "Q13443", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13443" }, { "id": "rs202132858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202132858" }, { "id": "rs202132858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs202132858" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13443-1", "start_pos": 487, "end_pos": 487, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 9", "gene_name": "ADAM9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 819, "chemical_mass": 90556.0 } ] }, { "start_pos": "457", "site_seq": "ACNNSACDWDGGDCSGNSGGSR", "site_lbl": "Asn457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3T906-1", "start_pos": 457, "end_pos": 457, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunits alpha/beta", "gene_name": "GNPTAB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1256, "chemical_mass": 143622.0 } ] }, { "start_pos": "457", "site_seq": "N", "site_lbl": "Asn457", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3T906-1", "start_pos": 457, "end_pos": 457, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunits alpha/beta", "gene_name": "GNPTAB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1256, "chemical_mass": 143622.0 } ] }, { "start_pos": "196", "site_seq": "CDPSCPnGSCWGAGEENCQK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "196", "site_seq": "CDPSCPNGSCWGAGEENCQK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "7", "chr_pos": "55151320", "evidence": [ { "id": "rs1785139258", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1785139258" }, { "id": "rs1785139258", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1785139258#frequency_tab" }, { "id": "rs1785139258", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1785139258" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "7", "chr_pos": "55151321", "evidence": [ { "id": "rs766507267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766507267" }, { "id": "rs766507267", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766507267" }, { "id": "rs766507267", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766507267#frequency_tab" }, { "id": "rs766507267", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766507267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "", "site_lbl": "N227", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "8", "chr_pos": "73067456", "evidence": [ { "id": "rs773889462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773889462#frequency_tab" }, { "id": "rs773889462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773889462" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "351", "site_seq": "FLNATCDEYFTR", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H2X9-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1139, "chemical_mass": 126184.0 } ] }, { "start_pos": "351", "site_seq": "N", "site_lbl": "Asn351", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H2X9-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1139, "chemical_mass": 126184.0 } ] }, { "start_pos": "351", "site_seq": "", "site_lbl": "N351", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "20", "chr_pos": "46041457", "evidence": [ { "id": "rs2084546554", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2084546554" }, { "id": "rs2084546554", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2084546554" } ], "disease": [ { "disease_id": "DOID:0080460", "name": "developmental and epileptic encephalopathy 34", "description": "A developmental and epileptic encephalopathy characterized by infantile onset of refractory migrating focal seizures, developmental regression and severe global impairment that has_material_basis_in homozygous or compound heterozygous mutation in the SLC12A5 gene on chromosome 20q12.", "url": "http://disease-ontology.org/term/DOID:0080460", "evidence": [ { "id": "616645", "database": "MIM", "url": "https://www.omim.org/entry/616645" }, { "id": "0080460", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080460" } ] }, { "disease_id": "DOID:0080460", "name": "developmental and epileptic encephalopathy 34", "description": "A developmental and epileptic encephalopathy characterized by infantile onset of refractory migrating focal seizures, developmental regression and severe global impairment that has_material_basis_in homozygous or compound heterozygous mutation in the SLC12A5 gene on chromosome 20q12.", "url": "http://disease-ontology.org/term/DOID:0080460", "evidence": [ { "id": "616645", "database": "MIM", "url": "https://www.omim.org/entry/616645" }, { "id": "0080460", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080460" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->nullAT).", "chr_id": "20", "chr_pos": "46041454", "evidence": [ { "id": "rs1555863593", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555863593" } ], "disease": [ { "disease_id": "DOID:0080460", "name": "developmental and epileptic encephalopathy 34", "description": "A developmental and epileptic encephalopathy characterized by infantile onset of refractory migrating focal seizures, developmental regression and severe global impairment that has_material_basis_in homozygous or compound heterozygous mutation in the SLC12A5 gene on chromosome 20q12.", "url": "http://disease-ontology.org/term/DOID:0080460", "evidence": [ { "id": "616645", "database": "MIM", "url": "https://www.omim.org/entry/616645" }, { "id": "0080460", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080460" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H2X9-1", "start_pos": 351, "end_pos": 351, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1139, "chemical_mass": 126184.0 } ] }, { "start_pos": "81", "site_seq": "SGSAAPHQLPDNETDCGWAPFDK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P57057-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Glucose-6-phosphate exchanger SLC37A1", "gene_name": "SLC37A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 57648.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P57057-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Glucose-6-phosphate exchanger SLC37A1", "gene_name": "SLC37A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 57648.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "21", "chr_pos": "42534800", "evidence": [ { "id": "rs1354526500", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1354526500" }, { "id": "rs1354526500", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1354526500" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "21", "chr_pos": "42534801", "evidence": [ { "id": "rs1227911223", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1227911223" }, { "id": "rs1227911223", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1227911223" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P57057-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Glucose-6-phosphate exchanger SLC37A1", "gene_name": "SLC37A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 533, "chemical_mass": 57648.0 } ] }, { "start_pos": "333", "site_seq": "SILESVTSESNFHNYTLVSLNEEFNR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N6G5-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Chondroitin sulfate N-acetylgalactosaminyltransferase 2", "gene_name": "CSGALNACT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 62572.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N6G5-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Chondroitin sulfate N-acetylgalactosaminyltransferase 2", "gene_name": "CSGALNACT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 62572.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "10", "chr_pos": "43163883", "evidence": [ { "id": "rs753720826", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753720826" }, { "id": "rs753720826", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753720826" }, { "id": "rs753720826", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753720826" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8N6G5-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Chondroitin sulfate N-acetylgalactosaminyltransferase 2", "gene_name": "CSGALNACT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 542, "chemical_mass": 62572.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09055-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 798, "chemical_mass": 88231.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09055-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 798, "chemical_mass": 88231.0 } ] }, { "start_pos": "604", "site_seq": "EATIVGENETYPR", "site_lbl": "Asn604", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2G6-1", "start_pos": 604, "end_pos": 604, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "Sel1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88340.0 } ] }, { "start_pos": "604", "site_seq": "N", "site_lbl": "Asn604", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z2G6-1", "start_pos": 604, "end_pos": 604, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "Sel1l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 790, "chemical_mass": 88340.0 } ] }, { "start_pos": "37", "site_seq": "DTQTEAGSPFVGNPGNITGAR", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00993-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor UFO", "gene_name": "Axl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 98191.0 } ] }, { "start_pos": "37", "site_seq": "N", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00993-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor UFO", "gene_name": "Axl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 98191.0 } ] }, { "start_pos": "2361", "site_seq": "IESINQQLLPLGNISDNVDR", "site_lbl": "Asn2361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61789-1", "start_pos": 2361, "end_pos": 2361, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Laminin subunit alpha-3", "gene_name": "Lama3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3330, "chemical_mass": 366227.0 } ] }, { "start_pos": "2361", "site_seq": "N", "site_lbl": "Asn2361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61789-1", "start_pos": 2361, "end_pos": 2361, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Laminin subunit alpha-3", "gene_name": "Lama3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3330, "chemical_mass": 366227.0 } ] }, { "start_pos": "393", "site_seq": "GGLNLTAVTVTAENDHTVAFLGTSDGR", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "393", "site_seq": "N", "site_lbl": "Asn393", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RXS4-1", "start_pos": 393, "end_pos": 393, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Plexin-B2", "gene_name": "Plxnb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1842, "chemical_mass": 206230.0 } ] }, { "start_pos": "40", "site_seq": "DGSSNNSERWHHQIK", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88273-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Gremlin-2", "gene_name": "Grem2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 168, "chemical_mass": 19334.0 } ] }, { "start_pos": "40", "site_seq": "N", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88273-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Gremlin-2", "gene_name": "Grem2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 168, "chemical_mass": 19334.0 } ] }, { "start_pos": "173", "site_seq": "EANLTEDQILFFPK", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VCG4-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Complement component C8 gamma chain", "gene_name": "C8g", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 202, "chemical_mass": 22508.0 } ] }, { "start_pos": "173", "site_seq": "N", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VCG4-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Complement component C8 gamma chain", "gene_name": "C8g", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 202, "chemical_mass": 22508.0 } ] }, { "start_pos": "88", "site_seq": "NSSQLAFLLYNDQPPK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56542-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Deoxyribonuclease-2-alpha", "gene_name": "Dnase2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 353, "chemical_mass": 38811.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56542-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Deoxyribonuclease-2-alpha", "gene_name": "Dnase2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 353, "chemical_mass": 38811.0 } ] }, { "start_pos": "252", "site_seq": "TLYEVQVPENSSVDSLVIK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V48-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin-betaU", "gene_name": "Pcdhb21", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 774, "chemical_mass": 85231.0 } ] }, { "start_pos": "2941", "site_seq": "DLAGHNDTAIIGIYILR", "site_lbl": "Asn2941", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PF4-1", "start_pos": 2941, "end_pos": 2941, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-23", "gene_name": "Cdh23", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3354, "chemical_mass": 369623.0 } ] }, { "start_pos": "2941", "site_seq": "N", "site_lbl": "Asn2941", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99PF4-1", "start_pos": 2941, "end_pos": 2941, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-23", "gene_name": "Cdh23", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3354, "chemical_mass": 369623.0 } ] }, { "start_pos": "120", "site_seq": "SMNELDLNYSIDAVR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K449-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 9", "gene_name": "Abca9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1623, "chemical_mass": 183114.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K449-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 9", "gene_name": "Abca9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1623, "chemical_mass": 183114.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->HYS).", "chr_id": "11", "chr_pos": "110051337", "evidence": [ { "id": "rs3389148436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389148436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8K449-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 9", "gene_name": "Abca9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1623, "chemical_mass": 183114.0 } ] }, { "start_pos": "117", "site_seq": "LVSYPVGSNVSFECEQDFTLR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21180-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Complement C2", "gene_name": "C2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 84741.