{ "glytoucan_ac": "G23453IV", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "11520036", "url": "https://glygen.org/publication/PubMed/11520036" }, { "database": "PubMed", "id": "447724", "url": "https://glygen.org/publication/PubMed/447724" }, { "database": "PubMed", "id": "7295805", "url": "https://glygen.org/publication/PubMed/7295805" }, { "database": "PubMed", "id": "9254046", "url": "https://glygen.org/publication/PubMed/9254046" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "GlyConnect", "id": "426", "url": "https://glyconnect.expasy.org/browser/structures/426" }, { "database": "PubMed", "id": "10833030", "url": "https://glygen.org/publication/PubMed/10833030" }, { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "PubMed", "id": "6826553", "url": "https://glygen.org/publication/PubMed/6826553" }, { "database": "Subsumption", "id": "G86386QT", "url": "https://www.glygen.org/glycan/G86386QT" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 7227, "name": "Drosophila melanogaster", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "16897177", "url": "https://glygen.org/publication/PubMed/16897177" }, { "database": "PubMed", "id": "17264077", "url": "https://glygen.org/publication/PubMed/17264077" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" }, { "taxid": 10029, "name": "Cricetulus griseus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G64403MT", "url": "https://www.glygen.org/glycan/G64403MT" }, { "database": "Subsumption", "id": "G86386QT", "url": "https://www.glygen.org/glycan/G86386QT" }, { "database": "Subsumption", "id": "G91990UK", "url": "https://www.glygen.org/glycan/G91990UK" } ], "common_name": "Chinese hamster", "glygen_name": "Hamster", "reference_species": "Cricetulus griseus [10029]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G86386QT", "url": "https://www.glygen.org/glycan/G86386QT" }, { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" }, { "database": "PubMed", "id": "11469797", "url": "https://glygen.org/publication/PubMed/11469797" }, { "database": "PubMed", "id": "15316280", "url": "https://glygen.org/publication/PubMed/15316280" }, { "database": "PubMed", "id": "1555586", "url": "https://glygen.org/publication/PubMed/1555586" }, { "database": "PubMed", "id": "15557177", "url": "https://glygen.org/publication/PubMed/15557177" }, { "database": "PubMed", "id": "1577715", "url": "https://glygen.org/publication/PubMed/1577715" }, { "database": "PubMed", "id": "1904026", "url": "https://glygen.org/publication/PubMed/1904026" }, { "database": "PubMed", "id": "1967025", "url": "https://glygen.org/publication/PubMed/1967025" }, { "database": "PubMed", "id": "2110822", "url": "https://glygen.org/publication/PubMed/2110822" }, { "database": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" }, { "database": "PubMed", "id": "2297756", "url": "https://glygen.org/publication/PubMed/2297756" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" }, { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "25685702", "url": "https://glygen.org/publication/PubMed/25685702" }, { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29792883", "url": "https://glygen.org/publication/PubMed/29792883" }, { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "32310329", "url": "https://glygen.org/publication/PubMed/32310329" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" }, { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" }, { "database": "PubMed", "id": "39988192", "url": "https://glygen.org/publication/PubMed/39988192" }, { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "PubMed", "id": "4172099", "url": "https://glygen.org/publication/PubMed/4172099" }, { "database": "PubMed", "id": "6643471", "url": "https://glygen.org/publication/PubMed/6643471" }, { "database": "PubMed", "id": "7655165", "url": "https://glygen.org/publication/PubMed/7655165" }, { "database": "PubMed", "id": "7881178", "url": "https://glygen.org/publication/PubMed/7881178" }, { "database": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" }, { "database": "PubMed", "id": "8142896", "url": "https://glygen.org/publication/PubMed/8142896" }, { "database": "PubMed", "id": "8344278", "url": "https://glygen.org/publication/PubMed/8344278" }, { "database": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" }, { "database": "GlyGen", "id": "GLY_001408", "url": "https://data.glygen.org/GLY_001408" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G86386QT", "url": "https://www.glygen.org/glycan/G86386QT" }, { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" }, { "database": "PubMed", "id": "7906504", "url": "https://glygen.org/publication/PubMed/7906504" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "10782293", "url": "https://glygen.org/publication/PubMed/10782293" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "452", "url": "https://glyconnect.expasy.org/browser/compositions/452" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" }, { "taxid": 7955, "name": "Danio rerio", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G29451DX", "url": "https://www.glygen.org/glycan/G29451DX" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mass": 1275.46, "classification": [ { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Lacto series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Neo-lacto series" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Monoantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Truncated" } }, { "type": { "name": "O-linked", "url": "" }, "subtype": { "name": "Core 1", "url": "" } }, { "type": { "name": "O-linked", "url": "" }, "subtype": { "name": "Core 8" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 4, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "N144", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "144", "site_seq": "", "site_lbl": "N144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "105708020", "evidence": [ { "id": "P01876", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01876" }, { "id": "rs745327941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745327941" }, { "id": "rs745327941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745327941#frequency_tab" }, { "id": "rs745327941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745327941" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "14", "chr_pos": "105708021", "evidence": [ { "id": "rs1296586332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1296586332" }, { "id": "rs1296586332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1296586332" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01876-2", "start_pos": 144, "end_pos": 144, "residue": "N", "evidence": [ { "database": "PubMed", "id": "40667337", "url": "https://glygen.org/publication/PubMed/40667337" }, { "database": "TableMaker", "id": "TP5868669", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" } ], "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 398, "chemical_mass": 42849.0 } ] }, { "start_pos": "564", "site_seq": "N", "site_lbl": "Asn564", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24627-1", "start_pos": 564, "end_pos": 564, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "9254046", "url": "https://glygen.org/publication/PubMed/9254046" }, { "database": "GlyConnect", "id": "319", "url": "https://glyconnect.expasy.org/browser/proteins/319" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9913, "tax_name": "Bos taurus", "tax_common_name": "Bovine", "length": 708, "chemical_mass": 78056.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01012-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "19358553", "url": "https://glygen.org/publication/PubMed/19358553" }, { "database": "GlyConnect", "id": "475", "url": "https://glyconnect.expasy.org/browser/proteins/475" } ], "protein_name": "Ovalbumin", "gene_name": "SERPINB14", "tax_id": 9031, "tax_name": "Gallus gallus", "tax_common_name": "Chicken", "length": 386, "chemical_mass": 42881.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" }, { "database": "GlyConnect", "id": "671", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "31467031", "url": "https://glygen.org/publication/PubMed/31467031" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "1366", "site_seq": "ECYYNLNDASLCDNVLAPnVTK", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "1366", "site_seq": "KECYYNLNDASLCDNVLAPNVTK", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "1366", "site_seq": "", "site_lbl": "N1366", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "33360693", "evidence": [ { "id": "rs139331984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139331984" }, { "id": "rs139331984", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139331984" }, { "id": "rs139331984", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139331984" }, { "id": "rs139331984", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139331984#frequency_tab" }, { "id": "rs139331984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139331984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "33134893", "evidence": [ { "id": "Q14766", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14766" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "1366", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Abolishes N-glycosylation at this site without affecting ability to interact with the Latency-associated peptide chain (LAP) regulatory chain of TGFB1.", "evidence": [ { "database": "UniProtKB", "id": "Q14766", "url": "https://www.uniprot.org/uniprotkb/Q14766" }, { "database": "PubMed", "id": "8939931", "url": "https://glygen.org/publication/PubMed/8939931" }, { "database": "PubMed", "id": "8617200", "url": "https://glygen.org/publication/PubMed/8617200" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Abolishes N-glycosylation at this site without affecting ability to interact with the Latency-associated peptide chain (LAP) regulatory chain of TGFB1.", "evidence": [ { "database": "UniProtKB", "id": "Q14766", "url": "https://www.uniprot.org/uniprotkb/Q14766" }, { "database": "PubMed", "id": "8939931", "url": "https://glygen.org/publication/PubMed/8939931" }, { "database": "PubMed", "id": "8617200", "url": "https://glygen.org/publication/PubMed/8617200" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10677208", "url": "https://glygen.org/publication/PubMed/10677208" }, { "database": "GlyConnect", "id": "329", "url": "https://glyconnect.expasy.org/browser/proteins/329" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "1263", "site_seq": "N", "site_lbl": "Asn1263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 1263, "end_pos": 1263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "971", "site_seq": "N", "site_lbl": "Asn971", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 971, "end_pos": 971, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "1263", "site_seq": "", "site_lbl": "N1263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "122278921", "evidence": [ { "id": "rs2136222654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136222654" }, { "id": "rs2136222654", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136222654" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 1263, "end_pos": 1263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "585", "site_seq": "N", "site_lbl": "Asn585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13439-1", "start_pos": 585, "end_pos": 585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "690", "url": "https://glyconnect.expasy.org/browser/proteins/690" } ], "protein_name": "Golgin subfamily A member 4", "gene_name": "GOLGA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2230, "chemical_mass": 261140.0 } ] }, { "start_pos": "585", "site_seq": "", "site_lbl": "N585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS); n-glyco-sequon-gain (NKN->NKS).", "chr_id": "3", "chr_pos": "37323640", "evidence": [ { "id": "rs1362843640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1362843640" }, { "id": "rs1362843640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1362843640#frequency_tab" }, { "id": "rs1362843640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1362843640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->TQS); n-glyco-sequon-gain (NKN->NKT).", "chr_id": "NC_000003.12", "chr_pos": "37323640-37323641", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13439-1", "start_pos": 585, "end_pos": 585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "690", "url": "https://glyconnect.expasy.org/browser/proteins/690" } ], "protein_name": "Golgin subfamily A member 4", "gene_name": "GOLGA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2230, "chemical_mass": 261140.0 } ] }, { "start_pos": "625", "site_seq": "N", "site_lbl": "Asn625", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "771", "url": "https://glyconnect.expasy.org/browser/proteins/771" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "625", "site_seq": "", "site_lbl": "N625", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "13", "chr_pos": "28389890", "evidence": [ { "id": "rs764646845", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764646845" }, { "id": "rs764646845", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764646845" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "771", "url": "https://glyconnect.expasy.org/browser/proteins/771" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "503", "site_seq": "SVYnCSGEACR", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "503", "site_seq": "N", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "503", "site_seq": "SVYNCSGEACR", "site_lbl": "Asn503", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54802-1", "start_pos": 503, "end_pos": 503, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "803", "url": "https://glyconnect.expasy.org/browser/proteins/803" } ], "protein_name": "Alpha-N-acetylglucosaminidase", "gene_name": "NAGLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 743, "chemical_mass": 82266.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "105643755", "evidence": [ { "id": "rs1172977375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172977375" }, { "id": "rs1172977375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172977375" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "105643753", "evidence": [ { "id": "rs1411068751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411068751" }, { "id": "rs1411068751", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411068751#frequency_tab" }, { "id": "rs1411068751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411068751" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105643754", "evidence": [ { "id": "rs2087481484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087481484" }, { "id": "rs2087481484", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2087481484" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "", "site_lbl": "N207", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "16", "chr_pos": "72060289", "evidence": [ { "id": "rs761396788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761396788#frequency_tab" }, { "id": "rs761396788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761396788" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23829323", "url": "https://glygen.org/publication/PubMed/23829323" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "344", "site_seq": "SGTIFDNFLITNDEAYAEEFGnETWGVTK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "344", "site_seq": "", "site_lbl": "N344", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "19", "chr_pos": "12943606", "evidence": [ { "id": "rs1477630481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477630481" }, { "id": "rs1477630481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477630481" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "19", "chr_pos": "12943607", "evidence": [ { "id": "rs755626585", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755626585" }, { "id": "rs755626585", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755626585#frequency_tab" }, { "id": "rs755626585", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755626585" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27797-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1060", "url": "https://glyconnect.expasy.org/browser/proteins/1060" } ], "protein_name": "Calreticulin", "gene_name": "CALR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 48142.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGnVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "N", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGNVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16842-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1119", "url": "https://glyconnect.expasy.org/browser/proteins/1119" } ], "protein_name": "CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2", "gene_name": "ST3GAL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40173.