{ "glytoucan_ac": "G20528HD", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "Subsumption", "id": "G60070LT", "url": "https://www.glygen.org/glycan/G60070LT" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G41786IU", "url": "https://www.glygen.org/glycan/G41786IU" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G60070LT", "url": "https://www.glygen.org/glycan/G60070LT" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" }, { "taxid": 7955, "name": "Danio rerio", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G90155NY", "url": "https://www.glygen.org/glycan/G90155NY" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mass": 2483.9, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "256", "site_seq": "TVTnTTVEDETETNEVQGFLFGK", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU1-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 2", "gene_name": "UGGT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1516, "chemical_mass": 174735.0 } ] }, { "start_pos": "256", "site_seq": "ALDDTQVKTVTNTTVEDETETNEVQGFLFGK", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU1-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 2", "gene_name": "UGGT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1516, "chemical_mass": 174735.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU1-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 2", "gene_name": "UGGT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1516, "chemical_mass": 174735.0 } ] }, { "start_pos": "231", "site_seq": "GSCVNNSKEEDPPR", "site_lbl": "Asn231", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29319-1", "start_pos": 231, "end_pos": 231, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Ephrin type-A receptor 3", "gene_name": "Epha3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 983, "chemical_mass": 109955.0 } ] }, { "start_pos": "231", "site_seq": "N", "site_lbl": "Asn231", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29319-1", "start_pos": 231, "end_pos": 231, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Ephrin type-A receptor 3", "gene_name": "Epha3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 983, "chemical_mass": 109955.0 } ] }, { "start_pos": "166", "site_seq": "NQKDEINETDLK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10852-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 526, "chemical_mass": 58337.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10852-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 526, "chemical_mass": 58337.0 } ] }, { "start_pos": "607", "site_seq": "NATGLILR", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UHD1-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1582, "chemical_mass": 173297.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UHD1-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1582, "chemical_mass": 173297.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60928-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "Ggt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 568, "chemical_mass": 61563.0 } ] }, { "start_pos": "343", "site_seq": "NMSSEFYATQLR", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60928-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "Ggt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 568, "chemical_mass": 61563.0 } ] }, { "start_pos": "507", "site_seq": "LSNLVPGNYTFR", "site_lbl": "Asn507", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZV5-1", "start_pos": 507, "end_pos": 507, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Dyslexia-associated protein KIAA0319 homolog", "gene_name": "Kiaa0319", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1081, "chemical_mass": 117988.0 } ] }, { "start_pos": "507", "site_seq": "N", "site_lbl": "Asn507", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZV5-1", "start_pos": 507, "end_pos": 507, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Dyslexia-associated protein KIAA0319 homolog", "gene_name": "Kiaa0319", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1081, "chemical_mass": 117988.0 } ] }, { "start_pos": "202", "site_seq": "IAVISDMAFQNLTSLER", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLU0-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane protein FLRT2", "gene_name": "Flrt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 660, "chemical_mass": 73948.0 } ] }, { "start_pos": "202", "site_seq": "N", "site_lbl": "Asn202", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLU0-1", "start_pos": 202, "end_pos": 202, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane protein FLRT2", "gene_name": "Flrt2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 660, "chemical_mass": 73948.0 } ] }, { "start_pos": "397", "site_seq": "KINSSLQLPDR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "615", "site_seq": "LWVHNGAPVNASASCR", "site_lbl": "Asn615", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 615, "end_pos": 615, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "615", "site_seq": "N", "site_lbl": "Asn615", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q62179-1", "start_pos": 615, "end_pos": 615, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4B", "gene_name": "Sema4b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 823, "chemical_mass": 91392.0 } ] }, { "start_pos": "452", "site_seq": "AVNFNGSAGTPVTFNENGDAPGR", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47743-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 8", "gene_name": "Grm8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 908, "chemical_mass": 101828.0 } ] }, { "start_pos": "452", "site_seq": "N", "site_lbl": "Asn452", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47743-1", "start_pos": 452, "end_pos": 452, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 8", "gene_name": "Grm8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 908, "chemical_mass": 101828.0 } ] }, { "start_pos": "299", "site_seq": "ILFAPDTNFTR", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91V24-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-binding cassette sub-family A member 7", "gene_name": "Abca7", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2159, "chemical_mass": 236884.0 } ] }, { "start_pos": "74", "site_seq": "VELVAMNETDPK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01097-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1482, "chemical_mass": 165959.0 } ] }, { "start_pos": "760", "site_seq": "GPPLPPAHVHAESNSSTSIWLR", "site_lbl": "Asn760", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQS9-1", "start_pos": 760, "end_pos": 760, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily DCC subclass member 4", "gene_name": "Igdcc4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1252, "chemical_mass": 134765.0 } ] }, { "start_pos": "760", "site_seq": "", "site_lbl": "N760", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "9", "chr_pos": "65037901", "evidence": [ { "id": "rs3389050136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389050136" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9EQS9-1", "start_pos": 760, "end_pos": 760, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily DCC subclass member 4", "gene_name": "Igdcc4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1252, "chemical_mass": 134765.0 } ] }, { "start_pos": "40", "site_seq": "GTDNITVR", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLK3-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Limbic system-associated membrane protein", "gene_name": "Lsamp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 38086.0 } ] }, { "start_pos": "40", "site_seq": "N", "site_lbl": "Asn40", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLK3-1", "start_pos": 40, "end_pos": 40, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Limbic system-associated membrane protein", "gene_name": "Lsamp", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 38086.0 } ] }, { "start_pos": "265", "site_seq": "ANVTFTLSK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60943-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-17 receptor A", "gene_name": "Il17ra", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 864, "chemical_mass": 97808.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60943-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-17 receptor A", "gene_name": "Il17ra", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 864, "chemical_mass": 97808.0 } ] }, { "start_pos": "372", "site_seq": "WELNAMTTNSNISR", "site_lbl": "Asn372", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VEM9-1", "start_pos": 372, "end_pos": 372, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Kelch domain-containing protein 3", "gene_name": "Klhdc3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 382, "chemical_mass": 43082.0 } ] }, { "start_pos": "1008", "site_seq": "NTSLSSSAIYK", "site_lbl": "Asn1008", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0V8T8-1", "start_pos": 1008, "end_pos": 1008, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-associated protein like 5-2", "gene_name": "Cntnap5b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1292, "chemical_mass": 144260.0 } ] }, { "start_pos": "30", "site_seq": "EPGSSGPQNLSGPGGRER", "site_lbl": "Asn30", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9DB90-1", "start_pos": 30, "end_pos": 30, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Nonsense-mediated mRNA decay factor SMG9", "gene_name": "Smg9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 520, "chemical_mass": 57621.0 } ] }, { "start_pos": "121", "site_seq": "NYLGEAVSHNASLEVAILR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89026-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Roundabout homolog 1", "gene_name": "Robo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1612, "chemical_mass": 176407.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O89026-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Roundabout homolog 1", "gene_name": "Robo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1612, "chemical_mass": 176407.0 } ] }, { "start_pos": "163", "site_seq": "LEQNFFNCSCDIR", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6VNS1-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NT-3 growth factor receptor", "gene_name": "Ntrk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 825, "chemical_mass": 92760.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6VNS1-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NT-3 growth factor receptor", "gene_name": "Ntrk3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 825, "chemical_mass": 92760.0 } ] }, { "start_pos": "305", "site_seq": "LDLSNNNLTTLPR", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6RKD8-2", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane protein FLRT1", "gene_name": "Flrt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 674, "chemical_mass": 74151.0 } ] }, { "start_pos": "305", "site_seq": "N", "site_lbl": "Asn305", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6RKD8-2", "start_pos": 305, "end_pos": 305, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane protein FLRT1", "gene_name": "Flrt1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 674, "chemical_mass": 74151.0 } ] }, { "start_pos": "157", "site_seq": "WVENYTNSLLK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35684-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuroserpin", "gene_name": "Serpini1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 46348.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O35684-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuroserpin", "gene_name": "Serpini1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 46348.0 } ] }, { "start_pos": "636", "site_seq": "NSMTPGNLSPGIYLCNATNR", "site_lbl": "Asn636", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 636, "end_pos": 636, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "172", "site_seq": "IDGGPVILLQAGTPYNLTCR", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80W68-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 789, "chemical_mass": 87176.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80W68-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 789, "chemical_mass": 87176.0 } ] }, { "start_pos": "172", "site_seq": "", "site_lbl": "N172", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "3", "chr_pos": "86999504", "evidence": [ { "id": "rs3388637003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388637003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q80W68-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 789, "chemical_mass": 87176.0 } ] }, { "start_pos": "290", "site_seq": "GVDGPTLTVLANQTLLVEGQVIR", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P1D5-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Seizure 6-like protein", "gene_name": "Sez6l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 963, "chemical_mass": 104827.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P1D5-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Seizure 6-like protein", "gene_name": "Sez6l", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 963, "chemical_mass": 104827.0 } ] }, { "start_pos": "270", "site_seq": "ERPPTFLTPEGNESHK", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810U4-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1256, "chemical_mass": 138522.0 } ] }, { "start_pos": "402", "site_seq": "VDVIVANLTVTDK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15116-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 906, "chemical_mass": 99796.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15116-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 906, "chemical_mass": 99796.0 } ] }, { "start_pos": "931", "site_seq": "AMENESEVTGYK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07409-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113232.