{ "glytoucan_ac": "G20312EM", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "18", "url": "https://glyconnect.expasy.org/browser/compositions/18" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "24698316", "url": "https://glygen.org/publication/PubMed/24698316" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "18", "url": "https://glyconnect.expasy.org/browser/compositions/18" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "18", "url": "https://glyconnect.expasy.org/browser/compositions/18" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 2734.99, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 3, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 5, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "627", "url": "https://glyconnect.expasy.org/browser/proteins/627" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "156", "site_seq": "IDGSGNFQVLLSDRYFnK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "627", "url": "https://glyconnect.expasy.org/browser/proteins/627" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "12", "chr_pos": "6110440", "evidence": [ { "id": "rs1945295028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1945295028" }, { "id": "rs1945295028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1945295028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "12", "chr_pos": "6110439", "evidence": [ { "id": "rs371953822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371953822" }, { "id": "rs371953822", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371953822" }, { "id": "rs371953822", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371953822" }, { "id": "rs371953822", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371953822#frequency_tab" }, { "id": "rs371953822", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371953822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "627", "url": "https://glyconnect.expasy.org/browser/proteins/627" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1062", "url": "https://glyconnect.expasy.org/browser/proteins/1062" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1083", "url": "https://glyconnect.expasy.org/browser/proteins/1083" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "306", "site_seq": "nATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "N", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "RnATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "RNATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "N", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "nATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "QIGDALPVSCTISASRnATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "NATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "91", "site_seq": "DRLnLSENYTLSISNAR", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "91", "site_seq": "LNLSENYTLSISNAR", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "", "site_lbl": "N306", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "105541691", "evidence": [ { "id": "rs781323112", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781323112" }, { "id": "rs781323112", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs781323112" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "", "site_lbl": "N361", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "105545312", "evidence": [ { "id": "rs1276648550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1276648550" }, { "id": "rs1276648550", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1276648550" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "", "site_lbl": "N480", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "105550191", "evidence": [ { "id": "Q13740", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13740" }, { "id": "rs1940358284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1940358284" }, { "id": "rs1940358284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1940358284#frequency_tab" }, { "id": "rs1940358284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1940358284" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "91", "site_seq": "", "site_lbl": "N91", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "3", "chr_pos": "105524385", "evidence": [ { "id": "rs1939639092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1939639092" }, { "id": "rs1939639092", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1939639092" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "3", "chr_pos": "105524386", "evidence": [ { "id": "rs149366678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149366678" }, { "id": "rs149366678", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149366678" }, { "id": "rs149366678", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149366678#frequency_tab" }, { "id": "rs149366678", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149366678" }, { "id": "rs149366678", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149366678" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->TLS).", "chr_id": "3", "chr_pos": "105524386", "evidence": [ { "id": "rs149366678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149366678" }, { "id": "rs149366678", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149366678" }, { "id": "rs149366678", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149366678#frequency_tab" }, { "id": "rs149366678", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149366678" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1085", "url": "https://glyconnect.expasy.org/browser/proteins/1085" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGnASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1087", "url": "https://glyconnect.expasy.org/browser/proteins/1087" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1087", "url": "https://glyconnect.expasy.org/browser/proteins/1087" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGNASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1087", "url": "https://glyconnect.expasy.org/browser/proteins/1087" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1172", "url": "https://glyconnect.expasy.org/browser/proteins/1172" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1172", "url": "https://glyconnect.expasy.org/browser/proteins/1172" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1172", "url": "https://glyconnect.expasy.org/browser/proteins/1172" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1172", "url": "https://glyconnect.expasy.org/browser/proteins/1172" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "", "site_lbl": "N462", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "18", "chr_pos": "31536255", "evidence": [ { "id": "rs2144341490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2144341490" }, { "id": "rs2144341490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2144341490" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "18", "chr_pos": "31535375", "evidence": [ { "id": "rs745484404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745484404" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "18", "chr_pos": "31536256", "evidence": [ { "id": "rs375679311", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375679311#frequency_tab" }, { "id": "rs375679311", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375679311" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->nullGT).", "chr_id": "18", "chr_pos": "31535374", "evidence": [ { "id": "rs2510917341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2510917341" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1172", "url": "https://glyconnect.expasy.org/browser/proteins/1172" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "294", "site_seq": "PQNFNSSAR", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "9", "chr_pos": "137049887", "evidence": [ { "id": "Q9Y5L3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y5L3" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "9", "chr_pos": "137049885", "evidence": [ { "id": "rs777276731", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777276731" }, { "id": "rs777276731", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777276731" }, { "id": "rs777276731", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777276731" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5L3-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1193", "url": "https://glyconnect.expasy.org/browser/proteins/1193" } ], "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "ENTPD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 495, "chemical_mass": 53665.