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs N-glycosylation. Impairs exit from the endoplasmic reticulum. Decreases sialyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q16842", "url": "https://www.uniprot.org/uniprotkb/Q16842" }, { "database": "PubMed", "id": "25916169", "url": "https://glygen.org/publication/PubMed/25916169" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16842-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1119", "url": "https://glyconnect.expasy.org/browser/proteins/1119" } ], "protein_name": "CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2", "gene_name": "ST3GAL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 40173.0 } ] }, { "start_pos": "804", "site_seq": "nVTAQICIDK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "N", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "NVTAQICIDKK", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "804", "site_seq": "", "site_lbl": "N804", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "21", "chr_pos": "46002687", "evidence": [ { "id": "rs750677189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750677189" }, { "id": "rs750677189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750677189#frequency_tab" }, { "id": "rs750677189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750677189" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12109-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1129", "url": "https://glyconnect.expasy.org/browser/proteins/1129" } ], "protein_name": "Collagen alpha-1(VI) chain", "gene_name": "COL6A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1028, "chemical_mass": 108529.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "MLEAYnLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "N", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "IEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "", "site_lbl": "N1763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "6", "chr_pos": "75137543", "evidence": [ { "id": "rs755536829", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755536829#frequency_tab" }, { "id": "rs755536829", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755536829" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "", "site_lbl": "N2528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "6", "chr_pos": "75115897", "evidence": [ { "id": "rs2149361441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2149361441" }, { "id": "rs2149361441", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2149361441" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "6", "chr_pos": "75115898", "evidence": [ { "id": "rs1168175119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168175119" }, { "id": "rs1168175119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168175119#frequency_tab" }, { "id": "rs1168175119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1168175119" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1169", "url": "https://glyconnect.expasy.org/browser/proteins/1169" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "446", "site_seq": "GLFTnGSCADIK", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41180-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1227", "url": "https://glyconnect.expasy.org/browser/proteins/1227" } ], "protein_name": "Extracellular calcium-sensing receptor", "gene_name": "CASR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1078, "chemical_mass": 120675.0 } ] }, { "start_pos": "446", "site_seq": "N", "site_lbl": "Asn446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41180-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1227", "url": "https://glyconnect.expasy.org/browser/proteins/1227" } ], "protein_name": "Extracellular calcium-sensing receptor", "gene_name": "CASR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1078, "chemical_mass": 120675.0 } ] }, { "start_pos": "446", "site_seq": "", "site_lbl": "N446", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "122262372", "evidence": [ { "id": "rs1553766925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553766925" }, { "id": "rs1553766925", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1553766925" } ], "disease": [ { "disease_id": "DOID:0090107", "name": "autosomal dominant hypocalcemia 1", "description": "An autosomal dominant hypocalcemia disease that has_material_basis_in heterozygous mutation in the calcium sensing receptor gene (CASR) on chromosome 3q21.", "url": "http://disease-ontology.org/term/DOID:0090107", "evidence": [ { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" }, { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" } ] }, { "disease_id": "DOID:0090107", "name": "autosomal dominant hypocalcemia 1", "description": "An autosomal dominant hypocalcemia disease that has_material_basis_in heterozygous mutation in the calcium sensing receptor gene (CASR) on chromosome 3q21.", "url": "http://disease-ontology.org/term/DOID:0090107", "evidence": [ { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" }, { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" } ] }, { "disease_id": "DOID:0090109", "name": "autosomal dominant hypocalcemia", "description": "A metal metabolism disorder characterized by autosomal dominant inheritance of variable degrees of hypocalcemia with normal to low levels of parathyroid hormone.", "url": "http://disease-ontology.org/term/DOID:0090109", "evidence": [ { "id": "0090109", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090109" } ] }, { "disease_id": "DOID:0090109", "name": "autosomal dominant hypocalcemia", "description": "A metal metabolism disorder characterized by autosomal dominant inheritance of variable degrees of hypocalcemia with normal to low levels of parathyroid hormone.", "url": "http://disease-ontology.org/term/DOID:0090109", "evidence": [ { "id": "0090109", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090109" } ] }, { "disease_id": "DOID:0090107", "name": "autosomal dominant hypocalcemia 1", "description": "An autosomal dominant hypocalcemia disease that has_material_basis_in heterozygous mutation in the calcium sensing receptor gene (CASR) on chromosome 3q21.", "url": "http://disease-ontology.org/term/DOID:0090107", "evidence": [ { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" }, { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" } ] }, { "disease_id": "DOID:0090107", "name": "autosomal dominant hypocalcemia 1", "description": "An autosomal dominant hypocalcemia disease that has_material_basis_in heterozygous mutation in the calcium sensing receptor gene (CASR) on chromosome 