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07409-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113232.0 } ] }, { "start_pos": "432", "site_seq": "ILTKDNQTYMAVEGSTAYLLCK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "432", "site_seq": "", "site_lbl": "N432", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "X", "chr_pos": "72905268", "evidence": [ { "id": "rs3389560641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389560641" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "456", "site_seq": "ELSQWHNLTVIAAEINNPK", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70408-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-10", "gene_name": "Cdh10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 788, "chemical_mass": 88312.0 } ] }, { "start_pos": "456", "site_seq": "N", "site_lbl": "Asn456", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70408-1", "start_pos": 456, "end_pos": 456, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cadherin-10", "gene_name": "Cdh10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 788, "chemical_mass": 88312.0 } ] }, { "start_pos": "43", "site_seq": "GSNFTAICVLK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00560-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "Il6st", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 102451.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00560-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "Il6st", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 102451.0 } ] }, { "start_pos": "804", "site_seq": "FGQNDANPNSSESGHLGAGLHVENINDR", "site_lbl": "Asn804", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q76HP3-1", "start_pos": 804, "end_pos": 804, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Transmembrane protein 132D", "gene_name": "Tmem132d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1097, "chemical_mass": 121488.0 } ] }, { "start_pos": "299", "site_seq": "DFNPATVNYTIQK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0M6-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "Adgre5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 818, "chemical_mass": 90413.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0M6-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "Adgre5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 818, "chemical_mass": 90413.0 } ] }, { "start_pos": "180", "site_seq": "NSTTPLWR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJU2-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tetraspanin-9", "gene_name": "Tspan9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 239, "chemical_mass": 26738.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BJU2-1", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tetraspanin-9", "gene_name": "Tspan9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 239, "chemical_mass": 26738.0 } ] }, { "start_pos": "401", "site_seq": "FVPAATDAQAGGDNSSVQNR", "site_lbl": "Asn401", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23818-1", "start_pos": 401, "end_pos": 401, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor 1", "gene_name": "Gria1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 907, "chemical_mass": 101569.0 } ] }, { "start_pos": "401", "site_seq": "N", "site_lbl": "Asn401", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23818-1", "start_pos": 401, "end_pos": 401, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor 1", "gene_name": "Gria1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 907, "chemical_mass": 101569.0 } ] }, { "start_pos": "401", "site_seq": "", "site_lbl": "N401", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "11", "chr_pos": "57127788", "evidence": [ { "id": "rs3402258230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3402258230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23818-1", "start_pos": 401, "end_pos": 401, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor 1", "gene_name": "Gria1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 907, "chemical_mass": 101569.0 } ] }, { "start_pos": "283", "site_seq": "NLAPATNYSLR", "site_lbl": "Asn283", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55144-1", "start_pos": 283, "end_pos": 283, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "Tyro3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 880, "chemical_mass": 96208.0 } ] }, { "start_pos": "283", "site_seq": "N", "site_lbl": "Asn283", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55144-1", "start_pos": 283, "end_pos": 283, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "Tyro3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 880, "chemical_mass": 96208.0 } ] }, { "start_pos": "206", "site_seq": "N", "site_lbl": "Asn206", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 206, "end_pos": 206, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "206", "site_seq": "VNITPPQFILKPR", "site_lbl": "Asn206", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R1V6-3", "start_pos": 206, "end_pos": 206, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "Adam22", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 904, "chemical_mass": 99715.0 } ] }, { "start_pos": "304", "site_seq": "NNQSLDFEDIER", "site_lbl": "Asn304", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91XX4-1", "start_pos": 304, "end_pos": 304, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin gamma subfamily B, 6", "gene_name": "Pcdhgb6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 930, "chemical_mass": 100643.0 } ] }, { "start_pos": "658", "site_seq": "NASNLDSLHYFAAELK", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99M80-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase T", "gene_name": "Ptprt", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1454, "chemical_mass": 163012.0 } ] }, { "start_pos": "658", "site_seq": "N", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99M80-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase T", "gene_name": "Ptprt", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1454, "chemical_mass": 163012.0 } ] }, { "start_pos": "96", "site_seq": "N", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61851-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "Fgfr3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 801, "chemical_mass": 87758.0 } ] }, { "start_pos": "96", "site_seq": "LQVLNASHEDAGVYSCQHR", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61851-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "Fgfr3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 801, "chemical_mass": 87758.0 } ] }, { "start_pos": "895", "site_seq": "AYNTAGTGPSSLPVNVTTK", "site_lbl": "Asn895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JMB8-1", "start_pos": 895, "end_pos": 895, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-6", "gene_name": "Cntn6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113761.0 } ] }, { "start_pos": "895", "site_seq": "N", "site_lbl": "Asn895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JMB8-1", "start_pos": 895, "end_pos": 895, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-6", "gene_name": "Cntn6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113761.0 } ] }, { "start_pos": "58", "site_seq": "IVYCESHAFADIPENISGGSQGLSLR", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80XG9-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane neuronal protein 4", "gene_name": "Lrrtm4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 590, "chemical_mass": 67148.