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22413-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1196", "url": "https://glyconnect.expasy.org/browser/proteins/1196" } ], "protein_name": "Ectonucleotide pyrophosphatase/phosphodiesterase family member 1", "gene_name": "ENPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 925, "chemical_mass": 104924.0 } ] }, { "start_pos": "285", "site_seq": "MnASFSLK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22413-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1196", "url": "https://glyconnect.expasy.org/browser/proteins/1196" } ], "protein_name": "Ectonucleotide pyrophosphatase/phosphodiesterase family member 1", "gene_name": "ENPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 925, "chemical_mass": 104924.0 } ] }, { "start_pos": "285", "site_seq": "MNASFSLK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22413-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1196", "url": "https://glyconnect.expasy.org/browser/proteins/1196" } ], "protein_name": "Ectonucleotide pyrophosphatase/phosphodiesterase family member 1", "gene_name": "ENPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 925, "chemical_mass": 104924.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "131860446", "evidence": [ { "id": "rs754997713", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754997713" }, { "id": "rs754997713", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754997713" }, { "id": "rs754997713", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754997713" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P22413-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1196", "url": "https://glyconnect.expasy.org/browser/proteins/1196" } ], "protein_name": "Ectonucleotide pyrophosphatase/phosphodiesterase family member 1", "gene_name": "ENPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 925, "chemical_mass": 104924.0 } ] }, { "start_pos": "74", "site_seq": "AEMnGSK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "AEMnGSKLGR", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "2", "chr_pos": "47373845", "evidence": [ { "id": "rs2103747074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103747074" }, { "id": "rs2103747074", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103747074" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "2", "chr_pos": "47373844", "evidence": [ { "id": "rs780532486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780532486" }, { "id": "rs780532486", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780532486" }, { "id": "rs780532486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780532486" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "2", "chr_pos": "47373843", "evidence": [ { "id": "rs2103747069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103747069" }, { "id": "rs2103747069", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103747069" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Changed glycosylation pattern. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-111 and A-198.", "evidence": [ { "database": "UniProtKB", "id": "P16422", "url": "https://www.uniprot.org/uniprotkb/P16422" }, { "database": "PubMed", "id": "18508581", "url": "https://glygen.org/publication/PubMed/18508581" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1217", "url": "https://glyconnect.expasy.org/browser/proteins/1217" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "166", "site_seq": "LYLDHNnLTR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "1", "chr_pos": "203347773", "evidence": [ { "id": "rs769517548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769517548#frequency_tab" }, { "id": "rs769517548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769517548" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX51-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1259", "url": "https://glyconnect.expasy.org/browser/proteins/1259" } ], "protein_name": "Glutathione hydrolase light chain 1", "gene_name": "GGTLC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 225, "chemical_mass": 24274.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "20", "chr_pos": "23985697", "evidence": [ { "id": "rs376995039", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376995039" }, { "id": "rs376995039", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376995039" }, { "id": "rs376995039", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376995039#frequency_tab" }, { "id": "rs376995039", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376995039" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX51-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1259", "url": "https://glyconnect.expasy.org/browser/proteins/1259" } ], "protein_name": "Glutathione hydrolase light chain 1", "gene_name": "GGTLC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 225, "chemical_mass": 24274.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14390-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1260", "url": "https://glyconnect.expasy.org/browser/proteins/1260" } ], "protein_name": "Glutathione hydrolase light chain 2", "gene_name": "GGTLC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 218, "chemical_mass": 23661.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "22", "chr_pos": "22647258", "evidence": [ { "id": "rs755042325", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755042325" }, { "id": "rs755042325", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755042325" }, { "id": "rs755042325", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755042325" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14390-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1260", "url": "https://glyconnect.expasy.org/browser/proteins/1260" } ], "protein_name": "Glutathione hydrolase light chain 2", "gene_name": "GGTLC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 218, "chemical_mass": 23661.0 } ] }, { "start_pos": "297", "site_seq": "N", "site_lbl": "Asn297", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 297, "end_pos": 297, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "297", "site_seq": "", "site_lbl": "N297", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "22", "chr_pos": "24623786", "evidence": [ { "id": "rs1358299475", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358299475" }, { "id": "rs1358299475", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1358299475#frequency_tab" }, { "id": "rs1358299475", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358299475" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 297, "end_pos": 297, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1261", "url": "https://glyconnect.expasy.org/browser/proteins/1261" }, { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "297", "site_seq": "N", "site_lbl": "Asn297", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36268-1", "start_pos": 297, "end_pos": 297, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1396", "url": "https://glyconnect.expasy.org/browser/proteins/1396" } ], "protein_name": "Inactive glutathione hydrolase 2", "gene_name": "GGT2P", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61771.0 } ] }, { "start_pos": "424", "site_seq": "GETLEIGnYSFYALDNQNLR", "site_lbl": "Asn424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 424, "end_pos": 424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1402", "url": "https://glyconnect.expasy.org/browser/proteins/1402" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "424", "site_seq": "N", "site_lbl": "Asn424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 424, "end_pos": 