3q21.", "url": "http://disease-ontology.org/term/DOID:0090107", "evidence": [ { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" }, { "id": "0090107", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090107" } ] }, { "disease_id": "DOID:0090109", "name": "autosomal dominant hypocalcemia", "description": "A metal metabolism disorder characterized by autosomal dominant inheritance of variable degrees of hypocalcemia with normal to low levels of parathyroid hormone.", "url": "http://disease-ontology.org/term/DOID:0090109", "evidence": [ { "id": "0090109", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090109" } ] }, { "disease_id": "DOID:0090109", "name": "autosomal dominant hypocalcemia", "description": "A metal metabolism disorder characterized by autosomal dominant inheritance of variable degrees of hypocalcemia with normal to low levels of parathyroid hormone.", "url": "http://disease-ontology.org/term/DOID:0090109", "evidence": [ { "id": "0090109", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090109" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41180-1", "start_pos": 446, "end_pos": 446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1227", "url": "https://glyconnect.expasy.org/browser/proteins/1227" } ], "protein_name": "Extracellular calcium-sensing receptor", "gene_name": "CASR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1078, "chemical_mass": 120675.0 } ] }, { "start_pos": "530", "site_seq": "N", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "530", "site_seq": "GQGEQGSTGGTNISSTSEPK", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "530", "site_seq": "GQGEQGSTGGTnISSTSEPKEE", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "530", "site_seq": "", "site_lbl": "N530", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->HIS).", "chr_id": "1", "chr_pos": "150513432", "evidence": [ { "id": "Q16610", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16610" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "150513433", "evidence": [ { "id": "rs1670498310", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1670498310" }, { "id": "rs1670498310", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1670498310#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1228", "url": "https://glyconnect.expasy.org/browser/proteins/1228" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "263", "site_seq": "LDGSTnFTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1241", "url": "https://glyconnect.expasy.org/browser/proteins/1241" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1241", "url": "https://glyconnect.expasy.org/browser/proteins/1241" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "7", "chr_pos": "77196811", "evidence": [ { "id": "Q14314", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14314" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1241", "url": "https://glyconnect.expasy.org/browser/proteins/1241" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "900", "site_seq": "AnVTSENNMPR", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "N", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "ANVTSENNMPR", "site_lbl": "Asn900", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "900", "site_seq": "", "site_lbl": "N900", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "16", "chr_pos": "31326927", "evidence": [ { "id": "rs553934657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs553934657" }, { "id": "rs553934657", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs553934657" }, { "id": "rs553934657", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs553934657" }, { "id": "rs553934657", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs553934657#frequency_tab" }, { "id": "rs553934657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs553934657" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "16", "chr_pos": "31326926", "evidence": [ { "id": "rs755367569", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755367569" }, { "id": "rs755367569", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755367569" }, { "id": "rs755367569", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755367569#frequency_tab" }, { "id": "rs755367569", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755367569" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11215-1", "start_pos": 900, "end_pos": 900, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1411", "url": "https://glyconnect.expasy.org/browser/proteins/1411" } ], "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1152, "chemical_mass": 127179.0 } ] }, { "start_pos": "2007", "site_seq": "ITLHEnR", "site_lbl": "Asn2007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2007", "site_seq": "N", "site_lbl": "Asn2007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "ITVHGnGSLDIR", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "N", "site_lbl": "Asn2500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2007", "site_seq": "", "site_lbl": "N2007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "X", "chr_pos": "3317662", "evidence": [ { "id": "rs1921185417", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921185417" }, { "id": "rs1921185417", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921185417#frequency_tab" }, { "id": "rs1921185417", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1921185417" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2007, "end_pos": 2007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "2500", "site_seq": "", "site_lbl": "N2500", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "23", "chr_pos": "3310703", "evidence": [ { "id": "Q9NR99", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9NR99" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR99-1", "start_pos": 2500, "end_pos": 2500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1495", "url": "https://glyconnect.expasy.org/browser/proteins/1495" } ], "protein_name": "Matrix-remodeling-associated protein 5", "gene_name": "MXRA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2828, "chemical_mass": 312150.