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21180-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Complement C2", "gene_name": "C2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 760, "chemical_mass": 84741.0 } ] }, { "start_pos": "699", "site_seq": "PSGTCQANNETILCELGNPFK", "site_lbl": "Asn699", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62470-1", "start_pos": 699, "end_pos": 699, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Integrin alpha-3", "gene_name": "Itga3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1053, "chemical_mass": 116745.0 } ] }, { "start_pos": "699", "site_seq": "N", "site_lbl": "Asn699", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62470-1", "start_pos": 699, "end_pos": 699, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Integrin alpha-3", "gene_name": "Itga3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1053, "chemical_mass": 116745.0 } ] }, { "start_pos": "371", "site_seq": "SQNDTVTPDVWYTSKPEK", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99KR8-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Plasma alpha-L-fucosidase", "gene_name": "Fuca2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 461, "chemical_mass": 53645.0 } ] }, { "start_pos": "371", "site_seq": "N", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99KR8-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Plasma alpha-L-fucosidase", "gene_name": "Fuca2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 461, "chemical_mass": 53645.0 } ] }, { "start_pos": "371", "site_seq": "", "site_lbl": "N371", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "10", "chr_pos": "13383146", "evidence": [ { "id": "rs3389091408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389091408" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99KR8-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Plasma alpha-L-fucosidase", "gene_name": "Fuca2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 461, "chemical_mass": 53645.0 } ] }, { "start_pos": "65", "site_seq": "GNCIQANYSLMENGNIEVLNK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51910-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Apolipoprotein D", "gene_name": "Apod", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 189, "chemical_mass": 21530.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51910-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Apolipoprotein D", "gene_name": "Apod", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 189, "chemical_mass": 21530.0 } ] }, { "start_pos": "653", "site_seq": "TVPSSVSGVTVNNSGR", "site_lbl": "Asn653", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RU80-1", "start_pos": 653, "end_pos": 653, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase beta", "gene_name": "Ptprb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1998, "chemical_mass": 224495.0 } ] }, { "start_pos": "653", "site_seq": "N", "site_lbl": "Asn653", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B2RU80-1", "start_pos": 653, "end_pos": 653, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase beta", "gene_name": "Ptprb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1998, "chemical_mass": 224495.0 } ] }, { "start_pos": "653", "site_seq": "", "site_lbl": "N653", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->TNS).", "chr_id": "10", "chr_pos": "116167144", "evidence": [ { "id": "rs3389093507", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389093507" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "B2RU80-1", "start_pos": 653, "end_pos": 653, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase beta", "gene_name": "Ptprb", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1998, "chemical_mass": 224495.0 } ] }, { "start_pos": "347", "site_seq": "NCTDGLCVLNQR", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K1S3-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Netrin receptor UNC5B", "gene_name": "Unc5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 945, "chemical_mass": 103739.0 } ] }, { "start_pos": "347", "site_seq": "N", "site_lbl": "Asn347", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K1S3-1", "start_pos": 347, "end_pos": 347, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Netrin receptor UNC5B", "gene_name": "Unc5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 945, "chemical_mass": 103739.0 } ] }, { "start_pos": "146", "site_seq": "NVTEIDILVK", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WR6-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glycoprotein integral membrane protein 1", "gene_name": "Ginm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 327, "chemical_mass": 36079.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WR6-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glycoprotein integral membrane protein 1", "gene_name": "Ginm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 327, "chemical_mass": 36079.0 } ] }, { "start_pos": "959", "site_seq": "GSYEIIAANGEDTDVDKLTNSPQNQNITVPR", "site_lbl": "Asn959", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88783-1", "start_pos": 959, "end_pos": 959, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2183, "chemical_mass": 247230.0 } ] }, { "start_pos": "959", "site_seq": "N", "site_lbl": "Asn959", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88783-1", "start_pos": 959, "end_pos": 959, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2183, "chemical_mass": 247230.0 } ] }, { "start_pos": "521", "site_seq": "N", "site_lbl": "Asn521", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35918-1", "start_pos": 521, "end_pos": 521, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 2", "gene_name": "Kdr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1345, "chemical_mass": 150462.0 } ] }, { "start_pos": "521", "site_seq": "TVSTLVIQAANVSALYK", "site_lbl": "Asn521", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35918-1", "start_pos": 521, "end_pos": 521, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 2", "gene_name": "Kdr", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1345, "chemical_mass": 150462.0 } ] }, { "start_pos": "1743", "site_seq": "VTFASGMEINLSSEPHILAGAVNPTLGK", "site_lbl": "Asn1743", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS4-1", "start_pos": 1743, "end_pos": 1743, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Teneurin-1", "gene_name": "Tenm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2731, "chemical_mass": 305795.0 } ] }, { "start_pos": "1743", "site_seq": "N", "site_lbl": "Asn1743", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS4-1", "start_pos": 1743, "end_pos": 1743, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Teneurin-1", "gene_name": "Tenm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2731, "chemical_mass": 305795.0 } ] }, { "start_pos": "1476", "site_seq": "FSFYGNVSPR", "site_lbl": "Asn1476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80TE4-1", "start_pos": 1476, "end_pos": 1476, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Signal-induced proliferation-associated 1-like protein 2", "gene_name": "Sipa1l2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1722, "chemical_mass": 189413.0 } ] }, { "start_pos": "534", "site_seq": "GNSSLYPVVSPSLQQLVIEK", "site_lbl": "Asn534", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A0A0N4SUJ3-1", "start_pos": 534, "end_pos": 534, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "N-acetylated alpha-linked acidic dipeptidase-like 2", "gene_name": "Naaladl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 795, "chemical_mass": 88517.0 } ] }, { "start_pos": "534", "site_seq": "", "site_lbl": "N534", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "3", "chr_pos": "24225828", "evidence": [ { "id": "rs3392838335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3392838335" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A0A0N4SUJ3-1", "start_pos": 534, "end_pos": 534, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "N-acetylated alpha-linked acidic dipeptidase-like 2", "gene_name": "Naaladl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 795, "chemical_mass": 88517.0 } ] }, { "start_pos": "156", "site_seq": "NWTTAASPSAAFAAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "D3Z2R5-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Selenoprotein N", "gene_name": "Selenon", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 62492.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "D3Z2R5-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Selenoprotein N", "gene_name": "Selenon", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 62492.0 } ] }, { "start_pos": "503", "site_seq": "KVFGQWVSSSTLNMSEAGK", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00342-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "Flt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1000, "chemical_mass": 113496.0 } ] }, { "start_pos": "503", "site_seq": "N", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00342-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "Flt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1000, "chemical_mass": 113496.0 } ] }, { "start_pos": "141", "site_seq": "EVTEGGVVTVNCSLQEEKPPIFFK", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08481-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "Pecam1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81263.0 } ] }, { "start_pos": "141", "site_seq": "N", "site_lbl": "Asn141", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08481-1", "start_pos": 141, "end_pos": 141, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "Pecam1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 727, "chemical_mass": 81263.0 } ] }, { "start_pos": "1162", "site_seq": "GSSTPTNWSHLASEAQILAR", "site_lbl": "Asn1162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0B6-1", "start_pos": 1162, "end_pos": 1162, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "Lamc3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1581, "chemical_mass": 172322.0 } ] }, { "start_pos": "1162", "site_seq": "N", "site_lbl": "Asn1162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0B6-1", "start_pos": 1162, "end_pos": 1162, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Laminin subunit gamma-3", "gene_name": "Lamc3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1581, "chemical_mass": 172322.0 } ] }, { "start_pos": "371", "site_seq": "AAPYWIVAPQNLVLSPGENGTLICR", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "371", "site_seq": "N", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "522", "site_seq": "ANLSQTEPTPTSEPASGTPSAR", "site_lbl": "Asn522", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DBY4-1", "start_pos": 522, "end_pos": 522, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "TLR4 interactor with leucine rich repeats", "gene_name": "Tril", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 809, "chemical_mass": 88810.0 } ] }, { "start_pos": "748", "site_seq": "NSTIAVNSPVISVSINK", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8JZZ7-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor L2", "gene_name": "Adgrl2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1487, "chemical_mass": 166577.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JHJ3-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glycosylated lysosomal membrane protein", "gene_name": "Glmp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 404, "chemical_mass": 43804.0 } ] }, { "start_pos": "133", "site_seq": "LLEFDSTNASEGAQPPGKPYPPYSLAK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JHJ3-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glycosylated lysosomal membrane protein", "gene_name": "Glmp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 404, "chemical_mass": 43804.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Reduced glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9JHJ3", "url": "https://www.uniprot.org/uniprotkb/Q9JHJ3" }, { "database": "PubMed", "id": "32959924", "url": "https://glygen.org/publication/PubMed/32959924" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9JHJ3-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glycosylated lysosomal membrane protein", "gene_name": "Glmp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 404, "chemical_mass": 43804.0 } ] }, { "start_pos": "54", "site_seq": "FMGSPEINETTLYQR", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12032-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "Timp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 205, "chemical_mass": 22628.0 } ] }, { "start_pos": "54", "site_seq": "N", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12032-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "Timp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 205, "chemical_mass": 22628.0 } ] }, { "start_pos": "1345", "site_seq": "LNATTANTATVEVLAPSAR", "site_lbl": "Asn1345", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6V4S5-1", "start_pos": 1345, "end_pos": 1345, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein sidekick-2", "gene_name": "Sdk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2176, "chemical_mass": 239902.0 } ] }, { "start_pos": "309", "site_seq": "KLMAQVNQTFEELALLR", "site_lbl": "Asn309", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V24-1", "start_pos": 309, "end_pos": 309, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 7", "gene_name": "Abca7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2159, "chemical_mass": 236884.0 } ] }, { "start_pos": "309", "site_seq": "N", "site_lbl": "Asn309", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V24-1", "start_pos": 309, "end_pos": 309, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 7", "gene_name": "Abca7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2159, "chemical_mass": 236884.0 } ] }, { "start_pos": "1006", "site_seq": "N", "site_lbl": "Asn1006", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BNA6-1", "start_pos": 1006, "end_pos": 1006, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin Fat 3", "gene_name": "Fat3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4555, "chemical_mass": 502011.0 } ] }, { "start_pos": "1006", "site_seq": "QQFYNLTVR", "site_lbl": "Asn1006", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BNA6-1", "start_pos": 1006, "end_pos": 1006, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin Fat 3", "gene_name": "Fat3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4555, "chemical_mass": 502011.0 } ] }, { "start_pos": "162", "site_seq": "TAQDLDVGNNSVQNYK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91XZ8-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin beta 22", "gene_name": "Pcdhb22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 794, "chemical_mass": 86870.0 } ] }, { "start_pos": "1443", "site_seq": "LTNQTLGFSFAVEQDIPVK", "site_lbl": "Asn1443", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61838-1", "start_pos": 1443, "end_pos": 1443, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Pregnancy zone protein", "gene_name": "Pzp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1495, "chemical_mass": 165853.0 } ] }, { "start_pos": "1443", "site_seq": "N", "site_lbl": "Asn1443", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61838-1", "start_pos": 1443, "end_pos": 1443, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Pregnancy zone protein", "gene_name": "Pzp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1495, "chemical_mass": 165853.0 } ] }, { "start_pos": "118", "site_seq": "ILNETLYENAK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R3G9-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tetraspanin-8", "gene_name": "Tspan8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 235, "chemical_mass": 25582.