424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1402", "url": "https://glyconnect.expasy.org/browser/proteins/1402" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "HnLTITQGK", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1402", "url": "https://glyconnect.expasy.org/browser/proteins/1402" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "N", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1402", "url": "https://glyconnect.expasy.org/browser/proteins/1402" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "HNLTITQGK", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1402", "url": "https://glyconnect.expasy.org/browser/proteins/1402" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "1057", "site_seq": "TASCSnVTCWLK", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1057", "site_seq": "N", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1057", "site_seq": "TASCSNVTCWLK", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1406", "url": "https://glyconnect.expasy.org/browser/proteins/1406" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "834", "site_seq": "SALLEFACTHNLGnCSTTAMK", "site_lbl": "Asn834", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 834, "end_pos": 834, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "834", "site_seq": "N", "site_lbl": "Asn834", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 834, "end_pos": 834, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "834", "site_seq": "SALLEFACTHNLGNCSTTAMK", "site_lbl": "Asn834", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 834, "end_pos": 834, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "850", "site_seq": "LFDDWMASnGTQSLPTDVMTTVFK", "site_lbl": "Asn850", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 850, "end_pos": 850, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "850", "site_seq": "N", "site_lbl": "Asn850", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 850, "end_pos": 850, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "850", "site_seq": "", "site_lbl": "N850", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "5", "chr_pos": "97022472", "evidence": [ { "id": "rs144235120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144235120" }, { "id": "rs144235120", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144235120" }, { "id": "rs144235120", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144235120" }, { "id": "rs144235120", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144235120#frequency_tab" }, { "id": "rs144235120", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144235120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 850, "end_pos": 850, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1455", "url": "https://glyconnect.expasy.org/browser/proteins/1455" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "304", "site_seq": "YKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICK", "site_lbl": "Asn304", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14108-1", "start_pos": 304, "end_pos": 304, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1479", "url": "https://glyconnect.expasy.org/browser/proteins/1479" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "SCARB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54290.0 } ] }, { "start_pos": "304", "site_seq": "N", "site_lbl": "Asn304", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14108-1", "start_pos": 304, "end_pos": 304, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1479", "url": "https://glyconnect.expasy.org/browser/proteins/1479" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "SCARB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54290.0 } ] }, { "start_pos": "304", "site_seq": "", "site_lbl": "N304", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "4", "chr_pos": "76174228", "evidence": [ { "id": "rs1732197179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1732197179" }, { "id": "rs1732197179", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1732197179#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "4", "chr_pos": "76174227", "evidence": [ { "id": "rs150870503", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150870503" }, { "id": "rs150870503", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150870503" }, { "id": "rs150870503", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150870503#frequency_tab" }, { "id": "rs150870503", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150870503" } ], "disease": [ { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] }, { "disease_id": "DOID:0111444", "name": "progressive myoclonus epilepsy 4", "description": "A progressive myoclonus epilepsy characterized by progressive myoclonic epilepsy often associated with renal failure that has_material_basis_in homozygous or compound heterozygous of mutation in the SCARB2 gene on chromosome 4q21.1.", "url": "http://disease-ontology.org/term/DOID:0111444", "evidence": [ { "id": "254900", "database": "MIM", "url": "https://www.omim.org/entry/254900" }, { "id": "0111444", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111444" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14108-1", "start_pos": 304, "end_pos": 304, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1479", "url": "https://glyconnect.expasy.org/browser/proteins/1479" } ], "protein_name": "Lysosome membrane protein 2", "gene_name": "SCARB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54290.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13296-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1486", "url": "https://glyconnect.expasy.org/browser/proteins/1486" } ], "protein_name": "Mammaglobin-A", "gene_name": "SCGB2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 93, "chemical_mass": 10499.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "11", "chr_pos": "62270983", "evidence": [ { "id": "rs772554381", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772554381" }, { "id": "rs772554381", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772554381" }, { "id": "rs772554381", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772554381#frequency_tab" }, { "id": "rs772554381", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772554381" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13296-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1486", "url": "https://glyconnect.expasy.org/browser/proteins/1486" } ], "protein_name": "Mammaglobin-A", "gene_name": "SCGB2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 93, "chemical_mass": 10499.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96NY8-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1538", "url": "https://glyconnect.expasy.org/browser/proteins/1538" } ], "protein_name": "Nectin-4", "gene_name": "NECTIN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 55454.0 } ] }, { "start_pos": "281", "site_seq": "", "site_lbl": "N281", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "1", "chr_pos": "161076365", "evidence": [ { "id": "rs1351414494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351414494" }, { "id": "rs1351414494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351414494#frequency_tab" }, { "id": "rs1351414494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351414494" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "1", "chr_pos": "161076363", "evidence": [ { "id": "rs1653414558", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1653414558" }, { "id": "rs1653414558", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1653414558#frequency_tab" }, { "id": "rs1653414558", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1653414558" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->YWT).", "chr_id": "1", "chr_pos": "161076365", "evidence": [ { "id": "rs1351414494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351414494" }, { "id": "rs1351414494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351414494#frequency_tab" }, { "id": "rs1351414494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351414494" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96NY8-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1538", "url": "https://glyconnect.expasy.org/browser/proteins/1538" } ], "protein_name": "Nectin-4", "gene_name": "NECTIN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 55454.