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSRR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQNMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "22", "chr_pos": "50287693", "evidence": [ { "id": "rs920837059", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs920837059" }, { "id": "rs920837059", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs920837059" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1613", "url": "https://glyconnect.expasy.org/browser/proteins/1613" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "216", "site_seq": "N", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYnVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "IVTPEEYYNVTVQ", "site_lbl": "Asn216", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "216", "site_seq": "", "site_lbl": "N216", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "1", "chr_pos": "167546113", "evidence": [ { "id": "rs144088168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144088168" }, { "id": "rs144088168", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144088168" }, { "id": "rs144088168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144088168#frequency_tab" }, { "id": "rs144088168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144088168" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "1", "chr_pos": "167546112", "evidence": [ { "id": "rs748757226", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748757226" }, { "id": "rs748757226", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748757226#frequency_tab" }, { "id": "rs748757226", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748757226" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "1", "chr_pos": "167546114", "evidence": [ { "id": "rs1399559749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399559749" }, { "id": "rs1399559749", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1399559749#frequency_tab" }, { "id": "rs1399559749", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399559749" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75629-1", "start_pos": 216, "end_pos": 216, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1653", "url": "https://glyconnect.expasy.org/browser/proteins/1653" } ], "protein_name": "Protein CREG1", "gene_name": "CREG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 220, "chemical_mass": 24075.0 } ] }, { "start_pos": "562", "site_seq": "N", "site_lbl": "Asn562", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95171-1", "start_pos": 562, "end_pos": 562, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1724", "url": "https://glyconnect.expasy.org/browser/proteins/1724" } ], "protein_name": "Sciellin", "gene_name": "SCEL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 688, "chemical_mass": 77552.0 } ] }, { "start_pos": "562", "site_seq": "", "site_lbl": "N562", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "13", "chr_pos": "77628004", "evidence": [ { "id": "rs754106670", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754106670" }, { "id": "rs754106670", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754106670" }, { "id": "rs754106670", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754106670#frequency_tab" }, { "id": "rs754106670", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754106670" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95171-1", "start_pos": 562, "end_pos": 562, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1724", "url": "https://glyconnect.expasy.org/browser/proteins/1724" } ], "protein_name": "Sciellin", "gene_name": "SCEL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 688, "chemical_mass": 77552.0 } ] }, { "start_pos": "330", "site_seq": "FFAEnETWVVDSCTTCTCK", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1805", "url": "https://glyconnect.expasy.org/browser/proteins/1805" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "330", "site_seq": "N", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1805", "url": "https://glyconnect.expasy.org/browser/proteins/1805" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "156015013", "evidence": [ { "id": "rs762299406", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762299406" }, { "id": "rs762299406", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762299406" }, { "id": "rs762299406", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762299406#frequency_tab" }, { "id": "rs762299406", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762299406" }, { "id": "rs762299406", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs762299406" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43308-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1840", "url": "https://glyconnect.expasy.org/browser/proteins/1840" } ], "protein_name": "Translocon-associated protein subunit beta", "gene_name": "SSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 183, "chemical_mass": 20135.