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R3G9-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tetraspanin-8", "gene_name": "Tspan8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 235, "chemical_mass": 25582.0 } ] }, { "start_pos": "421", "site_seq": "MSVYNITLK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6DD96-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin gamma subfamily A, 7", "gene_name": "Pcdhga7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 935, "chemical_mass": 101559.0 } ] }, { "start_pos": "151", "site_seq": "QQYNSLLSNMSR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "151", "site_seq": "N", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09470-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "Ace", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1312, "chemical_mass": 150918.0 } ] }, { "start_pos": "395", "site_seq": "ISENGSSVAGILSSPNMEK", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0M6-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "Adgre5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 818, "chemical_mass": 90413.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0M6-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "Adgre5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 818, "chemical_mass": 90413.0 } ] }, { "start_pos": "944", "site_seq": "SCEELLPGPGACVGNSSQSR", "site_lbl": "Asn944", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60519-1", "start_pos": 944, "end_pos": 944, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-5B", "gene_name": "Sema5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1093, "chemical_mass": 120327.0 } ] }, { "start_pos": "944", "site_seq": "N", "site_lbl": "Asn944", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60519-1", "start_pos": 944, "end_pos": 944, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-5B", "gene_name": "Sema5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1093, "chemical_mass": 120327.0 } ] }, { "start_pos": "252", "site_seq": "LLHGQTLVLNCTATTELNTR", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35969-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "Flt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1333, "chemical_mass": 149876.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35969-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "Flt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1333, "chemical_mass": 149876.0 } ] }, { "start_pos": "714", "site_seq": "IQQEPGIILGPGNSTLFIER", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35969-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "Flt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1333, "chemical_mass": 149876.0 } ] }, { "start_pos": "714", "site_seq": "N", "site_lbl": "Asn714", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35969-1", "start_pos": 714, "end_pos": 714, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "Flt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1333, "chemical_mass": 149876.0 } ] }, { "start_pos": "46", "site_seq": "TQDALIVLNVSGTR", "site_lbl": "Asn46", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0V2-1", "start_pos": 46, "end_pos": 46, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A-type voltage-gated potassium channel KCND2", "gene_name": "Kcnd2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 630, "chemical_mass": 70577.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQH2-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "Erap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 930, "chemical_mass": 106599.0 } ] }, { "start_pos": "403", "site_seq": "CFNAMEVDALNSSHPVSTPVENPAQIR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQH2-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 1", "gene_name": "Erap1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 930, "chemical_mass": 106599.0 } ] }, { "start_pos": "155", "site_seq": "PGSSHNGSGDGGAAVPTSGPGDFLYVGVMTAQK", "site_lbl": "Asn155", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5DTK1-1", "start_pos": 155, "end_pos": 155, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Chondroitin sulfate synthase 3", "gene_name": "Chsy3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 884, "chemical_mass": 100099.0 } ] }, { "start_pos": "155", "site_seq": "N", "site_lbl": "Asn155", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5DTK1-1", "start_pos": 155, "end_pos": 155, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Chondroitin sulfate synthase 3", "gene_name": "Chsy3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 884, "chemical_mass": 100099.0 } ] }, { "start_pos": "94", "site_seq": "TECCFTDFCNNITLHLPTASPNAPR", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K348-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Activin receptor type-1C", "gene_name": "Acvr1c", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 493, "chemical_mass": 54700.0 } ] }, { "start_pos": "407", "site_seq": "EQTPEYNVTITATDSGKPSLSSK", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91XX8-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin gamma subfamily B, 1", "gene_name": "Pcdhgb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 918, "chemical_mass": 98867.0 } ] }, { "start_pos": "447", "site_seq": "HPTDININLTILCSDSNGK", "site_lbl": "Asn447", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TN16-1", "start_pos": 447, "end_pos": 447, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Hedgehog-interacting protein", "gene_name": "Hhip", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 700, "chemical_mass": 78513.0 } ] }, { "start_pos": "447", "site_seq": "N", "site_lbl": "Asn447", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TN16-1", "start_pos": 447, "end_pos": 447, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Hedgehog-interacting protein", "gene_name": "Hhip", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 700, "chemical_mass": 78513.0 } ] }, { "start_pos": "120", "site_seq": "TDLCSVIPPTTPVPTNSTAK", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0L9-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sialomucin core protein 24", "gene_name": "Cd164", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 197, "chemical_mass": 21059.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R0L9-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sialomucin core protein 24", "gene_name": "Cd164", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 197, "chemical_mass": 21059.0 } ] }, { "start_pos": "317", "site_seq": "VTTVHMGNYTCHALGHEQLVQTHVLQVNVPPVIR", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5STE3-1", "start_pos": 317, "end_pos": 317, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Follistatin-related protein 4", "gene_name": "Fstl4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 841, "chemical_mass": 92579.0 } ] }, { "start_pos": "317", "site_seq": "N", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5STE3-1", "start_pos": 317, "end_pos": 317, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Follistatin-related protein 4", "gene_name": "Fstl4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 841, "chemical_mass": 92579.0 } ] }, { "start_pos": "1153", "site_seq": "DSFLTTANLSVTTNQDVR", "site_lbl": "Asn1153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F6RXI4-1", "start_pos": 1153, "end_pos": 1153, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Chondroitin sulfate proteoglycan 4B", "gene_name": "Cspg4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2391, "chemical_mass": 265718.0 } ] }, { "start_pos": "325", "site_seq": "NLSQIVSYQTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810B8-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "SLIT and NTRK-like protein 4", "gene_name": "Slitrk4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 837, "chemical_mass": 94538.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810B8-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "SLIT and NTRK-like protein 4", "gene_name": "Slitrk4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 837, "chemical_mass": 94538.0 } ] }, { "start_pos": "257", "site_seq": "NTTYQLAQSEYLNVLQPQQ", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80X71-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "Tmem106b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 275, "chemical_mass": 31172.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80X71-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "Tmem106b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 275, "chemical_mass": 31172.0 } ] }, { "start_pos": "161", "site_seq": "ENGTLSVVATISGNTFNK", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "161", "site_seq": "N", "site_lbl": "Asn161", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 161, "end_pos": 161, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "627", "site_seq": "LQVYRPSGGAAAVPEGSSEPDNR", "site_lbl": "Asn627", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08852-1", "start_pos": 627, "end_pos": 627, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Polycystin-1", "gene_name": "Pkd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4293, "chemical_mass": 466577.0 } ] }, { "start_pos": "627", "site_seq": "N", "site_lbl": "Asn627", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08852-1", "start_pos": 627, "end_pos": 627, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Polycystin-1", "gene_name": "Pkd1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4293, "chemical_mass": 466577.0 } ] }, { "start_pos": "11", "site_seq": "APPDGLMNASGALAGEAAAAGGAR", "site_lbl": "Asn11", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P58406-1", "start_pos": 11, "end_pos": 11, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Histamine H3 receptor", "gene_name": "Hrh3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 445, "chemical_mass": 48541.0 } ] }, { "start_pos": "11", "site_seq": "N", "site_lbl": "Asn11", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P58406-1", "start_pos": 11, "end_pos": 11, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Histamine H3 receptor", "gene_name": "Hrh3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 445, "chemical_mass": 48541.0 } ] }, { "start_pos": "224", "site_seq": "IIFMPNGFITQCPNLNR", "site_lbl": "Asn224", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2VWQ2-1", "start_pos": 224, "end_pos": 224, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein kinase C-binding protein NELL1", "gene_name": "Nell1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 810, "chemical_mass": 89415.0 } ] }, { "start_pos": "224", "site_seq": "N", "site_lbl": "Asn224", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q2VWQ2-1", "start_pos": 224, "end_pos": 224, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein kinase C-binding protein NELL1", "gene_name": "Nell1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 810, "chemical_mass": 89415.0 } ] }, { "start_pos": "1797", "site_seq": "CNISLPMENGLNSIEWR", "site_lbl": "Asn1797", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 1797, "end_pos": 1797, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "1797", "site_seq": "N", "site_lbl": "Asn1797", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTS5-1", "start_pos": 1797, "end_pos": 1797, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2764, "chemical_mass": 306468.0 } ] }, { "start_pos": "793", "site_seq": "AAEQIAGSFVYSIPFSTGTVNK", "site_lbl": "Asn793", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z1L5-1", "start_pos": 793, "end_pos": 793, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Voltage-dependent calcium channel subunit alpha-2/delta-3", "gene_name": "Cacna2d3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 122778.0 } ] }, { "start_pos": "694", "site_seq": "QSPFASSSEHSSENGSLR", "site_lbl": "Asn694", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYE3-1", "start_pos": 694, "end_pos": 694, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "BCL11 transcription factor A", "gene_name": "Bcl11a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 835, "chemical_mass": 91197.0 } ] }, { "start_pos": "1050", "site_seq": "TNATSPGVNSSASPQATDKSCTV", "site_lbl": "Asn1050", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91Z67-1", "start_pos": 1050, "end_pos": 1050, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "SLIT-ROBO Rho GTPase-activating protein 2", "gene_name": "Srgap2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1071, "chemical_mass": 120798.0 } ] }, { "start_pos": "90", "site_seq": "LSNWNNTLESQTLQEVK", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q52KR2-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeats and immunoglobulin-like domains protein 2", "gene_name": "Lrig2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1054, "chemical_mass": 117863.