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "1", "chr_pos": "113981079", "evidence": [ { "id": "rs746449303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746449303#frequency_tab" }, { "id": "rs746449303", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746449303" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1637", "url": "https://glyconnect.expasy.org/browser/proteins/1637" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1637", "url": "https://glyconnect.expasy.org/browser/proteins/1637" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1637", "url": "https://glyconnect.expasy.org/browser/proteins/1637" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "274", "site_seq": "EALENMnSTLK", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43490-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1642", "url": "https://glyconnect.expasy.org/browser/proteins/1642" } ], "protein_name": "Prominin-1", "gene_name": "PROM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97202.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43490-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1642", "url": "https://glyconnect.expasy.org/browser/proteins/1642" } ], "protein_name": "Prominin-1", "gene_name": "PROM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97202.0 } ] }, { "start_pos": "274", "site_seq": "", "site_lbl": "N274", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "4", "chr_pos": "16018505", "evidence": [ { "id": "rs778490205", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778490205" }, { "id": "rs778490205", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778490205" }, { "id": "rs778490205", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778490205" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43490-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1642", "url": "https://glyconnect.expasy.org/browser/proteins/1642" } ], "protein_name": "Prominin-1", "gene_name": "PROM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 865, "chemical_mass": 97202.0 } ] }, { "start_pos": "286", "site_seq": "nVSVAEGK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "286", "site_seq": "NVSVAEGK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "525", "site_seq": "QRnNSWVK", "site_lbl": "Asn525", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 525, "end_pos": 525, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "525", "site_seq": "N", "site_lbl": "Asn525", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 525, "end_pos": 525, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "525", "site_seq": "QRNNSWVK", "site_lbl": "Asn525", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 525, "end_pos": 525, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "525", "site_seq": "", "site_lbl": "N525", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->HNS).", "chr_id": "1", "chr_pos": "116961602", "evidence": [ { "id": "rs780315153", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780315153" }, { "id": "rs780315153", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780315153" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 525, "end_pos": 525, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1647", "url": "https://glyconnect.expasy.org/browser/proteins/1647" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "297", "site_seq": "N", "site_lbl": "Asn297", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A6NGU5-1", "start_pos": 297, "end_pos": 297, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1694", "url": "https://glyconnect.expasy.org/browser/proteins/1694" } ], "protein_name": "Putative glutathione hydrolase 3 proenzyme", "gene_name": "GGT3P", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 568, "chemical_mass": 61502.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "211", "site_seq": "LGDVEVNAGQnATFQCIATGR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "211", "site_seq": "LGDVEVNAGQNATFQCIATGR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "416", "site_seq": "IAVDWESLGYnITR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "416", "site_seq": "IAVDWESLGYNITR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "416", "site_seq": "", "site_lbl": "N416", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "NC_000006.12", "chr_pos": "128089907", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15262-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1709", "url": "https://glyconnect.expasy.org/browser/proteins/1709" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase kappa", "gene_name": "PTPRK", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1439, "chemical_mass": 162102.0 } ] }, { "start_pos": "1034", "site_seq": "nTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "N", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "NTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQnLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "N", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQNLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "GnFSTEGCGCVCEPGWK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1809", "site_seq": "N", "site_lbl": "Asn1809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1809, "end_pos": 1809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "9", "chr_pos": "115087233", "evidence": [ { "id": "rs1484018579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1484018579" }, { "id": "rs1484018579", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1484018579" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1809", "site_seq": "", "site_lbl": "N1809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "115038347", "evidence": [ { "id": "rs1419051843", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1419051843" }, { "id": "rs1419051843", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1419051843" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1809, "end_pos": 1809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1842", "url": "https://glyconnect.expasy.org/browser/proteins/1842" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "127", "site_seq": "LFQNCSELFK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "127", "site_seq": "LFQnCSELFK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "275", "site_seq": "VLHnGTLAELQGLPHIR", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13641-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1860", "url": "https://glyconnect.expasy.org/browser/proteins/1860" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "TPBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 46032.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13641-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1860", "url": "https://glyconnect.expasy.org/browser/proteins/1860" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "TPBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 46032.0 } ] }, { "start_pos": "275", "site_seq": "VLHNGTLAELQGLPHIR", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13641-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1860", "url": "https://glyconnect.expasy.org/browser/proteins/1860" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "TPBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 46032.