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80XG9-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Leucine-rich repeat transmembrane neuronal protein 4", "gene_name": "Lrrtm4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 590, "chemical_mass": 67148.0 } ] }, { "start_pos": "501", "site_seq": "TPASDPHGDNLTYSVFYTK", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97798-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neogenin", "gene_name": "Neo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1492, "chemical_mass": 162920.0 } ] }, { "start_pos": "501", "site_seq": "N", "site_lbl": "Asn501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97798-1", "start_pos": 501, "end_pos": 501, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Neogenin", "gene_name": "Neo1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1492, "chemical_mass": 162920.0 } ] }, { "start_pos": "59", "site_seq": "TEAADLCQAFNSTLPTMDQMK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15379-14", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "CD44 antigen", "gene_name": "Cd44", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 778, "chemical_mass": 85617.0 } ] }, { "start_pos": "59", "site_seq": "N", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15379-14", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "CD44 antigen", "gene_name": "Cd44", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 778, "chemical_mass": 85617.0 } ] }, { "start_pos": "283", "site_seq": "ANDSDQGANAEIDYTFHQAPEVVR", "site_lbl": "Asn283", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CFX3-1", "start_pos": 283, "end_pos": 283, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin 1", "gene_name": "Pcdh1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1038, "chemical_mass": 112411.0 } ] }, { "start_pos": "325", "site_seq": "GNPKPALQWFYNGAILNESK", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15209-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 821, "chemical_mass": 92133.0 } ] }, { "start_pos": "511", "site_seq": "NADIVYQLGPNASFFDLDRK", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "F8VPK8-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin 9", "gene_name": "Pcdh9", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1237, "chemical_mass": 136145.0 } ] }, { "start_pos": "32", "site_seq": "PKKSDSNASFLR", "site_lbl": "Asn32", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C8R3-1", "start_pos": 32, "end_pos": 32, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Ankyrin-2", "gene_name": "Ank2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 3898, "chemical_mass": 426261.0 } ] }, { "start_pos": "815", "site_seq": "LTAEQGHNVTLMVQLEEGDVQR", "site_lbl": "Asn815", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JLC4-1", "start_pos": 815, "end_pos": 815, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "VPS10 domain-containing receptor SorCS1", "gene_name": "Sorcs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 129631.0 } ] }, { "start_pos": "815", "site_seq": "N", "site_lbl": "Asn815", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JLC4-1", "start_pos": 815, "end_pos": 815, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "VPS10 domain-containing receptor SorCS1", "gene_name": "Sorcs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 129631.0 } ] }, { "start_pos": "686", "site_seq": "HVTSNASDSESSYR", "site_lbl": "Asn686", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q811D0-1", "start_pos": 686, "end_pos": 686, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Disks large homolog 1", "gene_name": "Dlg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 905, "chemical_mass": 100120.0 } ] }, { "start_pos": "121", "site_seq": "FLQPYNSSHLYVCGTYAFQPK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64151-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4C", "gene_name": "Sema4c", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 834, "chemical_mass": 92557.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64151-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Semaphorin-4C", "gene_name": "Sema4c", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 834, "chemical_mass": 92557.0 } ] }, { "start_pos": "557", "site_seq": "DAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGR", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PX28-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protocadherin 10", "gene_name": "Pcdh10", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1047, "chemical_mass": 113993.0 } ] }, { "start_pos": "3", "site_seq": "MANSTGKAPPDER", "site_lbl": "Asn3", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9Q7E2-1", "start_pos": 3, "end_pos": 3, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "AT-rich interactive domain-containing protein 2", "gene_name": "Arid2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1828, "chemical_mass": 195988.0 } ] }, { "start_pos": "344", "site_seq": "DRANSTQSR", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9D5R2-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "WD repeat-containing protein 20", "gene_name": "Wdr20", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 567, "chemical_mass": 62782.