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q52KR2-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeats and immunoglobulin-like domains protein 2", "gene_name": "Lrig2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1054, "chemical_mass": 117863.0 } ] }, { "start_pos": "630", "site_seq": "YPDEEGICQPCPINCTHSCVDLDER", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70424-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "Erbb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138579.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70424-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "Erbb2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138579.0 } ] }, { "start_pos": "385", "site_seq": "VLDLDHNEISGTIEDTSGAFTGLDNLSK", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70193-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeats and immunoglobulin-like domains protein 1", "gene_name": "Lrig1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 119156.0 } ] }, { "start_pos": "385", "site_seq": "N", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70193-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeats and immunoglobulin-like domains protein 1", "gene_name": "Lrig1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1091, "chemical_mass": 119156.0 } ] }, { "start_pos": "400", "site_seq": "GYTLYGTTHCGDVDECSMNNGSCEQGCVNTK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NZL8-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Signal peptide, CUB and EGF-like domain-containing protein 1", "gene_name": "Scube1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1018, "chemical_mass": 111606.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NZL8-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Signal peptide, CUB and EGF-like domain-containing protein 1", "gene_name": "Scube1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1018, "chemical_mass": 111606.0 } ] }, { "start_pos": "2458", "site_seq": "SDIPHQPMGIIAVANDTNSCELSPCALLNGGCHDLCLLTPDGR", "site_lbl": "Asn2458", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 2458, "end_pos": 2458, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "2458", "site_seq": "N", "site_lbl": "Asn2458", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JI18-1", "start_pos": 2458, "end_pos": 2458, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Low-density lipoprotein receptor-related protein 1B", "gene_name": "Lrp1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4599, "chemical_mass": 513634.0 } ] }, { "start_pos": "32", "site_seq": "ALEVANGTVTSLPGATVTLICPGK", "site_lbl": "Asn32", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22272-1", "start_pos": 32, "end_pos": 32, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "Il6ra", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 460, "chemical_mass": 50455.0 } ] }, { "start_pos": "32", "site_seq": "N", "site_lbl": "Asn32", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22272-1", "start_pos": 32, "end_pos": 32, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "Il6ra", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 460, "chemical_mass": 50455.0 } ] }, { "start_pos": "1463", "site_seq": "EKVMNDSDTQESSLVDQSDPISPLLFENTEEENGGTGVTR", "site_lbl": "Asn1463", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "B9EKR1-1", "start_pos": 1463, "end_pos": 1463, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase zeta", "gene_name": "Ptprz1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2312, "chemical_mass": 254405.0 } ] }, { "start_pos": "413", "site_seq": "NISSHSNIIFSNGELDPWSGGGVTR", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TMR0-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "Prcp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 491, "chemical_mass": 55027.0 } ] }, { "start_pos": "413", "site_seq": "N", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TMR0-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "Prcp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 491, "chemical_mass": 55027.0 } ] }, { "start_pos": "413", "site_seq": "", "site_lbl": "N413", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "7", "chr_pos": "92577971", "evidence": [ { "id": "rs3388927016", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388927016" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7TMR0-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "Prcp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 491, "chemical_mass": 55027.0 } ] }, { "start_pos": "90", "site_seq": "RWNCTTIDDSLAIFGPVLDK", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17553-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Proto-oncogene Wnt-3", "gene_name": "Wnt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 355, "chemical_mass": 39659.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17553-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Proto-oncogene Wnt-3", "gene_name": "Wnt3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 355, "chemical_mass": 39659.0 } ] }, { "start_pos": "284", "site_seq": "CVQWPPTNASLEEHSIEK", "site_lbl": "Asn284", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2APX8-1", "start_pos": 284, "end_pos": 284, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium channel protein type 1 subunit alpha", "gene_name": "Scn1a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2009, "chemical_mass": 228800.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "438", "site_seq": "ELSVQDQPSLSPTSLQnSSSHTTTAK", "site_lbl": "Asn438", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "", "site_lbl": "N438", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->ISS).", "chr_id": "7", "chr_pos": "135394232", "evidence": [ { "id": "rs1043577436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1043577436" }, { "id": "rs1043577436", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1043577436" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "7", "chr_pos": "135394231", "evidence": [ { "id": "rs1796558680", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1796558680" }, { "id": "rs1796558680", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1796558680" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "693", "site_seq": "DYSLTFGAInQTWSYR", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "N", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "DYSLTFGAINQTWSYR", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQnITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "N", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQNITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "", "site_lbl": "N693", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "14", "chr_pos": "52038927", "evidence": [ { "id": "rs768965058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768965058" }, { "id": "rs768965058", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768965058" }, { "id": "rs768965058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768965058" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "14", "chr_pos": "52038925", "evidence": [ { "id": "rs1274839377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1274839377" }, { "id": "rs1274839377", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1274839377#frequency_tab" }, { "id": "rs1274839377", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1274839377" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "1228", "site_seq": "ADMVNEDLLSDGTSEnESGFWDSFK", "site_lbl": "Asn1228", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 1228, "end_pos": 1228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "1228", "site_seq": "KADMVNEDLLSDGTSENESGFWDSFK", "site_lbl": "Asn1228", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 1228, "end_pos": 1228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "1228", "site_seq": "N", "site_lbl": "Asn1228", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 1228, "end_pos": 1228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "1228", "site_seq": "", "site_lbl": "N1228", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "128177889", "evidence": [ { "id": "rs1213160937", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1213160937" }, { "id": "rs1213160937", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1213160937" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 1228, "end_pos": 1228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "198", "site_seq": "RnESHLIDFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJ14-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "GGT7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 662, "chemical_mass": 70467.0 } ] }, { "start_pos": "198", "site_seq": "nESHLIDFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJ14-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "GGT7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 662, "chemical_mass": 70467.0 } ] }, { "start_pos": "198", "site_seq": "NESHLIDFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJ14-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "GGT7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 662, "chemical_mass": 70467.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJ14-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 7", "gene_name": "GGT7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 662, "chemical_mass": 70467.0 } ] }, { "start_pos": "173", "site_seq": "N", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "173", "site_seq": "ITIAInNTLTPTTLPPGTIQYLTDTSK", "site_lbl": "Asn173", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "173", "site_seq": "", "site_lbl": "N173", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "7", "chr_pos": "65979790", "evidence": [ { "id": "P08236", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08236" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "65979790", "evidence": [ { "id": "rs996983482", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs996983482" }, { "id": "rs996983482", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs996983482#frequency_tab" }, { "id": "rs996983482", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs996983482" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08236-1", "start_pos": 173, "end_pos": 173, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-glucuronidase", "gene_name": "GUSB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 651, "chemical_mass": 74732.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "182", "site_seq": "YHYnGTLLDGTSFDTSYSK", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "310", "site_seq": "nHTYNTYIGQGYIIPGMDQGLQGACMGER", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "310", "site_seq": "N", "site_lbl": "Asn310", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 310, "end_pos": 310, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "182", "site_seq": "", "site_lbl": "N182", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "17", "chr_pos": "41818242", "evidence": [ { "id": "rs782722256", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782722256" }, { "id": "rs782722256", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782722256" }, { "id": "rs782722256", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782722256#frequency_tab" }, { "id": "rs782722256", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782722256" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "1070", "site_seq": "DLDTDFTNnASQPETK", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "1070", "site_seq": "N", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "1070", "site_seq": "GKDLDTDFTNNASQPETK", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "9", "chr_pos": "115087180", "evidence": [ { "id": "rs778574555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778574555#frequency_tab" }, { "id": "rs778574555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778574555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "157", "site_seq": "FVnDTK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "N157", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "2", "chr_pos": "9527935", "evidence": [ { "id": "rs1664592938", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1664592938" }, { "id": "rs1664592938", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1664592938" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "HSVLWNAMIHPLCnMTLK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "HSVLWNAMIHPLCNMTLK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->DMT).", "chr_id": "11", "chr_pos": "124648099", "evidence": [ { "id": "rs1942967215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942967215" }, { "id": "rs1942967215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1942967215#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HAT2-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialate O-acetylesterase", "gene_name": "SIAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 58315.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "", "site_lbl": "N82", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "326", "site_seq": "HFnTSLVFPR", "site_lbl": "Asn326", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 326, "end_pos": 326, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "326", "site_seq": "HFNTSLVFPR", "site_lbl": "Asn326", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 326, "end_pos": 326, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "326", "site_seq": "N", "site_lbl": "Asn326", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PKC3-1", "start_pos": 326, "end_pos": 326, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thioredoxin domain-containing protein 11", "gene_name": "TXNDC11", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 985, "chemical_mass": 110529.