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "NC_000006.12", "chr_pos": "82365784", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "6", "chr_pos": "82365785", "evidence": [ { "id": "rs931897460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs931897460" }, { "id": "rs931897460", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs931897460#frequency_tab" }, { "id": "rs931897460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs931897460" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13641-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1860", "url": "https://glyconnect.expasy.org/browser/proteins/1860" } ], "protein_name": "Trophoblast glycoprotein", "gene_name": "TPBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 46032.0 } ] }, { "start_pos": "251", "site_seq": "DFEDLYTPVnGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "KDFEDLYTPVNGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "196069505", "evidence": [ { "id": "rs764716764", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764716764" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "607", "url": "https://glyconnect.expasy.org/browser/proteins/607" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "655", "url": "https://glyconnect.expasy.org/browser/proteins/655" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "116", "site_seq": "SAnASFNIK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "655", "url": "https://glyconnect.expasy.org/browser/proteins/655" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "116", "site_seq": "SANASFNIK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "655", "url": "https://glyconnect.expasy.org/browser/proteins/655" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "116", "site_seq": "", "site_lbl": "N116", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->IAS).", "chr_id": "6", "chr_pos": "43129244", "evidence": [ { "id": "rs1460965413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460965413" }, { "id": "rs1460965413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1460965413#frequency_tab" }, { "id": "rs1460965413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460965413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "6", "chr_pos": "43129244", "evidence": [ { "id": "rs1460965413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460965413" }, { "id": "rs1460965413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1460965413#frequency_tab" }, { "id": "rs1460965413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460965413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "655", "url": "https://glyconnect.expasy.org/browser/proteins/655" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "LHEITnETFR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "LHEITNETFR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "", "site_lbl": "N117", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "16", "chr_pos": "4381227", "evidence": [ { "id": "Q6EMK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6EMK4" }, { "id": "rs1288526677", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1288526677" }, { "id": "rs1288526677", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1288526677#frequency_tab" }, { "id": "rs1288526677", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1288526677" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "670", "url": "https://glyconnect.expasy.org/browser/proteins/670" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "112", "site_seq": "N", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "112", "site_seq": "", "site_lbl": "N112", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "7", "chr_pos": "99968386", "evidence": [ { "id": "rs191613328", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" }, { "id": "rs191613328", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191613328" }, { "id": "rs191613328", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "7", "chr_pos": "99968384", "evidence": [ { "id": "rs8192465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs8192465" }, { "id": "rs8192465", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs8192465#frequency_tab" }, { "id": "rs8192465", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs8192465" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "692", "url": "https://glyconnect.expasy.org/browser/proteins/692" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "57", "site_seq": "AFnSTLPTMAQMEK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16070-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "736", "url": "https://glyconnect.expasy.org/browser/proteins/736" } ], "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 742, "chemical_mass": 81538.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16070-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "736", "url": "https://glyconnect.expasy.org/browser/proteins/736" } ], "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 742, "chemical_mass": 81538.0 } ] }, { "start_pos": "57", "site_seq": "AFNSTLPTMAQMEK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16070-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "736", "url": "https://glyconnect.expasy.org/browser/proteins/736" } ], "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 742, "chemical_mass": 81538.0 } ] }, { "start_pos": "57", "site_seq": "TEAADLCKAFnSTLPTMAQMEK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16070-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "736", "url": "https://glyconnect.expasy.org/browser/proteins/736" } ], "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 742, "chemical_mass": 81538.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "NC_000011.10", "chr_pos": "35176677", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16070-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "736", "url": "https://glyconnect.expasy.org/browser/proteins/736" } ], "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 742, "chemical_mass": 81538.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "744", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "365", "site_seq": "DASSFLAEWQnITK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "984", "url": "https://glyconnect.expasy.org/browser/proteins/984" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "984", "url": "https://glyconnect.expasy.org/browser/proteins/984" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "DASSFLAEWQNITK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "984", "url": "https://glyconnect.expasy.org/browser/proteins/984" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "N365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62884663", "evidence": [ { "id": "rs763205241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763205241" }, { "id": "rs763205241", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763205241" }, { "id": "rs763205241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763205241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "984", "url": "https://glyconnect.expasy.org/browser/proteins/984" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs both the stability and the trafficking of SLC3A2 to the plasma membrane; when associated with Q-381; Q-424 and Q-506.", "evidence": [ { "database": "UniProtKB", "id": "P08195", "url": "https://www.uniprot.org/uniprotkb/P08195" }, { "database": "PubMed", "id": "36028562", "url": "https://glygen.org/publication/PubMed/36028562" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "984", "url": "https://glyconnect.expasy.org/browser/proteins/984" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16620-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1029", "url": "https://glyconnect.expasy.org/browser/proteins/1029" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "NTRK2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 91999.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGnVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "N", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "85", "site_seq": "TVLTPATNHMGNVTFTIPANR", "site_lbl": "Asn85", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01024-1", "start_pos": 85, "end_pos": 85, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "110", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "protein_name": "Complement C3", "gene_name": "C3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1663, "chemical_mass": 187148.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGM5-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1234", "url": "https://glyconnect.expasy.org/browser/proteins/1234" } ], "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 42055.0 } ] }, { "start_pos": "136", "site_seq": "VLYLAAYnCTLRPVSK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGM5-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1234", "url": "https://glyconnect.expasy.org/browser/proteins/1234" } ], "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 42055.