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "TnFTSK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "SRTnFTSK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "", "site_lbl": "N79", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "NC_000011.10", "chr_pos": "119420188", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "RnWTEAEVK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "nWTEAEVK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "89637535", "evidence": [ { "id": "P16444", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16444" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "16", "chr_pos": "89637902", "evidence": [ { "id": "rs1341032596", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1341032596" }, { "id": "rs1341032596", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1341032596" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "16", "chr_pos": "89637901", "evidence": [ { "id": "rs746299372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746299372" }, { "id": "rs746299372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746299372" }, { "id": "rs746299372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746299372#frequency_tab" }, { "id": "rs746299372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746299372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "157", "site_seq": "SAEGTFFInK", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "N", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "SAEGTFFINKTEIEDFPR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "157", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No change of the catalytic activity associated with the alpha-chain. No catalytic activity associated with the alpha-chain; when associated with Q-115 and Q-295.", "evidence": [ { "database": "UniProtKB", "id": "P06865", "url": "https://www.uniprot.org/uniprotkb/P06865" }, { "database": "PubMed", "id": "1533633", "url": "https://glygen.org/publication/PubMed/1533633" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06865-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-hexosaminidase subunit alpha", "gene_name": "HEXA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60703.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "179", "site_seq": "VAnLTFVVNSLDGK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "179", "site_seq": "", "site_lbl": "N179", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "7", "chr_pos": "77199258", "evidence": [ { "id": "rs1379380334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1379380334" }, { "id": "rs1379380334", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1379380334#frequency_tab" }, { "id": "rs1379380334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1379380334" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "", "site_lbl": "N678", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "4", "chr_pos": "110548207", "evidence": [ { "id": "rs1727151705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727151705" }, { "id": "rs1727151705", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727151705" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "193", "site_seq": "FnSSSSSLEEK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "N", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "FNSSSSSLEEK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "193", "site_seq": "", "site_lbl": "N193", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "5", "chr_pos": "139026868", "evidence": [ { "id": "rs761754008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761754008" }, { "id": "rs761754008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761754008" }, { "id": "rs761754008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761754008#frequency_tab" }, { "id": "rs761754008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761754008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H173-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52085.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "DIENFnSTQK", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "", "site_lbl": "N33", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST); n-glyco-sequon-gain (NFN->NFS).", "chr_id": "4", "chr_pos": "73483950", "evidence": [ { "id": "rs200353894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200353894" }, { "id": "rs200353894", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200353894#frequency_tab" }, { "id": "rs200353894", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200353894" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "4", "chr_pos": "73483949", "evidence": [ { "id": "rs762960521", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762960521#frequency_tab" }, { "id": "rs762960521", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762960521" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "4", "chr_pos": "73483951", "evidence": [ { "id": "rs752012336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752012336" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "153", "site_seq": "VVMDIPYELWNETSAEVADLKK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "VVMDIPYELWnETSAEVADLK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "153", "site_seq": "", "site_lbl": "N153", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "6", "chr_pos": "42937803", "evidence": [ { "id": "rs373936858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373936858" }, { "id": "rs373936858", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373936858" }, { "id": "rs373936858", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373936858" }, { "id": "rs373936858", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373936858#frequency_tab" }, { "id": "rs373936858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373936858" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "6", "chr_pos": "42937802", "evidence": [ { "id": "rs1238716233", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1238716233" }, { "id": "rs1238716233", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1238716233" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BT09-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein canopy homolog 3", "gene_name": "CNPY3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 278, "chemical_mass": 30748.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "268", "site_seq": "ALMnGSESR", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "ALMNGSESR", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on the interaction with P.falciparum RH5; when associated with D-160 and D-302.", "evidence": [ { "database": "UniProtKB", "id": "P35613", "url": "https://www.uniprot.org/uniprotkb/P35613" }, { "database": "PubMed", "id": "22080952", "url": "https://glygen.org/publication/PubMed/22080952" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35613-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basigin", "gene_name": "BSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 42200.0 } ] }, { "start_pos": "468", "site_seq": "DGVSAAVVVAEMASYLETMnITLK", "site_lbl": "Asn468", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "", "site_lbl": "N468", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "136", "site_seq": "ILPISLEPSSSTEPTQSnLSVTAK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96H35-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable RNA-binding protein 18", "gene_name": "RBM18", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21649.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "9", "chr_pos": "122245263", "evidence": [ { "id": "rs1184393931", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1184393931" }, { "id": "rs1184393931", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1184393931#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96H35-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable RNA-binding protein 18", "gene_name": "RBM18", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21649.