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "476", "site_seq": "YEQGTGCWQGPnR", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "N", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "YEQGTGCWQGPNR", "site_lbl": "Asn476", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "476", "site_seq": "", "site_lbl": "N476", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "19", "chr_pos": "11449162", "evidence": [ { "id": "rs922380592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs922380592" }, { "id": "rs922380592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs922380592#frequency_tab" }, { "id": "rs922380592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs922380592" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14314-1", "start_pos": 476, "end_pos": 476, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 528, "chemical_mass": 59425.0 } ] }, { "start_pos": "411", "site_seq": "N", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "411", "site_seq": "IYnWSGYPLLVQK", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "411", "site_seq": "", "site_lbl": "N411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "12", "chr_pos": "14507072", "evidence": [ { "id": "rs1419270468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1419270468" }, { "id": "rs1419270468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1419270468#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->SWS).", "chr_id": "12", "chr_pos": "14507073", "evidence": [ { "id": "rs1945262306", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1945262306" }, { "id": "rs1945262306", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1945262306" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6P4A8-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipase B-like 1", "gene_name": "PLBD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 553, "chemical_mass": 63255.0 } ] }, { "start_pos": "273", "site_seq": "SAVSTSWLLPYnYTWSPEK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "273", "site_seq": "SAVSTSWLLPYNYTWSPEK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "273", "site_seq": "", "site_lbl": "N273", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "16", "chr_pos": "68259237", "evidence": [ { "id": "rs371632429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371632429" }, { "id": "rs371632429", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371632429" }, { "id": "rs371632429", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371632429#frequency_tab" }, { "id": "rs371632429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371632429" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "273", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation site. Mildly reduces production of the mature, active enzyme.", "evidence": [ { "database": "UniProtKB", "id": "Q8NCC3", "url": "https://www.uniprot.org/uniprotkb/Q8NCC3" }, { "database": "PubMed", "id": "23958596", "url": "https://glygen.org/publication/PubMed/23958596" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "542", "site_seq": "MnQSLSLLYNVPAVAEEIQDEVDELLQK", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05067-1", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amyloid-beta precursor protein", "gene_name": "APP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 86943.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05067-1", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amyloid-beta precursor protein", "gene_name": "APP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 86943.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->HQS).", "chr_id": "21", "chr_pos": "25954653", "evidence": [ { "id": "rs1347380777", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1347380777" }, { "id": "rs1347380777", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1347380777" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->IQS).", "chr_id": "21", "chr_pos": "25954652", "evidence": [ { "id": "P05067", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05067" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "21", "chr_pos": "25954652", "evidence": [ { "id": "rs1299179388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1299179388" }, { "id": "rs1299179388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1299179388" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05067-1", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amyloid-beta precursor protein", "gene_name": "APP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 86943.0 } ] }, { "start_pos": "183", "site_seq": "AGSLWDPnITACK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRM6-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor B", "gene_name": "IL17RB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 55885.0 } ] }, { "start_pos": "183", "site_seq": "AGSLWDPNITACK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRM6-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor B", "gene_name": "IL17RB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 55885.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRM6-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor B", "gene_name": "IL17RB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 55885.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "3", "chr_pos": "53856861", "evidence": [ { "id": "Q9NRM6", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NRM6" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRM6-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor B", "gene_name": "IL17RB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 55885.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "232", "site_seq": "GYLTSFEMFnSTYK", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "232", "site_seq": "GYLTSFEMFNSTYK", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75356-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleoside diphosphate phosphatase ENTPD5", "gene_name": "ENTPD5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 428, "chemical_mass": 47517.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "299", "site_seq": "QInSSISGNLWDK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "299", "site_seq": "QINSSISGNLWDKDQR", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "299", "site_seq": "", "site_lbl": "N299", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "1", "chr_pos": "84563318", "evidence": [ { "id": "rs928283673", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928283673" }, { "id": "rs928283673", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs928283673" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "97", "site_seq": "IGGDAATTVnNSTPDFGFGGQK", "site_lbl": "Asn97", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92945-1", "start_pos": 97, "end_pos": 97, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Far upstream element-binding protein 2", "gene_name": "KHSRP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 73115.0 } ] }, { "start_pos": "97", "site_seq": "", "site_lbl": "N97", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "19", "chr_pos": "6422396", "evidence": [ { "id": "Q92945", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92945" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92945-1", "start_pos": 97, "end_pos": 97, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Far upstream element-binding protein 2", "gene_name": "KHSRP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 73115.0 } ] }, { "start_pos": "86", "site_seq": "ELAVPDGYTnR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "86", "site_seq": "ELAVPDGYTNR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "TSIPTINMEnK", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "TSIPTINMENK", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "N", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "", "site_lbl": "N969", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "17", "chr_pos": "50081395", "evidence": [ { "id": "rs1447627958", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447627958" }, { "id": "rs1447627958", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1447627958#frequency_tab" }, { "id": "rs1447627958", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1447627958" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "470", "site_seq": "GVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "N", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "470", "site_seq": "RGVFITnETGQPLIGK", "site_lbl": "Asn470", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 470, "end_pos": 470, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "191", "site_seq": "N", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ7-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive C-alpha-formylglycine-generating enzyme 2", "gene_name": "SUMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 301, "chemical_mass": 33843.0 } ] }, { "start_pos": "191", "site_seq": "GQVYPWGNWFQPnR", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ7-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive C-alpha-formylglycine-generating enzyme 2", "gene_name": "SUMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 301, "chemical_mass": 33843.0 } ] }, { "start_pos": "191", "site_seq": "GQVYPWGNWFQPnRTNLWQGK", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ7-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive C-alpha-formylglycine-generating enzyme 2", "gene_name": "SUMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 301, "chemical_mass": 33843.0 } ] }, { "start_pos": "191", "site_seq": "GQVYPWGNWFQPNR", "site_lbl": "Asn191", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ7-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive C-alpha-formylglycine-generating enzyme 2", "gene_name": "SUMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 301, "chemical_mass": 33843.0 } ] }, { "start_pos": "191", "site_seq": "", "site_lbl": "N191", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "7", "chr_pos": "56076871", "evidence": [ { "id": "rs1795591931", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1795591931" }, { "id": "rs1795591931", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1795591931#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "7", "chr_pos": "56076870", "evidence": [ { "id": "rs1427231774", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1427231774" }, { "id": "rs1427231774", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1427231774#frequency_tab" }, { "id": "rs1427231774", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1427231774" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ7-1", "start_pos": 191, "end_pos": 191, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive C-alpha-formylglycine-generating enzyme 2", "gene_name": "SUMF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 301, "chemical_mass": 33843.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "", "site_lbl": "N557", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "112158878", "evidence": [ { "id": "rs1554337654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337654" }, { "id": "rs1554337654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337654" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "6", "chr_pos": "112158879", "evidence": [ { "id": "rs1554337657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337657" }, { "id": "rs1554337657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337657" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "HGIQYFNnNTQHSSLFMLNEVK", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "", "site_lbl": "N169", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "3", "chr_pos": "186725201", "evidence": [ { "id": "rs2108623231", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623231" }, { "id": "rs2108623231", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623231" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "3", "chr_pos": "186725203", "evidence": [ { "id": "rs2108623237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623237" }, { "id": "rs2108623237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->TNT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "2331", "site_seq": "HMLALAPnSTAR", "site_lbl": "Asn2331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92508-1", "start_pos": 2331, "end_pos": 2331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Piezo-type mechanosensitive ion channel component 1", "gene_name": "PIEZO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2521, "chemical_mass": 286790.0 } ] }, { "start_pos": "2331", "site_seq": "GGTVEYANEKHMLALAPnSTAR", "site_lbl": "Asn2331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92508-1", "start_pos": 2331, "end_pos": 2331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Piezo-type mechanosensitive ion channel component 1", "gene_name": "PIEZO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2521, "chemical_mass": 286790.0 } ] }, { "start_pos": "2331", "site_seq": "HMLALAPNSTAR", "site_lbl": "Asn2331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92508-1", "start_pos": 2331, "end_pos": 2331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Piezo-type mechanosensitive ion channel component 1", "gene_name": "PIEZO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2521, "chemical_mass": 286790.0 } ] }, { "start_pos": "2331", "site_seq": "N", "site_lbl": "Asn2331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92508-1", "start_pos": 2331, "end_pos": 2331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Piezo-type mechanosensitive ion channel component 1", "gene_name": "PIEZO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2521, "chemical_mass": 286790.0 } ] }, { "start_pos": "2331", "site_seq": "", "site_lbl": "N2331", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "16", "chr_pos": "88716417", "evidence": [ { "id": "rs746444593", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746444593" }, { "id": "rs746444593", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746444593" }, { "id": "rs746444593", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746444593#frequency_tab" }, { "id": "rs746444593", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746444593" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "16", "chr_pos": "88716418", "evidence": [ { "id": "rs1386175142", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386175142" }, { "id": "rs1386175142", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1386175142" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92508-1", "start_pos": 2331, "end_pos": 2331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Piezo-type mechanosensitive ion channel component 1", "gene_name": "PIEZO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2521, "chemical_mass": 286790.0 } ] }, { "start_pos": "1170", "site_seq": "ELLQHHGLVPQIEAATAYTIFVPTnR", "site_lbl": "Asn1170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 1170, "end_pos": 1170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "1170", "site_seq": "N", "site_lbl": "Asn1170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 1170, "end_pos": 1170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "606", "site_seq": "ILTMANQVLAVnISEEGR", "site_lbl": "Asn606", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 606, "end_pos": 606, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "606", "site_seq": "N", "site_lbl": "Asn606", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 