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186642542", "evidence": [ { "id": "rs1300900401", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1300900401" }, { "id": "rs1300900401", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1300900401#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UGM5-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1234", "url": "https://glyconnect.expasy.org/browser/proteins/1234" } ], "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 42055.0 } ] }, { "start_pos": "290", "site_seq": "CFLGnGTGYR", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q04756-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1309", "url": "https://glyconnect.expasy.org/browser/proteins/1309" } ], "protein_name": "Hepatocyte growth factor activator serine protease", "gene_name": "HGFAC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 655, "chemical_mass": 70682.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q04756-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1309", "url": "https://glyconnect.expasy.org/browser/proteins/1309" } ], "protein_name": "Hepatocyte growth factor activator serine protease", "gene_name": "HGFAC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 655, "chemical_mass": 70682.0 } ] }, { "start_pos": "5186", "site_seq": "N", "site_lbl": "Asn5186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 5186, "end_pos": 5186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1386", "url": "https://glyconnect.expasy.org/browser/proteins/1386" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "5186", "site_seq": "YLPVnSSLLTSDCSER", "site_lbl": "Asn5186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 5186, "end_pos": 5186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1386", "url": "https://glyconnect.expasy.org/browser/proteins/1386" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "5186", "site_seq": "YLPVNSSLLTSDCSER", "site_lbl": "Asn5186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 5186, "end_pos": 5186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1386", "url": "https://glyconnect.expasy.org/browser/proteins/1386" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "2240", "site_seq": "nGTISVR", "site_lbl": "Asn2240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2240, "end_pos": 2240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1439", "url": "https://glyconnect.expasy.org/browser/proteins/1439" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2240", "site_seq": "N", "site_lbl": "Asn2240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2240, "end_pos": 2240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1439", "url": "https://glyconnect.expasy.org/browser/proteins/1439" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "106", "site_seq": "N", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "106", "site_seq": "FnLTETSEAEIHQSFQHLLR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "YTGnASALFILPDQDKMEEVEAMLLPETLK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "YTGnASALFILPDQDK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "94614759", "evidence": [ { "id": "rs1885922817", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1885922817" }, { "id": "rs1885922817", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1885922817" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "14", "chr_pos": "94614821", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" }, { "id": "rs145819878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145819878#frequency_tab" }, { "id": "rs145819878", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145819878" }, { "id": "rs145819878", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145819878" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "14", "chr_pos": "94619363", "evidence": [ { "id": "rs534010283", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534010283" }, { "id": "rs534010283", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs534010283" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "19", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "301", "site_seq": "N", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1914", "url": "https://glyconnect.expasy.org/browser/proteins/1914" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "301", "site_seq": "EVLSSnVSWR", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1914", "url": "https://glyconnect.expasy.org/browser/proteins/1914" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "301", "site_seq": "", "site_lbl": "N301", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "6", "chr_pos": "46879952", "evidence": [ { "id": "rs368520666", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368520666" }, { "id": "rs368520666", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368520666" }, { "id": "rs368520666", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368520666#frequency_tab" }, { "id": "rs368520666", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368520666" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1914", "url": "https://glyconnect.expasy.org/browser/proteins/1914" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09326-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1926", "url": "https://glyconnect.expasy.org/browser/proteins/1926" } ], "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 243, "chemical_mass": 27683.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5T2D2-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "1980", "url": "https://glyconnect.expasy.org/browser/proteins/1980" } ], "protein_name": "Trem-like transcript 2 protein", "gene_name": "TREML2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 321, "chemical_mass": 35127.0 } ] }, { "start_pos": "245", "site_seq": "GAFFPLTERnWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "683", "url": "https://glyconnect.expasy.org/browser/proteins/683" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "N", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "683", "url": "https://glyconnect.expasy.org/browser/proteins/683" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "nWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "683", "url": "https://glyconnect.expasy.org/browser/proteins/683" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "NWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "683", "url": "https://glyconnect.expasy.org/browser/proteins/683" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "118", "site_seq": "QGGVnATQVLIQHLR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "12", "chr_pos": "56361853", "evidence": [ { "id": "rs750714330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750714330" }, { "id": "rs750714330", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750714330" }, { "id": "rs750714330", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750714330#frequency_tab" }, { "id": "rs750714330", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750714330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13790-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "702", "url": "https://glyconnect.expasy.org/browser/proteins/702" } ], "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 326, "chemical_mass": 35399.