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "89", "site_seq": "GSnYTSK", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "16", "chr_pos": "30475519", "evidence": [ { "id": "rs2151141095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2151141095" }, { "id": "rs2151141095", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2151141095" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "16", "chr_pos": "30475520", "evidence": [ { "id": "rs2050457701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2050457701" }, { "id": "rs2050457701", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2050457701#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "625", "site_seq": "AQNDLFSTSGNEWVLLNLnVTGYYR", "site_lbl": "Asn625", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "625", "site_seq": "N", "site_lbl": "Asn625", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "625", "site_seq": "", "site_lbl": "N625", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT); n-glyco-sequon-gain (NLN->NLS).", "chr_id": "15", "chr_pos": "89799505", "evidence": [ { "id": "rs1567158374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567158374" }, { "id": "rs1567158374", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567158374" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "15", "chr_pos": "89799506", "evidence": [ { "id": "rs1894541807", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1894541807" }, { "id": "rs1894541807", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1894541807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 625, "end_pos": 625, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "N234", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "15", "chr_pos": "89805376", "evidence": [ { "id": "rs1338821581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338821581" }, { "id": "rs1338821581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338821581" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "15", "chr_pos": "89805377", "evidence": [ { "id": "rs1173509041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1173509041" }, { "id": "rs1173509041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1173509041#frequency_tab" }, { "id": "rs1173509041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1173509041" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "GVTSVSQIFHSPDLAIRDTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVNASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "", "site_lbl": "N238", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->nullAS).", "chr_id": "11", "chr_pos": "57606037", "evidence": [ { "id": "rs2495440431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2495440431" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "217", "site_seq": "QTQVGIVQYGEnVTHEFNLNK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "QTQVGIVQYGENVTHEFNLNK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "5", "chr_pos": "52881897", "evidence": [ { "id": "rs569021701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569021701" }, { "id": "rs569021701", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs569021701" }, { "id": "rs569021701", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569021701" }, { "id": "rs569021701", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs569021701" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "5", "chr_pos": "52881899", "evidence": [ { "id": "rs762276627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762276627" }, { "id": "rs762276627", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762276627" }, { "id": "rs762276627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762276627#frequency_tab" }, { "id": "rs762276627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762276627" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "658", "site_seq": "TNIQGQVPYVSAnFTAHISPYK", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "658", "site_seq": "N", "site_lbl": "Asn658", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQnITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "N", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQNITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "658", "site_seq": "", "site_lbl": "N658", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "14", "chr_pos": "52040705", "evidence": [ { "id": "rs1892248691", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1892248691" }, { "id": "rs1892248691", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1892248691" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 658, "end_pos": 658, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "7", "chr_pos": "23260501", "evidence": [ { "id": "rs769718537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769718537#frequency_tab" }, { "id": "rs769718537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769718537" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQnLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "N", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQNLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "GnFSTEGCGCVCEPGWK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "9", "chr_pos": "115087233", "evidence": [ { "id": "rs1484018579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1484018579" }, { "id": "rs1484018579", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1484018579" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "LYHFLLGAWSLnATELDPCPLSPELLGLTK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "", "site_lbl": "N77", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15476441", "evidence": [ { "id": "rs1457765600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457765600" }, { "id": "rs1457765600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457765600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "15476440", "evidence": [ { "id": "Q96PD5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q96PD5" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "130", "site_seq": "MATPLLMQALPMGALPQGPMQnATK", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->YAT).", "chr_id": "5", "chr_pos": "150406312", "evidence": [ { "id": "rs1234104385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234104385" }, { "id": "rs1234104385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234104385" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->HES).", "chr_id": "3", "chr_pos": "155116553", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "166", "site_seq": "LYLDHNnLTR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "1", "chr_pos": "203347773", "evidence": [ { "id": "rs769517548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769517548#frequency_tab" }, { "id": "rs769517548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769517548" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "56", "site_seq": "GGnVTLPCK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10915-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hyaluronan and proteoglycan link protein 1", "gene_name": "HAPLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 40166.