606, "end_pos": 606, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "1170", "site_seq": "", "site_lbl": "N1170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "3", "chr_pos": "52514176", "evidence": [ { "id": "rs1290272325", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290272325" }, { "id": "rs1290272325", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1290272325#frequency_tab" }, { "id": "rs1290272325", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1290272325" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 1170, "end_pos": 1170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "606", "site_seq": "", "site_lbl": "N606", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "3", "chr_pos": "52506238", "evidence": [ { "id": "rs201240267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201240267" }, { "id": "rs201240267", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201240267" }, { "id": "rs201240267", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201240267" }, { "id": "rs201240267", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201240267#frequency_tab" }, { "id": "rs201240267", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201240267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 606, "end_pos": 606, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "rs1175912363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175912363" }, { "id": "rs1175912363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175912363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "P98160", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "187", "site_seq": "EIQWNSLGNGLAYEDFSFPIFLLEDEnETK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "187", "site_seq": "EIQWNSLGNGLAYEDFSFPIFLLEDENETK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "435", "site_seq": "ARnISGVVLADHSGAFHNK", "site_lbl": "Asn435", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 435, "end_pos": 435, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "435", "site_seq": "nISGVVLADHSGAFHNK", "site_lbl": "Asn435", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 435, "end_pos": 435, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "435", "site_seq": "N", "site_lbl": "Asn435", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 435, "end_pos": 435, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "435", "site_seq": "NISGVVLADHSGAFHNK", "site_lbl": "Asn435", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 435, "end_pos": 435, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->TET).", "chr_id": "1", "chr_pos": "160350228", "evidence": [ { "id": "rs2101900004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2101900004" }, { "id": "rs2101900004", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2101900004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "1", "chr_pos": "160350227", "evidence": [ { "id": "Q92542", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92542" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92542-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nicastrin", "gene_name": "NCSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 709, "chemical_mass": 78411.0 } ] }, { "start_pos": "977", "site_seq": "IDCYPDENGASAEnCTAR", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "N", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "", "site_lbl": "N977", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 0 out of 0 filters:", "chr_id": "NC_000007.14", "chr_pos": "142052417", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "509", "site_seq": "nETHFDAGAK", "site_lbl": "Asn509", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 509, "end_pos": 509, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "509", "site_seq": "N", "site_lbl": "Asn509", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 509, "end_pos": 509, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "509", "site_seq": "NETHFDAGAK", "site_lbl": "Asn509", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 509, "end_pos": 509, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "509", "site_seq": "", "site_lbl": "N509", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "17", "chr_pos": "63483497", "evidence": [ { "id": "rs769290119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769290119" }, { "id": "rs769290119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769290119" }, { "id": "rs769290119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769290119" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 509, "end_pos": 509, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "509", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "In Ndom123456 mutant; abolished dipeptidyl carboxypeptidase activity; when associated with D-318 and D-445.", "evidence": [ { "database": "UniProtKB", "id": "P12821", "url": "https://www.uniprot.org/uniprotkb/P12821" }, { "database": "PubMed", "id": "20826823", "url": "https://glygen.org/publication/PubMed/20826823" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 509, "end_pos": 509, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "156", "site_seq": "IDGSGNFQVLLSDRYFnK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "12", "chr_pos": "6110440", "evidence": [ { "id": "rs1945295028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1945295028" }, { "id": "rs1945295028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1945295028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "12", "chr_pos": "6110439", "evidence": [ { "id": "rs371953822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371953822" }, { "id": "rs371953822", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371953822" }, { "id": "rs371953822", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371953822" }, { "id": "rs371953822", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371953822#frequency_tab" }, { "id": "rs371953822", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371953822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "", "site_lbl": "N2585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "12", "chr_pos": "5968143", "evidence": [ { "id": "rs2136354943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136354943" }, { "id": "rs2136354943", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136354943" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "240", "site_seq": "GQTAESLAVHnITVCEQK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04839-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 65336.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04839-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 570, "chemical_mass": 65336.0 } ] }, { "start_pos": "344", "site_seq": "SGTIFDNFLITNDEAYAEEFGnETWGVTK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "19", "chr_pos": "12943606", "evidence": [ { "id": "rs1477630481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477630481" }, { "id": "rs1477630481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477630481" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "19", "chr_pos": "12943607", "evidence": [ { "id": "rs755626585", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755626585#frequency_tab" }, { "id": "rs755626585", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755626585" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->HES).", "chr_id": "3", "chr_pos": "155116553", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "136", "site_seq": "YGnMTEDHVMHLLQNADPLK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "110", "site_seq": "AVIFFGDQEHPnVTEFAVGPLPGPCYMR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "7", "chr_pos": "150856800", "evidence": [ { "id": "P19801", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19801" }, { "id": "rs373164869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" }, { "id": "rs373164869", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373164869" }, { "id": "rs373164869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373164869#frequency_tab" }, { "id": "rs373164869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373164869" }, { "id": "rs373164869", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373164869" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "327", "site_seq": "LDSFGPINPTLnTTYSFLTTFFK", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74721158", "evidence": [ { "id": "rs1749848813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1749848813" }, { "id": "rs1749848813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1749848813#frequency_tab" }, { "id": "rs1749848813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1749848813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "5", "chr_pos": "74721159", "evidence": [ { "id": "rs763927371", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763927371" }, { "id": "rs763927371", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763927371" }, { "id": "rs763927371", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763927371#frequency_tab" }, { "id": "rs763927371", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763927371" } ], "disease": [ { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] }, { "disease_id": "DOID:3323", "name": "Sandhoff disease", "description": "A GM2 gangliosidosis that is characterized by an accumulation of GM2 gangliosides, particularly in neurons, and that has_material_basis_in mutation in the beta subunit of hexosaminidase (HEXB) on chromosome 5q13.", "url": "http://disease-ontology.org/term/DOID:3323", "evidence": [ { "id": "0010006", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010006" }, { "id": "268800", "database": "MIM", "url": "https://www.omim.org/entry/268800" }, { "id": "3074", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/3074#disease" }, { "id": "3323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07686-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit beta", "gene_name": "HEXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 556, "chemical_mass": 63137.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU5-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "SULF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 870, "chemical_mass": 100455.0 } ] }, { "start_pos": "198", "site_seq": "DYLTDLITnDSVSFFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU5-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "SULF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 870, "chemical_mass": 100455.0 } ] }, { "start_pos": "198", "site_seq": "HGSDYSKDYLTDLITNDSVSFFR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU5-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "SULF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 870, "chemical_mass": 100455.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "20", "chr_pos": "47690271", "evidence": [ { "id": "rs2088152920", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2088152920" }, { "id": "rs2088152920", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2088152920#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "20", "chr_pos": "47690270", "evidence": [ { "id": "rs200775510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200775510" }, { "id": "rs200775510", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200775510" }, { "id": "rs200775510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200775510" }, { "id": "rs200775510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200775510#frequency_tab" }, { "id": "rs200775510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200775510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IWU5-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "SULF2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 870, "chemical_mass": 100455.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "7", "chr_pos": "23260501", "evidence": [ { "id": "rs769718537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769718537#frequency_tab" }, { "id": "rs769718537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769718537" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "406", "site_seq": "HLYTTTGGETDFTnVTSLR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "406", "site_seq": "HLYTTTGGETDFTNVTSLR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->TVT).", "chr_id": "1", "chr_pos": "109340771", "evidence": [ { "id": "rs1254881019", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1254881019" }, { "id": "rs1254881019", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1254881019" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99523-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin", "gene_name": "SORT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 831, "chemical_mass": 92068.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "2", "chr_pos": "70276841", "evidence": [ { "id": "rs764712210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764712210#frequency_tab" }, { "id": "rs764712210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764712210" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "2", "chr_pos": "70276842", "evidence": [ { "id": "Q9UHG3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UHG3" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "431", "site_seq": "MYSEGSDIVPQSnETALHYFK", "site_lbl": "Asn431", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "431", "site_seq": "N", "site_lbl": "Asn431", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "431", "site_seq": "", "site_lbl": "N431", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "14", "chr_pos": "81490428", "evidence": [ { "id": "Q9UBV2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UBV2" }, { "id": "rs1443797116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443797116" }, { "id": "rs1443797116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443797116" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBV2-1", "start_pos": 431, "end_pos": 431, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sel-1 homolog 1", "gene_name": "SEL1L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 794, "chemical_mass": 88755.