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "714", "url": "https://glyconnect.expasy.org/browser/proteins/714" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "1086", "site_seq": "GISDnYTLALITYALSSVGSPK", "site_lbl": "Asn1086", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1086, "end_pos": 1086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1086", "site_seq": "N", "site_lbl": "Asn1086", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1086, "end_pos": 1086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1086", "site_seq": "GISDNYTLALITYALSSVGSPK", "site_lbl": "Asn1086", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1086, "end_pos": 1086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1086", "site_seq": "", "site_lbl": "N1086", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "6", "chr_pos": "73808150", "evidence": [ { "id": "Q6YHK3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6YHK3" }, { "id": "rs767941521", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767941521" }, { "id": "rs767941521", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767941521" }, { "id": "rs767941521", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767941521" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1086, "end_pos": 1086, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" }, { "database": "GlyConnect", "id": "795", "url": "https://glyconnect.expasy.org/browser/proteins/795" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "136", "site_seq": "FNPGAESVVLSnSTLK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "4", "chr_pos": "89895378", "evidence": [ { "id": "rs577895255", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577895255" }, { "id": "rs577895255", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs577895255" }, { "id": "rs577895255", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577895255" }, { "id": "rs577895255", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs577895255#frequency_tab" }, { "id": "rs577895255", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs577895255" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "4", "chr_pos": "89895378", "evidence": [ { "id": "rs577895255", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577895255" }, { "id": "rs577895255", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs577895255" }, { "id": "rs577895255", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577895255" }, { "id": "rs577895255", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs577895255#frequency_tab" }, { "id": "rs577895255", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs577895255" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "WFSAGLASnSSWLR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "", "site_lbl": "N51", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "ALGFEnATQALGR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "17", "chr_pos": "78972140", "evidence": [ { "id": "rs923974095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs923974095" }, { "id": "rs923974095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs923974095#frequency_tab" }, { "id": "rs923974095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs923974095" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "17", "chr_pos": "78976002", "evidence": [ { "id": "rs770079138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770079138#frequency_tab" }, { "id": "rs770079138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770079138" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1256", "url": "https://glyconnect.expasy.org/browser/proteins/1256" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "321", "site_seq": "nCTSYGVLDISK", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1611", "url": "https://glyconnect.expasy.org/browser/proteins/1611" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "321", "site_seq": "N", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1611", "url": "https://glyconnect.expasy.org/browser/proteins/1611" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "321", "site_seq": "", "site_lbl": "N321", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "7", "chr_pos": "80671119", "evidence": [ { "id": "rs149492740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149492740#frequency_tab" }, { "id": "rs149492740", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149492740" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "7", "chr_pos": "80671121", "evidence": [ { "id": "P16671", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16671" }, { "id": "rs374208165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374208165" }, { "id": "rs374208165", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374208165" }, { "id": "rs374208165", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs374208165" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "7", "chr_pos": "80671119", "evidence": [ { "id": "rs149492740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149492740#frequency_tab" }, { "id": "rs149492740", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149492740" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1611", "url": "https://glyconnect.expasy.org/browser/proteins/1611" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "nGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "NGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "1", "chr_pos": "180175342", "evidence": [ { "id": "O00391", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O00391" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "1", "chr_pos": "180175343", "evidence": [ { "id": "rs1662863114", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1662863114" }, { "id": "rs1662863114", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1662863114#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "O00391", "url": "https://www.uniprot.org/uniprotkb/O00391" }, { "database": "PubMed", "id": "29757379", "url": "https://glygen.org/publication/PubMed/29757379" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23280-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1924", "url": "https://glyconnect.expasy.org/browser/proteins/1924" } ], "protein_name": "Carbonic anhydrase 6", "gene_name": "CA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 308, "chemical_mass": 35367.0 } ] }, { "start_pos": "256", "site_seq": "", "site_lbl": "N256", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->DKT).", "chr_id": "1", "chr_pos": "8970903", "evidence": [ { "id": "P23280", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P23280" }, { "id": "rs1569729158", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569729158" }, { "id": "rs1569729158", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569729158" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "1", "chr_pos": "8970905", "evidence": [ { "id": "rs3737665", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3737665" }, { "id": "rs3737665", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs3737665" }, { "id": "rs3737665", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3737665" }, { "id": "rs3737665", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs3737665#frequency_tab" }, { "id": "rs3737665", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs3737665" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "1", "chr_pos": "8970904", "evidence": [ { "id": "rs1640092755", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1640092755" }, { "id": "rs1640092755", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1640092755#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23280-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1924", "url": "https://glyconnect.expasy.org/browser/proteins/1924" } ], "protein_name": "Carbonic anhydrase 6", "gene_name": "CA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 308, "chemical_mass": 35367.0 } ] }, { "start_pos": "1205", "site_seq": "TAHCnESFYFLCK", "site_lbl": "Asn1205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1205, "end_pos": 1205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1956", "url": "https://glyconnect.expasy.org/browser/proteins/1956" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "1205", "site_seq": "N", "site_lbl": "Asn1205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1205, "end_pos": 1205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "1956", "url": "https://glyconnect.expasy.org/browser/proteins/1956" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "55", "site_seq": "N", "site_lbl": "Asn55", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13410-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2933", "url": "https://glyconnect.expasy.org/browser/proteins/2933" } ], "protein_name": "Butyrophilin