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10915-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hyaluronan and proteoglycan link protein 1", "gene_name": "HAPLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 40166.0 } ] }, { "start_pos": "56", "site_seq": "", "site_lbl": "N56", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "5", "chr_pos": "83652759", "evidence": [ { "id": "rs1345284457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1345284457" }, { "id": "rs1345284457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1345284457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "5", "chr_pos": "83652758", "evidence": [ { "id": "rs576797253", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576797253" }, { "id": "rs576797253", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576797253" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10915-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hyaluronan and proteoglycan link protein 1", "gene_name": "HAPLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 40166.0 } ] }, { "start_pos": "68", "site_seq": "TASnLTVSVLEAEGVFEK", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "N", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "TASNLTVSVLEAEGVFEK", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "", "site_lbl": "N68", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "73697527", "evidence": [ { "id": "rs1002167718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1002167718" }, { "id": "rs1002167718", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1002167718#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "73697527", "evidence": [ { "id": "rs1002167718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1002167718" }, { "id": "rs1002167718", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1002167718#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "135", "site_seq": "FAEInGSALCSYNLKPSEYTTSPK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "135", "site_seq": "FAEINGSALCSYNLK", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WWI5-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Choline transporter-like protein 1", "gene_name": "SLC44A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 657, "chemical_mass": 73302.0 } ] }, { "start_pos": "353", "site_seq": "VnISNYSLVMESDAGTFLPTGLQFTGSEK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "353", "site_seq": "", "site_lbl": "N353", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "8", "chr_pos": "97066012", "evidence": [ { "id": "rs1266858158", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266858158" }, { "id": "rs1266858158", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1266858158#frequency_tab" }, { "id": "rs1266858158", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1266858158" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "651", "site_seq": "WKPPSDPNGnITHYLVFWER", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "651", "site_seq": "WKPPSDPNGNITHYLVFWER", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "651", "site_seq": "N", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "1", "chr_pos": "40078590", "evidence": [ { "id": "rs746776515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746776515" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "1", "chr_pos": "40078591", "evidence": [ { "id": "rs768490419", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768490419#frequency_tab" }, { "id": "rs768490419", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768490419" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "NC_000001.11", "chr_pos": "40078591", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "215", "site_seq": "DSVnISQK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P58397-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 12", "gene_name": "ADAMTS12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1594, "chemical_mass": 177676.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P58397-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 12", "gene_name": "ADAMTS12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1594, "chemical_mass": 177676.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "451", "site_seq": "EPVPMQDQEQVLnDTVDGK", "site_lbl": "Asn451", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20936-1", "start_pos": 451, "end_pos": 451, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ras GTPase-activating protein 1", "gene_name": "RASA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1047, "chemical_mass": 116403.0 } ] }, { "start_pos": "451", "site_seq": "", "site_lbl": "N451", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "5", "chr_pos": "87362571", "evidence": [ { "id": "rs2112456504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2112456504" }, { "id": "rs2112456504", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2112456504" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "5", "chr_pos": "87362570", "evidence": [ { "id": "rs529871259", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs529871259" }, { "id": "rs529871259", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs529871259" }, { "id": "rs529871259", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs529871259" }, { "id": "rs529871259", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs529871259#frequency_tab" }, { "id": "rs529871259", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs529871259" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "5", "chr_pos": "87362569", "evidence": [ { "id": "rs2112456482", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2112456482" }, { "id": "rs2112456482", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2112456482" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20936-1", "start_pos": 451, "end_pos": 451, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ras GTPase-activating protein 1", "gene_name": "RASA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1047, "chemical_mass": 116403.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "50361733", "evidence": [ { "id": "rs1214907251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214907251" }, { "id": "rs1214907251", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214907251#frequency_tab" }, { "id": "rs1214907251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214907251" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] } ], "record_id": "G20528HD" }