{ "glytoucan_ac": "G04657PL", "species": [ { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G41821MR", "url": "https://www.glygen.org/glycan/G41821MR" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 10029, "name": "Cricetulus griseus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G41821MR", "url": "https://www.glygen.org/glycan/G41821MR" } ], "common_name": "Chinese hamster", "glygen_name": "Hamster", "reference_species": "Cricetulus griseus [10029]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G41821MR", "url": "https://www.glygen.org/glycan/G41821MR" }, { "database": "Subsumption", "id": "G52880ZN", "url": "https://www.glygen.org/glycan/G52880ZN" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G33320JS", "url": "https://www.glygen.org/glycan/G33320JS" }, { "database": "Subsumption", "id": "G52880ZN", "url": "https://www.glygen.org/glycan/G52880ZN" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mass": 2078.77, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "O-linked", "url": "" }, "subtype": { "name": "Core 9" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 3, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 4, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "692", "site_seq": "SnISILR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19022-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-2", "gene_name": "CDH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 99809.0 } ] }, { "start_pos": "692", "site_seq": "SNISILR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19022-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-2", "gene_name": "CDH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 99809.0 } ] }, { "start_pos": "692", "site_seq": "N", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19022-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-2", "gene_name": "CDH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 99809.0 } ] }, { "start_pos": "692", "site_seq": "", "site_lbl": "N692", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "18", "chr_pos": "27985134", "evidence": [ { "id": "rs1555630396", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555630396" }, { "id": "rs1555630396", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1555630396" } ], "disease": [ { "disease_id": "DOID:0060688", "name": "arteriovenous malformations of the brain", "description": "A central nervous system benign neoplasm that derives_from endothelial cells and that is located_in the brain.", "url": "http://disease-ontology.org/term/DOID:0060688", "evidence": [ { "id": "0060688", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060688" } ] }, { "disease_id": "DOID:0060688", "name": "arteriovenous malformations of the brain", "description": "A central nervous system benign neoplasm that derives_from endothelial cells and that is located_in the brain.", "url": "http://disease-ontology.org/term/DOID:0060688", "evidence": [ { "id": "0060688", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060688" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19022-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-2", "gene_name": "CDH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 99809.0 } ] }, { "start_pos": "81", "site_seq": "LSGCQNITSTK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17181-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 557, "chemical_mass": 63525.0 } ] }, { "start_pos": "81", "site_seq": "LSGCQnITSTK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17181-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 557, "chemical_mass": 63525.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17181-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 557, "chemical_mass": 63525.0 } ] }, { "start_pos": "400", "site_seq": "LFDWANTSR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NVI7-2", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ATPase family AAA domain-containing protein 3A", "gene_name": "ATAD3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 586, "chemical_mass": 66218.0 } ] }, { "start_pos": "400", "site_seq": "", "site_lbl": "N400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "1", "chr_pos": "1524381", "evidence": [ { "id": "rs747303116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747303116" }, { "id": "rs747303116", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747303116" }, { "id": "rs747303116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747303116" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "1", "chr_pos": "1524382", "evidence": [ { "id": "rs757460899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757460899" }, { "id": "rs757460899", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757460899" }, { "id": "rs757460899", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757460899#frequency_tab" }, { "id": "rs757460899", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757460899" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "1", "chr_pos": "1524382", "evidence": [ { "id": "rs757460899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757460899" }, { "id": "rs757460899", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757460899" }, { "id": "rs757460899", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757460899#frequency_tab" }, { "id": "rs757460899", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757460899" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NVI7-2", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "ATPase family AAA domain-containing protein 3A", "gene_name": "ATAD3A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 586, "chemical_mass": 66218.0 } ] }, { "start_pos": "348", "site_seq": "LGLTPEATNASLLGCMEDLSVNGQR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UVK1-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Chondroitin sulfate proteoglycan 4", "gene_name": "CSPG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2322, "chemical_mass": 250537.0 } ] }, { "start_pos": "348", "site_seq": "LGLTPEATnASLLGCMEDLSVNGQR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UVK1-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Chondroitin sulfate proteoglycan 4", "gene_name": "CSPG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2322, "chemical_mass": 250537.