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "NTTYQLGQSEYLNVLQPQQ", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "", "site_lbl": "N256", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "7", "chr_pos": "12231917", "evidence": [ { "id": "rs1782033094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1782033094" }, { "id": "rs1782033094", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1782033094" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "128", "site_seq": "LnYTLSQGHR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "128", "site_seq": "KLnYTLSQGHR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "128", "site_seq": "KLNYTLSQGHR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "815", "url": "https://glyconnect.expasy.org/browser/proteins/815" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "995", "url": "https://glyconnect.expasy.org/browser/proteins/995" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "297", "site_seq": "N", "site_lbl": "Asn297", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 297, "end_pos": 297, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1120", "url": "https://glyconnect.expasy.org/browser/proteins/1120" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "752", "site_seq": "N", "site_lbl": "Asn752", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 752, "end_pos": 752, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32310329", "url": "https://glygen.org/publication/PubMed/32310329" }, { "database": "GlyConnect", "id": "1120", "url": "https://glyconnect.expasy.org/browser/proteins/1120" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TDY8-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1944", "url": "https://glyconnect.expasy.org/browser/proteins/1944" } ], "protein_name": "Immunoglobulin superfamily DCC subclass member 4", "gene_name": "IGDCC4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1250, "chemical_mass": 134210.0 } ] }, { "start_pos": "483", "site_seq": "", "site_lbl": "N483", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "15", "chr_pos": "65395221", "evidence": [ { "id": "rs745994988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745994988" }, { "id": "rs745994988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745994988" }, { "id": "rs745994988", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745994988#frequency_tab" }, { "id": "rs745994988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745994988" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TDY8-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "1944", "url": "https://glyconnect.expasy.org/browser/proteins/1944" } ], "protein_name": "Immunoglobulin superfamily DCC subclass member 4", "gene_name": "IGDCC4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1250, "chemical_mass": 134210.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFI4-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "2066", "url": "https://glyconnect.expasy.org/browser/proteins/2066" } ], "protein_name": "Putative protein FAM10A5", "gene_name": "ST13P5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 369, "chemical_mass": 41378.0 } ] }, { "start_pos": "3411", "site_seq": "N", "site_lbl": "Asn3411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3411", "site_seq": "FVEGSHnSTVSLTTK", "site_lbl": "Asn3411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3411", "site_seq": "", "site_lbl": "N3411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "21006635", "evidence": [ { "id": "P04114", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04114" }, { "id": "rs771372599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771372599" }, { "id": "rs771372599", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771372599" }, { "id": "rs771372599", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771372599#frequency_tab" }, { "id": "rs771372599", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771372599" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary.", "url": "http://disease-ontology.org/term/DOID:2394", "evidence": [ { "id": "2394", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "2", "chr_pos": "21006636", "evidence": [ { "id": "rs773958267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773958267" }, { "id": "rs773958267", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773958267" }, { "id": "rs773958267", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773958267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3411, "end_pos": 3411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "726", "url": "https://glyconnect.expasy.org/browser/proteins/726" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "HAnWTLTPLK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "726", "url": "https://glyconnect.expasy.org/browser/proteins/726" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "7", "chr_pos": "95306308", "evidence": [ { "id": "rs762779494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762779494#frequency_tab" }, { "id": "rs762779494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762779494" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "7", "chr_pos": "95306306", "evidence": [ { "id": "P27169", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27169" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "7", "chr_pos": "95306307", "evidence": [ { "id": "rs1807539623", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1807539623" }, { "id": "rs1807539623", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1807539623" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" }, { "database": "GlyConnect", "id": "726", "url": "https://glyconnect.expasy.org/browser/proteins/726" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "105855049", "evidence": [ { "id": "rs1555378058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555378058" }, { "id": "rs1555378058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555378058" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "14", "chr_pos": "105855048", "evidence": [ { "id": "rs1248268985", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248268985" }, { "id": "rs1248268985", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1248268985#frequency_tab" }, { "id": "rs1248268985", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248268985" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "25802287", "url": "https://glygen.org/publication/PubMed/25802287" }, { "database": "GlyConnect", "id": "280", "url": "https://glyconnect.expasy.org/browser/proteins/280" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "1105", "site_seq": "VNSSLHSQISR", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "1105", "site_seq": "N", "site_lbl": "Asn1105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02468-1", "start_pos": 