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "N234", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "15", "chr_pos": "89805376", "evidence": [ { "id": "rs1338821581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338821581" }, { "id": "rs1338821581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338821581" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "15", "chr_pos": "89805377", "evidence": [ { "id": "rs1173509041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1173509041" }, { "id": "rs1173509041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1173509041#frequency_tab" }, { "id": "rs1173509041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1173509041" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "N818", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "89792235", "evidence": [ { "id": "rs1968642413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968642413" }, { "id": "rs1968642413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1968642413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "E", "comment": "Very low receptor activity and HCoV-229E infection.", "evidence": [ { "database": "UniProtKB", "id": "P15144", "url": "https://www.uniprot.org/uniprotkb/P15144" }, { "database": "PubMed", "id": "11559807", "url": "https://glygen.org/publication/PubMed/11559807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "577", "site_seq": "GLPSLTSVSWnISVPR", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "577", "site_seq": "TPNWDRGLPSLTSVSWnISVPR", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "577", "site_seq": "N", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "417", "site_seq": "NYIVPILWLnETGTIGDEK", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "RNYIVPILWLnETGTIGDEK", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "N", "site_lbl": "Asn417", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "417", "site_seq": "", "site_lbl": "N417", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "7", "chr_pos": "80673405", "evidence": [ { "id": "rs947550070", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs947550070" }, { "id": "rs947550070", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs947550070" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "7", "chr_pos": "80673363_80673405", "evidence": [ { "id": "rs774967939", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774967939" }, { "id": "rs774967939", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774967939" }, { "id": "rs774967939", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774967939" }, { "id": "rs773534827", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773534827" }, { "id": "rs773534827", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773534827" }, { "id": "rs773534827", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773534827" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 417, "end_pos": 417, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "15", "site_seq": "LCSGYYSLnQSFVEPFQCPR", "site_lbl": "Asn15", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A6NKW6-1", "start_pos": 15, "end_pos": 15, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein shisa-like-2B", "gene_name": "SHISAL2B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 160, "chemical_mass": 17663.0 } ] }, { "start_pos": "15", "site_seq": "", "site_lbl": "N15", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->IQS).", "chr_id": "5", "chr_pos": "64690667", "evidence": [ { "id": "rs1741625918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1741625918" }, { "id": "rs1741625918", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1741625918#frequency_tab" }, { "id": "rs1741625918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1741625918" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A6NKW6-1", "start_pos": 15, "end_pos": 15, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein shisa-like-2B", "gene_name": "SHISAL2B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 160, "chemical_mass": 17663.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "", "site_lbl": "N678", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "4", "chr_pos": "110548207", "evidence": [ { "id": "rs1727151705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727151705" }, { "id": "rs1727151705", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727151705" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "241", "site_seq": "AEDYGPVEVISHWHPnITINIVDDHTPWVK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "241", "site_seq": "RAEDYGPVEVISHWHPNITINIVDDHTPWVK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96005-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative lipid scramblase CLPTM1", "gene_name": "CLPTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 76097.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "551", "site_seq": "EGKPFYQMTSnATQAFWTK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "64356239", "evidence": [ { "id": "rs2035842772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2035842772" }, { "id": "rs2035842772", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2035842772" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "623", "site_seq": "N", "site_lbl": "Asn623", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 623, "end_pos": 623, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "623", "site_seq": "TTLVDnNTWNNSHIALVGK", "site_lbl": "Asn623", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 623, "end_pos": 623, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "623", "site_seq": "TTLVDNNTWNNSHIALVGK", "site_lbl": "Asn623", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TCJ2-1", "start_pos": 623, "end_pos": 623, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B", "gene_name": "STT3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 826, "chemical_mass": 93674.0 } ] }, { "start_pos": "1365", "site_seq": "LMSTEASQnITYHCK", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "ASQNITYHCK", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "1365", "site_seq": "", "site_lbl": "N1365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "17", "chr_pos": "50185932", "evidence": [ { "id": "rs1906471089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1906471089" }, { "id": "rs1906471089", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1906471089" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02452-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1464, "chemical_mass": 138911.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "107", "site_seq": "CLSPDVTPCFCTInFTLEK", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "107", "site_seq": "", "site_lbl": "N107", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "6", "chr_pos": "75267667", "evidence": [ { "id": "rs1426369513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426369513" }, { "id": "rs1426369513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426369513#frequency_tab" }, { "id": "rs1426369513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426369513" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "6", "chr_pos": "75267667", "evidence": [ { "id": "rs1426369513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426369513" }, { "id": "rs1426369513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426369513#frequency_tab" }, { "id": "rs1426369513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426369513" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "50361733", "evidence": [ { "id": "rs1214907251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214907251" }, { "id": "rs1214907251", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214907251#frequency_tab" }, { "id": "rs1214907251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214907251" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "181", "site_seq": "N", "site_lbl": "Asn181", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVG9-1", "start_pos": 181, "end_pos": 181, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylserine synthase 2", "gene_name": "PTDSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 56253.0 } ] }, { "start_pos": "181", "site_seq": "DYGGNCLIYDPDnETDPFHNIWDK", "site_lbl": "Asn181", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVG9-1", "start_pos": 181, "end_pos": 181, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylserine synthase 2", "gene_name": "PTDSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 56253.0 } ] }, { "start_pos": "181", "site_seq": "", "site_lbl": "N181", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "11", "chr_pos": "487044", "evidence": [ { "id": "rs1374637726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374637726" }, { "id": "rs1374637726", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374637726#frequency_tab" }, { "id": "rs1374637726", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374637726" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "11", "chr_pos": "487044", "evidence": [ { "id": "rs1374637726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374637726" }, { "id": "rs1374637726", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1374637726#frequency_tab" }, { "id": "rs1374637726", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374637726" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "487045", "evidence": [ { "id": "rs1412683606", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1412683606" }, { "id": "rs1412683606", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1412683606#frequency_tab" }, { "id": "rs1412683606", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1412683606" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVG9-1", "start_pos": 181, "end_pos": 181, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylserine synthase 2", "gene_name": "PTDSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 56253.0 } ] }, { "start_pos": "368", "site_seq": "N", "site_lbl": "Asn368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35858-1", "start_pos": 368, "end_pos": 368, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin-like growth factor-binding protein complex acid labile subunit", "gene_name": "IGFALS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 605, "chemical_mass": 66035.0 } ] }, { "start_pos": "368", "site_seq": "AGAFLGLTNVAVMnLSGNCLR", "site_lbl": "Asn368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35858-1", "start_pos": 368, "end_pos": 368, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin-like growth factor-binding protein complex acid labile subunit", "gene_name": "IGFALS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 605, "chemical_mass": 66035.0 } ] }, { "start_pos": "278", "site_seq": "InTTADEK", "site_lbl": "Asn278", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 278, "end_pos": 278, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "278", "site_seq": "N", "site_lbl": "Asn278", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 278, "end_pos": 278, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "278", "site_seq": "", "site_lbl": "N278", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "15", "chr_pos": "58640956", "evidence": [ { "id": "O14672", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14672" }, { "id": "rs1896402411", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1896402411" }, { "id": "rs1896402411", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1896402411" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 278, "end_pos": 278, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "405", "site_seq": "IETVLPAEFFEVLSSSQnGSYHR", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "405", "site_seq": "N", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TEM1-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1887, "chemical_mass": 205111.0 } ] }, { "start_pos": "167", "site_seq": "DLnETIHYMYK", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "DLNETIHYMYK", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "14", "chr_pos": "92713865", "evidence": [ { "id": "rs1303621486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1303621486" }, { "id": "rs1303621486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1303621486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99538-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Legumain", "gene_name": "LGMN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 433, "chemical_mass": 49411.0 } ] }, { "start_pos": "112", "site_seq": "EnMTFGSTLVTNPNGGFLACGPLYAYR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "112", "site_seq": "ENMTFGSTLVTNPNGGFLACGPLYAYR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "112", "site_seq": "N", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "VYVYALnQTR", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "VYVYALNQTR", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "N", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "", "site_lbl": "N532", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "5", "chr_pos": "52909038", "evidence": [ { "id": "rs1268595142", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1268595142" }, { "id": "rs1268595142", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1268595142#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "5", "chr_pos": "52909037", "evidence": [ { "id": "rs758786220", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758786220" }, { "id": "rs758786220", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758786220" }, { "id": "rs758786220", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758786220#frequency_tab" }, { "id": "rs758786220", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758786220" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "50", "site_seq": "EIFVANGTQGK", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "EIFVAnGTQGK", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "1", "chr_pos": "167765640", "evidence": [ { "id": "O95297", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95297" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "1", "chr_pos": "167765639", "evidence": [ { "id": "rs1661099816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1661099816" }, { "id": "rs1661099816", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1661099816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "", "site_lbl": "N113", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "10", "chr_pos": "73068972", "evidence": [ { "id": "rs764044557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764044557" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "88", "site_seq": "HPDAVAWAnLTNAIR", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "HPDAVAWANLTNAIR", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "88", "site_seq": "", "site_lbl": "N88", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "113358863", "evidence": [ { "id": "rs1384462400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1384462400" }, { "id": "rs1384462400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1384462400" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "113358863", "evidence": [ { "id": "rs1384462400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1384462400" }, { "id": "rs1384462400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1384462400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NHP8-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Putative phospholipase B-like 2", "gene_name": "PLBD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 65472.0 } ] }, { "start_pos": "871", "site_seq": "ENDNFnISK", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60486-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-C1", "gene_name": "PLXNC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1568, "chemical_mass": 175742.