{ "glytoucan_ac": "G09528DL", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G21109OS", "url": "https://www.glygen.org/glycan/G21109OS" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G10773YW", "url": "https://www.glygen.org/glycan/G10773YW" }, { "database": "Subsumption", "id": "G61714PI", "url": "https://www.glygen.org/glycan/G61714PI" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G10773YW", "url": "https://www.glygen.org/glycan/G10773YW" }, { "database": "Subsumption", "id": "G61714PI", "url": "https://www.glygen.org/glycan/G61714PI" }, { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" }, { "database": "GlyCosmos", "id": "G09528DL", "url": "https://glycosmos.org/glycans/show/G09528DL" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G10773YW", "url": "https://www.glygen.org/glycan/G10773YW" }, { "database": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G10773YW", "url": "https://www.glygen.org/glycan/G10773YW" }, { "database": "Subsumption", "id": "G61714PI", "url": "https://www.glygen.org/glycan/G61714PI" }, { "database": "Subsumption", "id": "G42713IF", "url": "https://www.glygen.org/glycan/G42713IF" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G10773YW", "url": "https://www.glygen.org/glycan/G10773YW" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G72840IQ", "url": "https://www.glygen.org/glycan/G72840IQ" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 7955, "name": "Danio rerio", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G72404VA", "url": "https://www.glygen.org/glycan/G72404VA" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mass": 2036.72, "classification": [ { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Lacto series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Neo-lacto series" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "46", "site_seq": "N", "site_lbl": "Asn46", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "46", "site_seq": "", "site_lbl": "N46", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "14", "chr_pos": "105856083", "evidence": [ { "id": "rs1229938382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229938382" }, { "id": "rs1229938382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1229938382#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01871-2", "start_pos": 46, "end_pos": 46, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 474, "chemical_mass": 51924.0 } ] }, { "start_pos": "317", "site_seq": "N", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "317", "site_seq": "RLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKR", "site_lbl": "Asn317", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "317", "site_seq": "", "site_lbl": "N317", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "12", "chr_pos": "64739425", "evidence": [ { "id": "rs2136245502", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136245502" }, { "id": "rs2136245502", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136245502" } ], "disease": [ { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 317, "end_pos": 317, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 47, "end_pos": 47, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "47", "site_seq": "", "site_lbl": "N47", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "14", "chr_pos": "105588257", "evidence": [ { "id": "rs781877710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781877710" }, { "id": "rs781877710", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781877710" }, { "id": "rs781877710", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781877710" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "14", "chr_pos": "105588256", "evidence": [ { "id": "rs782791977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782791977" }, { "id": "rs782791977", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782791977" }, { "id": "rs782791977", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782791977" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 47, "end_pos": 47, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "516", "site_seq": "N", "site_lbl": "Asn516", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13087-1", "start_pos": 516, "end_pos": 516, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Protein disulfide-isomerase A2", "gene_name": "PDIA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 58206.0 } ] }, { "start_pos": "516", "site_seq": "", "site_lbl": "N516", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "16", "chr_pos": "287081", "evidence": [ { "id": "rs2052396968", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2052396968" }, { "id": "rs2052396968", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2052396968#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->IST).", "chr_id": "16", "chr_pos": "287082", "evidence": [ { "id": "rs1399961715", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399961715" }, { "id": "rs1399961715", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399961715" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "16", "chr_pos": "287082", "evidence": [ { "id": "rs1399961715", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399961715" }, { "id": "rs1399961715", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399961715" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13087-1", "start_pos": 516, "end_pos": 516, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Protein disulfide-isomerase A2", "gene_name": "PDIA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 58206.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8MYU2-1", "start_pos": 666, "end_pos": 666, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Potassium channel subfamily U member 1", "gene_name": "KCNU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1149, "chemical_mass": 129543.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "8", "chr_pos": "36864508", "evidence": [ { "id": "A8MYU2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/A8MYU2" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A8MYU2-1", "start_pos": 666, "end_pos": 666, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Potassium channel subfamily U member 1", "gene_name": "KCNU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1149, "chemical_mass": 129543.0 } ] }, { "start_pos": "585", "site_seq": "N", "site_lbl": "Asn585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14513-1", "start_pos": 585, "end_pos": 585, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Nck-associated protein 5", "gene_name": "NCKAP5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1909, "chemical_mass": 208537.0 } ] }, { "start_pos": "585", "site_seq": "", "site_lbl": "N585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "132785057", "evidence": [ { "id": "rs993442095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs993442095" }, { "id": "rs993442095", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs993442095" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14513-1", "start_pos": 585, "end_pos": 585, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Nck-associated protein 5", "gene_name": "NCKAP5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1909, "chemical_mass": 208537.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "", "site_lbl": "N139", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "4", "chr_pos": "165464499", "evidence": [ { "id": "rs140774899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140774899" }, { "id": "rs140774899", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140774899#frequency_tab" }, { "id": "rs140774899", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140774899" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "4", "chr_pos": "165464498", "evidence": [ { "id": "rs1732065580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1732065580" }, { "id": "rs1732065580", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1732065580" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G09528DL", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G09528DL" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] } ], "record_id": "G09528DL" }