{ "glytoucan_ac": "G07810QS", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 3318.18, "classification": [ { "type": { "name": "Other", "url": "" }, "subtype": { "name": "Other", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 8, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 7, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 2, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "735", "site_seq": "PYTGSNCLKEYVAGRFGQDDSTGYAAFSVNDNYGQNFSLSMFVR", "site_lbl": "Asn735", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VHS2-1", "start_pos": 735, "end_pos": 735, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Protein crumbs homolog 1", "gene_name": "Crb1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1405, "chemical_mass": 153350.0 } ] }, { "start_pos": "87", "site_seq": "VQLYRIQFNESFAEMNR", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19783-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cytochrome c oxidase subunit 4 isoform 1, mitochondrial", "gene_name": "Cox4i1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 169, "chemical_mass": 19530.0 } ] }, { "start_pos": "31", "site_seq": "VKGSQGQFPLTQNVTVVEGGTAILTCR", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLQ9-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell adhesion molecule 2", "gene_name": "Cadm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 435, "chemical_mass": 47559.0 } ] }, { "start_pos": "31", "site_seq": "RSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCR", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLQ9-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell adhesion molecule 2", "gene_name": "Cadm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 435, "chemical_mass": 47559.0 } ] }, { "start_pos": "31", "site_seq": "N", "site_lbl": "Asn31", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLQ9-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell adhesion molecule 2", "gene_name": "Cadm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 435, "chemical_mass": 47559.0 } ] }, { "start_pos": "31", "site_seq": "", "site_lbl": "N31", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "16", "chr_pos": "66581745", "evidence": [ { "id": "rs3389403264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389403264" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8BLQ9-1", "start_pos": 31, "end_pos": 31, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell adhesion molecule 2", "gene_name": "Cadm2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 435, "chemical_mass": 47559.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "538", "site_seq": "YIHQnYTK", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "538", "site_seq": "N", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "538", "site_seq": "", "site_lbl": "N538", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "1", "chr_pos": "11966279", "evidence": [ { "id": "rs1324713201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1324713201" }, { "id": "rs1324713201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1324713201" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q02809-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1", "gene_name": "PLOD1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 727, "chemical_mass": 83550.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "289", "site_seq": "NSFnISNLLVLHLSHNR", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "289", "site_seq": "N", "site_lbl": "Asn289", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 289, "end_pos": 289, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "320", "site_seq": "LEHLYLNnNSIEK", "site_lbl": "Asn320", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 320, "end_pos": 320, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "320", "site_seq": "N", "site_lbl": "Asn320", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 320, "end_pos": 320, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "320", "site_seq": "", "site_lbl": "N320", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "1", "chr_pos": "203484143", "evidence": [ { "id": "P51888", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P51888" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 320, "end_pos": 320, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "193", "site_seq": "nMTLLVEK", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "193", "site_seq": "N", "site_lbl": "Asn193", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "72", "site_seq": "SLGSGGSVSQLFSnFTGSVDDR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "193", "site_seq": "", "site_lbl": "N193", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "13", "chr_pos": "53043112", "evidence": [ { "id": "rs199556573", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199556573" }, { "id": "rs199556573", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199556573" }, { "id": "rs199556573", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199556573" }, { "id": "rs199556573", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199556573#frequency_tab" }, { "id": "rs199556573", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199556573" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 193, "end_pos": 193, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "365", "site_seq": "DASSFLAEWQnITK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "DASSFLAEWQNITK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "N365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62884663", "evidence": [ { "id": "rs763205241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763205241" }, { "id": "rs763205241", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763205241" }, { "id": "rs763205241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763205241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62885196", "evidence": [ { "id": "rs751788730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751788730" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs both the stability and the trafficking of SLC3A2 to the plasma membrane; when associated with Q-381; Q-424 and Q-506.", "evidence": [ { "database": "UniProtKB", "id": "P08195", "url": "https://www.uniprot.org/uniprotkb/P08195" }, { "database": "PubMed", "id": "36028562", "url": "https://glygen.org/publication/PubMed/36028562" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs both the stability and the trafficking of SLC3A2 to the plasma membrane; when associated with Q-365; Q-424 and Q-506.", "evidence": [ { "database": "UniProtKB", "id": "P08195", "url": "https://www.uniprot.org/uniprotkb/P08195" }, { "database": "PubMed", "id": "36028562", "url": "https://glygen.org/publication/PubMed/36028562" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "91", "site_seq": "TAFITnFTLTIDGVTYPGNVK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "251", "site_seq": "DFEDLYTPVnGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "KDFEDLYTPVNGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "196069505", "evidence": [ { "id": "rs764716764", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764716764" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "", "site_lbl": "N341", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "P56199", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P56199" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "rs1415396844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415396844" }, { "id": "rs1415396844", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415396844#frequency_tab" }, { "id": "rs1415396844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415396844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTnLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTNLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "1", "chr_pos": "169131437", "evidence": [ { "id": "P05026", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05026" }, { "id": "rs369488918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" }, { "id": "rs369488918", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369488918#frequency_tab" }, { "id": "rs369488918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369488918" }, { "id": "rs369488918", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "93", "site_seq": "QNQCFYnSSYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVnNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVNNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "12", "chr_pos": "64747838", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" }, { "id": "rs1199190795", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199190795" }, { "id": "rs1199190795", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1199190795#frequency_tab" }, { "id": "rs1199190795", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1199190795" }, { "id": "rs1199190795", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1199190795" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on cytoprotective function. No effect on Neisseria binding. No effect on Measles virus binding.", "evidence": [ { "database": "UniProtKB", "id": "P15529", "url": "https://www.uniprot.org/uniprotkb/P15529" }, { "database": "PubMed", "id": "11260136", "url": "https://glygen.org/publication/PubMed/11260136" }, { "database": "PubMed", "id": "9759896", "url": "https://glygen.org/publication/PubMed/9759896" }, { "database": "PubMed", "id": "8764003", "url": "https://glygen.org/publication/PubMed/8764003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "58", "site_seq": "GQSYSVnVTFTSNIQSK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P61916-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "NPC intracellular cholesterol transporter 2", "gene_name": "NPC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 151, "chemical_mass": 16570.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P61916-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "NPC intracellular cholesterol transporter 2", "gene_name": "NPC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 151, "chemical_mass": 16570.0 } ] }, { "start_pos": "58", "site_seq": "EVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P61916-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "NPC intracellular cholesterol transporter 2", "gene_name": "NPC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 151, "chemical_mass": 16570.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "69", "site_seq": "MLFVEPILEVSSLPTTnSTTNSATK", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "11", "chr_pos": "57600032", "evidence": [ { "id": "rs924552014", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924552014" }, { "id": "rs924552014", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924552014#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "11", "chr_pos": "57600032", "evidence": [ { "id": "P05155", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05155" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "57600033", "evidence": [ { "id": "rs1945329565", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1945329565" }, { "id": "rs1945329565", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1945329565" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NnATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "17", "chr_pos": "28369780", "evidence": [ { "id": "rs2067937096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2067937096" }, { "id": "rs2067937096", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2067937096#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "", "site_lbl": "N207", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "16", "chr_pos": "72060289", "evidence": [ { "id": "rs761396788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761396788#frequency_tab" }, { "id": "rs761396788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761396788" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "YTGnASALFILPDQDKMEEVEAMLLPETLK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "YTGnASALFILPDQDK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "14", "chr_pos": "94619363", "evidence": [ { "id": "rs534010283", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534010283" }, { "id": "rs534010283", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs534010283" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] } ], "record_id": "G07810QS" }