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60486-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-C1", "gene_name": "PLXNC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1568, "chemical_mass": 175742.0 } ] }, { "start_pos": "871", "site_seq": "ENDNFNISK", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60486-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-C1", "gene_name": "PLXNC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1568, "chemical_mass": 175742.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "12", "chr_pos": "94248245", "evidence": [ { "id": "rs753108746", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753108746" }, { "id": "rs753108746", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753108746" }, { "id": "rs753108746", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753108746#frequency_tab" }, { "id": "rs753108746", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753108746" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "12", "chr_pos": "94248245", "evidence": [ { "id": "rs753108746", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753108746" }, { "id": "rs753108746", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753108746" }, { "id": "rs753108746", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753108746#frequency_tab" }, { "id": "rs753108746", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753108746" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60486-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-C1", "gene_name": "PLXNC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1568, "chemical_mass": 175742.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "189", "site_seq": "GPNMLISTEVnATQFLALVQEK", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WW52-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein FAM151A", "gene_name": "FAM151A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 64028.0 } ] }, { "start_pos": "189", "site_seq": "GPNMLISTEVNATQFLALVQEKYPKATLSPGWTTFYMSTSPNR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WW52-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein FAM151A", "gene_name": "FAM151A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 64028.0 } ] }, { "start_pos": "189", "site_seq": "", "site_lbl": "N189", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "1", "chr_pos": "54614709", "evidence": [ { "id": "rs547075656", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs547075656" }, { "id": "rs547075656", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs547075656" }, { "id": "rs547075656", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs547075656" }, { "id": "rs547075656", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs547075656#frequency_tab" }, { "id": "rs547075656", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs547075656" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8WW52-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein FAM151A", "gene_name": "FAM151A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 64028.0 } ] }, { "start_pos": "109", "site_seq": "SnHTQATNDPPEVTVFPK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20036-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP alpha 1 chain", "gene_name": "HLA-DPA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 260, "chemical_mass": 29381.0 } ] }, { "start_pos": "109", "site_seq": "SNHTQATNDPPEVTVFPK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20036-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP alpha 1 chain", "gene_name": "HLA-DPA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 260, "chemical_mass": 29381.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20036-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP alpha 1 chain", "gene_name": "HLA-DPA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 260, "chemical_mass": 29381.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "6", "chr_pos": "33069662", "evidence": [ { "id": "P20036", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20036" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "6", "chr_pos": "33069661", "evidence": [ { "id": "rs1762159118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1762159118" }, { "id": "rs1762159118", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1762159118" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20036-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP alpha 1 chain", "gene_name": "HLA-DPA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 260, "chemical_mass": 29381.0 } ] }, { "start_pos": "49", "site_seq": "ALVCSQPGLnCTVK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96F46-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 866, "chemical_mass": 96122.0 } ] }, { "start_pos": "49", "site_seq": "ALVCSQPGLNCTVK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96F46-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 866, "chemical_mass": 96122.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96F46-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 866, "chemical_mass": 96122.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "", "site_lbl": "N94", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "8", "chr_pos": "120162501", "evidence": [ { "id": "rs1815713404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1815713404" }, { "id": "rs1815713404", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1815713404#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "398", "site_seq": "VTLWVHPFVNYNSSR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NSJ0-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "MYORG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 714, "chemical_mass": 81087.0 } ] }, { "start_pos": "398", "site_seq": "VTLWVHPFVNYnSSR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NSJ0-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "MYORG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 714, "chemical_mass": 81087.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6NSJ0-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "MYORG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 714, "chemical_mass": 81087.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "9", "chr_pos": "34371752", "evidence": [ { "id": "rs1820605753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1820605753" }, { "id": "rs1820605753", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1820605753" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6NSJ0-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myogenesis-regulating glycosidase", "gene_name": "MYORG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 714, "chemical_mass": 81087.0 } ] }, { "start_pos": "869", "site_seq": "VSDEnLTGVNPAAATR", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08F94-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrocystin", "gene_name": "PKHD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4074, "chemical_mass": 446702.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08F94-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrocystin", "gene_name": "PKHD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4074, "chemical_mass": 446702.0 } ] }, { "start_pos": "869", "site_seq": "", "site_lbl": "N869", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "6", "chr_pos": "52045075", "evidence": [ { "id": "rs772598832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772598832" }, { "id": "rs772598832", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772598832" }, { "id": "rs772598832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772598832" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->nullLT).", "chr_id": "6", "chr_pos": "52045078", "evidence": [ { "id": "rs2533097821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2533097821" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08F94-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrocystin", "gene_name": "PKHD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4074, "chemical_mass": 446702.0 } ] }, { "start_pos": "1893", "site_seq": "TITYGPELQAnITAGPAEGSPGSPR", "site_lbl": "Asn1893", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5N4-1", "start_pos": 1893, "end_pos": 1893, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sidekick-1", "gene_name": "SDK1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2213, "chemical_mass": 242112.0 } ] }, { "start_pos": "1893", "site_seq": "TITYGPELQANITAGPAEGSPGSPR", "site_lbl": "Asn1893", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5N4-1", "start_pos": 1893, "end_pos": 1893, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sidekick-1", "gene_name": "SDK1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2213, "chemical_mass": 242112.0 } ] }, { "start_pos": "1893", "site_seq": "N", "site_lbl": "Asn1893", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5N4-1", "start_pos": 1893, "end_pos": 1893, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sidekick-1", "gene_name": "SDK1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2213, "chemical_mass": 242112.0 } ] }, { "start_pos": "1893", "site_seq": "", "site_lbl": "N1893", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "7", "chr_pos": "4220247", "evidence": [ { "id": "rs149005994", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149005994" }, { "id": "rs149005994", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149005994" }, { "id": "rs149005994", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149005994" }, { "id": "rs149005994", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149005994#frequency_tab" }, { "id": "rs149005994", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149005994" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "7", "chr_pos": "4220247", "evidence": [ { "id": "rs149005994", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149005994" }, { "id": "rs149005994", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149005994" }, { "id": "rs149005994", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149005994" }, { "id": "rs149005994", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149005994#frequency_tab" }, { "id": "rs149005994", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149005994" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5N4-1", "start_pos": 1893, "end_pos": 1893, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein sidekick-1", "gene_name": "SDK1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2213, "chemical_mass": 242112.0 } ] }, { "start_pos": "1002", "site_seq": "SInVTGQGFSLIQR", "site_lbl": "Asn1002", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1002, "end_pos": 1002, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1002", "site_seq": "N", "site_lbl": "Asn1002", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1002, "end_pos": 1002, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1002", "site_seq": "SINVTGQGFSLIQR", "site_lbl": "Asn1002", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1002, "end_pos": 1002, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSnITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSNITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "70", "site_seq": "SGSLYMLCTGnSSHSSWDNQCQCTSSATR", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01589-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-2 receptor subunit alpha", "gene_name": "IL2RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 272, "chemical_mass": 30819.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01589-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-2 receptor subunit alpha", "gene_name": "IL2RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 272, "chemical_mass": 30819.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->ISS).", "chr_id": "10", "chr_pos": "6025881", "evidence": [ { "id": "P01589", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01589" }, { "id": "rs1172654832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172654832" }, { "id": "rs1172654832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172654832" }, { "id": "rs1172654832", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1172654832" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "10", "chr_pos": "6025881", "evidence": [ { "id": "P01589", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01589" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "10", "chr_pos": "6025881", "evidence": [ { "id": "rs1172654832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172654832" }, { "id": "rs1172654832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172654832" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01589-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-2 receptor subunit alpha", "gene_name": "IL2RA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 272, "chemical_mass": 30819.0 } ] }, { "start_pos": "937", "site_seq": "CnDTVPEDFEPFRR", "site_lbl": "Asn937", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 937, "end_pos": 937, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "937", "site_seq": "N", "site_lbl": "Asn937", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 937, "end_pos": 937, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "937", "site_seq": "CNDTVPEDFEPFRR", "site_lbl": "Asn937", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 937, "end_pos": 937, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] } ], "record_id": "G25079LO" }