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UVK1-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Chondroitin sulfate proteoglycan 4", "gene_name": "CSPG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2322, "chemical_mass": 250537.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "15", "chr_pos": "75690022", "evidence": [ { "id": "rs1035219869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1035219869" }, { "id": "rs1035219869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1035219869" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UVK1-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Chondroitin sulfate proteoglycan 4", "gene_name": "CSPG4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2322, "chemical_mass": 250537.0 } ] }, { "start_pos": "91", "site_seq": "LLPPVAFNHTIGHIVLSEHK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60805-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "Mertk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 994, "chemical_mass": 110157.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60805-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "Mertk", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 994, "chemical_mass": 110157.0 } ] }, { "start_pos": "956", "site_seq": "TSSQNNVHVLNTNK", "site_lbl": "Asn956", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07409-1", "start_pos": 956, "end_pos": 956, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113232.0 } ] }, { "start_pos": "956", "site_seq": "N", "site_lbl": "Asn956", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07409-1", "start_pos": 956, "end_pos": 956, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1028, "chemical_mass": 113232.0 } ] }, { "start_pos": "225", "site_seq": "NTTISVHPSTR", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29533-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "Vcam1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 81317.0 } ] }, { "start_pos": "225", "site_seq": "N", "site_lbl": "Asn225", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29533-1", "start_pos": 225, "end_pos": 225, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "Vcam1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 739, "chemical_mass": 81317.0 } ] }, { "start_pos": "339", "site_seq": "NGSQVLVR", "site_lbl": "Asn339", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00993-1", "start_pos": 339, "end_pos": 339, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor UFO", "gene_name": "Axl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 98191.0 } ] }, { "start_pos": "339", "site_seq": "N", "site_lbl": "Asn339", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q00993-1", "start_pos": 339, "end_pos": 339, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tyrosine-protein kinase receptor UFO", "gene_name": "Axl", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 888, "chemical_mass": 98191.0 } ] }, { "start_pos": "314", "site_seq": "GNLTIER", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R069-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "Bcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 622, "chemical_mass": 67670.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9R069-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "Bcam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 622, "chemical_mass": 67670.0 } ] }, { "start_pos": "363", "site_seq": "NVSSLADLKPK", "site_lbl": "Asn363", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q810C1-1", "start_pos": 363, "end_pos": 363, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "SLIT and NTRK-like protein 1", "gene_name": "Slitrk1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 696, "chemical_mass": 77817.0 } ] }, { "start_pos": "385", "site_seq": "APLMPWNESSIFHIPR", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10852-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 526, "chemical_mass": 58337.0 } ] }, { "start_pos": "385", "site_seq": "N", "site_lbl": "Asn385", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10852-1", "start_pos": 385, "end_pos": 385, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 526, "chemical_mass": 58337.0 } ] }, { "start_pos": "521", "site_seq": "IILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNK", "site_lbl": "Asn521", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 521, "end_pos": 521, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "521", "site_seq": "N", "site_lbl": "Asn521", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12960-1", "start_pos": 521, "end_pos": 521, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1020, "chemical_mass": 113388.0 } ] }, { "start_pos": "4", "site_seq": "MESNWTVHVFSR", "site_lbl": "Asn4", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08101-1", "start_pos": 4, "end_pos": 4, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II", "gene_name": "Fcgr2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 330, "chemical_mass": 36695.0 } ] }, { "start_pos": "480", "site_seq": "MARHSANTSMHAR", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YF9-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Rho GTPase-activating protein 33", "gene_name": "Arhgap33", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1305, "chemical_mass": 139801.0 } ] }, { "start_pos": "664", "site_seq": "YNTSCSKAYVNHMMSFHSNR", "site_lbl": "Asn664", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68FE8-1", "start_pos": 664, "end_pos": 664, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Zinc finger protein 280D", "gene_name": "Znf280d", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 974, "chemical_mass": 107836.0 } ] }, { "start_pos": "397", "site_seq": "KNQSSELR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "271", "site_seq": "NPDNDTR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YC5-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 597, "chemical_mass": 65701.0 } ] }, { "start_pos": "256", "site_seq": "SPHRPILQAGLPANQTAILGSDVEFHCK", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61851-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "Fgfr3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 801, "chemical_mass": 87758.