1105, "end_pos": 1105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2461", "url": "https://glyconnect.expasy.org/browser/proteins/2461" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "Lamc1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1607, "chemical_mass": 177298.0 } ] }, { "start_pos": "202", "site_seq": "N", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKF6-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2528", "url": "https://glyconnect.expasy.org/browser/proteins/2528" } ], "protein_name": "Nectin-1", "gene_name": "Nectin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57035.0 } ] }, { "start_pos": "202", "site_seq": "NPNGTVTVISR", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKF6-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2528", "url": "https://glyconnect.expasy.org/browser/proteins/2528" } ], "protein_name": "Nectin-1", "gene_name": "Nectin1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 515, "chemical_mass": 57035.0 } ] }, { "start_pos": "293", "site_seq": "N", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "293", "site_seq": "VIYQNHNK", "site_lbl": "Asn293", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 293, "end_pos": 293, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "228", "site_seq": "N", "site_lbl": "Asn228", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 228, "end_pos": 228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "228", "site_seq": "ANATIEVK", "site_lbl": "Asn228", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97300-2", "start_pos": 228, "end_pos": 228, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2557", "url": "https://glyconnect.expasy.org/browser/proteins/2557" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 397, "chemical_mass": 44373.0 } ] }, { "start_pos": "2128", "site_seq": "N", "site_lbl": "Asn2128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2128, "end_pos": 2128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "2128", "site_seq": "DNATDSVPLR", "site_lbl": "Asn2128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 2128, "end_pos": 2128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "240", "site_seq": "QTTAMDFSYANETVCWVHVGDSAAQTQLK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "793", "site_seq": "N", "site_lbl": "Asn793", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TPD3-1", "start_pos": 793, "end_pos": 793, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2688", "url": "https://glyconnect.expasy.org/browser/proteins/2688" } ], "protein_name": "Roundabout homolog 2", "gene_name": "Robo2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1470, "chemical_mass": 161190.0 } ] }, { "start_pos": "793", "site_seq": "FHINKTVDAAIR", "site_lbl": "Asn793", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TPD3-1", "start_pos": 793, "end_pos": 793, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2688", "url": "https://glyconnect.expasy.org/browser/proteins/2688" } ], "protein_name": "Roundabout homolog 2", "gene_name": "Robo2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1470, "chemical_mass": 161190.0 } ] }, { "start_pos": "168", "site_seq": "N", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "168", "site_seq": "VNFTCKSHGFSPR", "site_lbl": "Asn168", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 168, "end_pos": 168, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "153", "site_seq": "RACQFNR", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "VINFYAGANQSMNVTCVGK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "197", "site_seq": "VINFYAGANQSMNVTCVGKRPQHYR", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14231-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2728", "url": "https://glyconnect.expasy.org/browser/proteins/2728" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 290, "chemical_mass": 33344.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64676-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2096", "url": "https://glyconnect.expasy.org/browser/proteins/2096" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "Ugt8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 541, "chemical_mass": 61249.0 } ] }, { "start_pos": "442", "site_seq": "LSEIHKDQPGHPVNR", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64676-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2096", "url": "https://glyconnect.expasy.org/browser/proteins/2096" } ], "protein_name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase", "gene_name": "Ugt8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 541, "chemical_mass": 61249.0 } ] }, { "start_pos": "671", "site_seq": "N", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "671", "site_seq": "ANYNLPIMVTDSGKPPMTNITDLR", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9WTR5-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2166", "url": "https://glyconnect.expasy.org/browser/proteins/2166" } ], "protein_name": "Cadherin-13", "gene_name": "Cdh13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 714, "chemical_mass": 78186.0 } ] }, { "start_pos": "258", "site_seq": "LAYATINDSR", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "258", "site_seq": "N", "site_lbl": "Asn258", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "258", "site_seq": "", "site_lbl": "N258", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->YDS).", "chr_id": "5", "chr_pos": "27836448", "evidence": [ { "id": "rs3388734770", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388734770" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 258, "end_pos": 258, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2255", "url": "https://glyconnect.expasy.org/browser/proteins/2255" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] } ], "record_id": "G23453IV" }