subfamily 1 member A1", "gene_name": "BTN1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 58960.0 } ] }, { "start_pos": "55", "site_seq": "", "site_lbl": "N55", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "26501675", "evidence": [ { "id": "rs755892439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755892439" }, { "id": "rs755892439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755892439" }, { "id": "rs755892439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755892439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13410-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2933", "url": "https://glyconnect.expasy.org/browser/proteins/2933" } ], "protein_name": "Butyrophilin subfamily 1 member A1", "gene_name": "BTN1A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 526, "chemical_mass": 58960.0 } ] }, { "start_pos": "114", "site_seq": "N", "site_lbl": "Asn114", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6WN34-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2935", "url": "https://glyconnect.expasy.org/browser/proteins/2935" } ], "protein_name": "Chordin-like protein 2", "gene_name": "CHRDL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 47495.0 } ] }, { "start_pos": "114", "site_seq": "", "site_lbl": "N114", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "11", "chr_pos": "74710939", "evidence": [ { "id": "rs760762037", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760762037" }, { "id": "rs760762037", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760762037" }, { "id": "rs760762037", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760762037#frequency_tab" }, { "id": "rs760762037", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760762037" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6WN34-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2935", "url": "https://glyconnect.expasy.org/browser/proteins/2935" } ], "protein_name": "Chordin-like protein 2", "gene_name": "CHRDL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 47495.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06858-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2940", "url": "https://glyconnect.expasy.org/browser/proteins/2940" } ], "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 475, "chemical_mass": 53162.0 } ] }, { "start_pos": "70", "site_seq": "TPEDTAEDTCHLIPGVAESVATCHFNHSSK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06858-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2940", "url": "https://glyconnect.expasy.org/browser/proteins/2940" } ], "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 475, "chemical_mass": 53162.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "8", "chr_pos": "19948300", "evidence": [ { "id": "rs2069901707", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2069901707" }, { "id": "rs2069901707", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2069901707" } ], "disease": [ { "disease_id": "DOID:14118", "name": "familial lipoprotein lipase deficiency", "description": "A familial hyperlipemia characterized by a deficiency of the enzyme lipoprotein lipase and the subsequent build up of chylomicrons and increased plasma concentration of triglycerides.", "url": "http://disease-ontology.org/term/DOID:14118", "evidence": [ { "id": "14118", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14118" } ] }, { "disease_id": "DOID:14118", "name": "familial lipoprotein lipase deficiency", "description": "A familial hyperlipemia characterized by a deficiency of the enzyme lipoprotein lipase and the subsequent build up of chylomicrons and increased plasma concentration of triglycerides.", "url": "http://disease-ontology.org/term/DOID:14118", "evidence": [ { "id": "14118", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14118" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06858-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2940", "url": "https://glyconnect.expasy.org/browser/proteins/2940" } ], "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 475, "chemical_mass": 53162.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2946", "url": "https://glyconnect.expasy.org/browser/proteins/2946" } ], "protein_name": "Tumor necrosis factor ligand superfamily member 13", "gene_name": "TNFSF13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27433.0 } ] }, { "start_pos": "124", "site_seq": "QHSVLHLVPINATSK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2946", "url": "https://glyconnect.expasy.org/browser/proteins/2946" } ], "protein_name": "Tumor necrosis factor ligand superfamily member 13", "gene_name": "TNFSF13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27433.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "17", "chr_pos": "7559879", "evidence": [ { "id": "rs1597833238", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1597833238" }, { "id": "rs1597833238", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1597833238" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "17", "chr_pos": "7559880", "evidence": [ { "id": "rs138604224", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138604224" }, { "id": "rs138604224", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138604224" }, { "id": "rs138604224", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138604224" }, { "id": "rs138604224", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138604224#frequency_tab" }, { "id": "rs138604224", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138604224" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2946", "url": "https://glyconnect.expasy.org/browser/proteins/2946" } ], "protein_name": "Tumor necrosis factor ligand superfamily member 13", "gene_name": "TNFSF13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27433.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "642", "site_seq": "N", "site_lbl": "Asn642", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 642, "end_pos": 642, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "642", "site_seq": "", "site_lbl": "N642", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "46438112", "evidence": [ { "id": "rs746996787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746996787" }, { "id": "rs746996787", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746996787" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "46438113", "evidence": [ { "id": "rs1471047941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471047941" }, { "id": "rs1471047941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1471047941#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 642, "end_pos": 642, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "367", "url": "https://glyconnect.expasy.org/browser/proteins/367" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "367", "url": "https://glyconnect.expasy.org/browser/proteins/367" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "367", "url": "https://glyconnect.expasy.org/browser/proteins/367" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "", "site_lbl": "N101", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "23", "chr_pos": "47585305", "evidence": [ { "id": "P01033", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01033" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "367", "url": "https://glyconnect.expasy.org/browser/proteins/367" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "151", "site_seq": "LRnVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "N", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "151", "site_seq": "nVSWATGR", "site_lbl": "Asn151", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08571-1", "start_pos": 151, "end_pos": 151, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 375, "chemical_mass": 40076.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "85", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "85", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "85", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "85", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] } ], "record_id": "G20312EM" }