{ "glytoucan_ac": "G21891JQ", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 3554.27, "classification": [ { "type": { "name": "Other", "url": "" }, "subtype": { "name": "Other", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 10, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 8, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "583", "site_seq": "EIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVR", "site_lbl": "Asn583", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43246-1", "start_pos": 583, "end_pos": 583, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "DNA mismatch repair protein Msh2", "gene_name": "MSH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 934, "chemical_mass": 104743.0 } ] }, { "start_pos": "583", "site_seq": "", "site_lbl": "N583", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "NC_000002.12", "chr_pos": "47471050", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "2", "chr_pos": "47471051", "evidence": [ { "id": "rs201118107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201118107#frequency_tab" }, { "id": "rs201118107", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201118107" } ], "disease": [ { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "2", "chr_pos": "47471052", "evidence": [ { "id": "rs876659176", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs876659176" }, { "id": "rs876659176", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs876659176" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "2", "chr_pos": "47471051", "evidence": [ { "id": "rs201118107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201118107#frequency_tab" }, { "id": "rs201118107", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201118107" }, { "id": "rs201118107", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201118107" } ], "disease": [ { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] }, { "disease_id": "DOID:0112182", "name": "mismatch repair cancer syndrome", "description": "A syndrome characterized by predisposition for development of a broad spectrum of malignancies during childhood, including mainly brain, hematological and gastrointestinal cancers that has_material_basis_in homozygous or compound heterozygous mutation in the mismatch repair genes MLH1, MSH2, MSH6, or PMS2 on chromosomes 3p22.2, 2p21-p16, 2p16.3, and 7p22.1, respectively.", "url": "http://disease-ontology.org/term/DOID:0112182", "evidence": [ { "id": "0112182", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112182" } ] }, { "disease_id": "DOID:0112182", "name": "mismatch repair cancer syndrome", "description": "A syndrome characterized by predisposition for development of a broad spectrum of malignancies during childhood, including mainly brain, hematological and gastrointestinal cancers that has_material_basis_in homozygous or compound heterozygous mutation in the mismatch repair genes MLH1, MSH2, MSH6, or PMS2 on chromosomes 3p22.2, 2p21-p16, 2p16.3, and 7p22.1, respectively.", "url": "http://disease-ontology.org/term/DOID:0112182", "evidence": [ { "id": "0112182", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112182" } ] }, { "disease_id": "DOID:0112182", "name": "mismatch repair cancer syndrome", "description": "A syndrome characterized by predisposition for development of a broad spectrum of malignancies during childhood, including mainly brain, hematological and gastrointestinal cancers that has_material_basis_in homozygous or compound heterozygous mutation in the mismatch repair genes MLH1, MSH2, MSH6, or PMS2 on chromosomes 3p22.2, 2p21-p16, 2p16.3, and 7p22.1, respectively.", "url": "http://disease-ontology.org/term/DOID:0112182", "evidence": [ { "id": "0112182", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112182" } ] }, { "disease_id": "DOID:0112182", "name": "mismatch repair cancer syndrome", "description": "A syndrome characterized by predisposition for development of a broad spectrum of malignancies during childhood, including mainly brain, hematological and gastrointestinal cancers that has_material_basis_in homozygous or compound heterozygous mutation in the mismatch repair genes MLH1, MSH2, MSH6, or PMS2 on chromosomes 3p22.2, 2p21-p16, 2p16.3, and 7p22.1, respectively.", "url": "http://disease-ontology.org/term/DOID:0112182", "evidence": [ { "id": "0112182", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112182" } ] }, { "disease_id": "DOID:0112182", "name": "mismatch repair cancer syndrome", "description": "A syndrome characterized by predisposition for development of a broad spectrum of malignancies during childhood, including mainly brain, hematological and gastrointestinal cancers that has_material_basis_in homozygous or compound heterozygous mutation in the mismatch repair genes MLH1, MSH2, MSH6, or PMS2 on chromosomes 3p22.2, 2p21-p16, 2p16.3, and 7p22.1, respectively.", "url": "http://disease-ontology.org/term/DOID:0112182", "evidence": [ { "id": "0112182", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112182" } ] }, { "disease_id": "DOID:0050465", "name": "Muir-Torre syndrome", "description": "A Lynch syndrome that is characterized by a propensity to develop cancers of the gastrointestinal tract, genitourinary tract, and skin that has_material_basis_in mutations in DNA mismatch repair genes.", "url": "http://disease-ontology.org/term/DOID:0050465", "evidence": [ { "id": "0050465", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050465" } ] }, { "disease_id": "DOID:0050465", "name": "Muir-Torre syndrome", "description": "A Lynch syndrome that is characterized by a propensity to develop cancers of the gastrointestinal tract, genitourinary tract, and skin that has_material_basis_in mutations in DNA mismatch repair genes.", "url": "http://disease-ontology.org/term/DOID:0050465", "evidence": [ { "id": "0050465", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050465" } ] }, { "disease_id": "DOID:0050465", "name": "Muir-Torre syndrome", "description": "A Lynch syndrome that is characterized by a propensity to develop cancers of the gastrointestinal tract, genitourinary tract, and skin that has_material_basis_in mutations in DNA mismatch repair genes.", "url": "http://disease-ontology.org/term/DOID:0050465", "evidence": [ { "id": "0050465", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050465" } ] }, { "disease_id": "DOID:0050465", "name": "Muir-Torre syndrome", "description": "A Lynch syndrome that is characterized by a propensity to develop cancers of the gastrointestinal tract, genitourinary tract, and skin that has_material_basis_in mutations in DNA mismatch repair genes.", "url": "http://disease-ontology.org/term/DOID:0050465", "evidence": [ { "id": "0050465", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050465" } ] }, { "disease_id": "DOID:0050465", "name": "Muir-Torre syndrome", "description": "A Lynch syndrome that is characterized by a propensity to develop cancers of the gastrointestinal tract, genitourinary tract, and skin that has_material_basis_in mutations in DNA mismatch repair genes.", "url": "http://disease-ontology.org/term/DOID:0050465", "evidence": [ { "id": "0050465", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050465" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "2", "chr_pos": "47471051", "evidence": [ { "id": "rs201118107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201118107" }, { "id": "rs201118107", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201118107#frequency_tab" }, { "id": "rs201118107", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201118107" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "2", "chr_pos": "47471050", "evidence": [ { "id": "rs2104279683", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2104279683" }, { "id": "rs2104279683", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2104279683" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->nullIS).", "chr_id": "2", "chr_pos": "47471050_47471051", "evidence": [ { "id": "rs1553367687", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553367687" } ], "disease": [ { "disease_id": "DOID:3883", "name": "Lynch syndrome", "description": "A syndrome that is characterized by an increased risk for colon cancer and cancers of the endometrium, ovary, stomach, small intestine, hepatobiliary tract, urinary tract, brain, and skin and has_material_basis_in mutation of mismatch repair genes that increases the risk of many types of cancers.", "url": "http://disease-ontology.org/term/DOID:3883", "evidence": [ { "id": "3883", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3883" } ] }, { "disease_id": "DOID:0070271", "name": "Lynch syndrome 1", "description": "A Lynch syndrome that has_material_basis_in heterozygous mutations in the MSH2 gene on chromosome 2p21-p16.", "url": "http://disease-ontology.org/term/DOID:0070271", "evidence": [ { "id": "120435", "database": "MIM", "url": "https://www.omim.org/entry/120435" }, { "id": "0070271", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070271" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43246-1", "start_pos": 583, "end_pos": 583, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "DNA mismatch repair protein Msh2", "gene_name": "MSH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 934, "chemical_mass": 104743.0 } ] }, { "start_pos": "80", "site_seq": "SYIFIYDGNKNSTTTDQNFTSAK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "2664", "site_seq": "KMAILTILDDSEPEDNESILVR", "site_lbl": "Asn2664", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VHN7-1", "start_pos": 2664, "end_pos": 2664, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G-protein coupled receptor V1", "gene_name": "Adgrv1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 6298, "chemical_mass": 687458.0 } ] }, { "start_pos": "2664", "site_seq": "", "site_lbl": "N2664", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->IES).", "chr_id": "13", "chr_pos": "81666224", "evidence": [ { "id": "rs3389293430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389293430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8VHN7-1", "start_pos": 2664, "end_pos": 2664, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G-protein coupled receptor V1", "gene_name": "Adgrv1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 6298, "chemical_mass": 687458.0 } ] }, { "start_pos": "190", "site_seq": "NEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLK", "site_lbl": "Asn190", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEK0-1", "start_pos": 190, "end_pos": 190, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "Tmem30a", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 364, "chemical_mass": 41061.0 } ] } ], "record_id": "G21891JQ" }