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61851-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "Fgfr3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 801, "chemical_mass": 87758.0 } ] }, { "start_pos": "81", "site_seq": "KLGGSGGSNGSSSGK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q0VBL3-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "RNA-binding protein 15", "gene_name": "Rbm15", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 962, "chemical_mass": 105722.0 } ] }, { "start_pos": "962", "site_seq": "NGSHCGPDYR", "site_lbl": "Asn962", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9Q6H8-1", "start_pos": 962, "end_pos": 962, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Pleckstrin homology domain containing, family A member 5", "gene_name": "Plekha5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1269, "chemical_mass": 144351.0 } ] }, { "start_pos": "113", "site_seq": "NVETNNSTVLIEGK", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z218-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 804, "chemical_mass": 91260.0 } ] }, { "start_pos": "219", "site_seq": "QAPDVLNFTK", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PVG8-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mucin-2", "gene_name": "Fcgbpl1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 2581, "chemical_mass": 280232.0 } ] }, { "start_pos": "166", "site_seq": "LYLDHNnLTR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "1", "chr_pos": "203347773", "evidence": [ { "id": "rs769517548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769517548" }, { "id": "rs769517548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769517548#frequency_tab" }, { "id": "rs769517548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769517548" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "1246", "site_seq": "CPnGTCIPSSK", "site_lbl": "Asn1246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1246, "end_pos": 1246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1246", "site_seq": "CPNGTCIPSSK", "site_lbl": "Asn1246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1246, "end_pos": 1246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1246", "site_seq": "N", "site_lbl": "Asn1246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1246, "end_pos": 1246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASnFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASNFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "N", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "SRnSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "nSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "NSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "N", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "2054", "site_seq": "HFnESR", "site_lbl": "Asn2054", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 2054, "end_pos": 2054, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "2054", "site_seq": "N", "site_lbl": "Asn2054", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 2054, "end_pos": 2054, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "871", "site_seq": "LTIVnSSVLDRPR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "871", "site_seq": "LTIVNSSVLDRPR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1246", "site_seq": "", "site_lbl": "N1246", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "11", "chr_pos": "121586251", "evidence": [ { "id": "rs1322007624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1322007624" }, { "id": "rs1322007624", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1322007624" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "11", "chr_pos": "121586253", "evidence": [ { "id": "rs1699102", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1699102" }, { "id": "rs1699102", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1699102" }, { "id": "rs1699102", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1699102" }, { "id": "rs1699102", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1699102#frequency_tab" }, { "id": "rs1699102", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1699102" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1246, "end_pos": 1246, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "", "site_lbl": "N1706", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "11", "chr_pos": "121607240", "evidence": [ { "id": "Q92673", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92673" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "", "site_lbl": "N1986", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "11", "chr_pos": "121621130", "evidence": [ { "id": "rs1863717703", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1863717703" }, { "id": "rs1863717703", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1863717703" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "11", "chr_pos": "121557353", "evidence": [ { "id": "rs1238822862", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1238822862" }, { "id": "rs1238822862", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1238822862#frequency_tab" }, { "id": "rs1238822862", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1238822862" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "11", "chr_pos": "121557355", "evidence": [ { "id": "rs1262906894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1262906894" }, { "id": "rs1262906894", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1262906894#frequency_tab" }, { "id": "rs1262906894", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1262906894" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "11", "chr_pos": "121557354", "evidence": [ { "id": "rs1186245679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1186245679" }, { "id": "rs1186245679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1186245679#frequency_tab" }, { "id": "rs1186245679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1186245679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "137", "site_seq": "VVDRGnGSRPSSPEEVK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "137", "site_seq": "GnGSRPSSPEEVK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "137", "site_seq": "GNGSRPSSPEEVK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "", "site_lbl": "N94", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "8", "chr_pos": "120162501", "evidence": [ { "id": "rs1815713404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1815713404" }, { "id": "rs1815713404", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1815713404#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "116", "site_seq": "VCSNDnK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "2243", "site_seq": "SPGTANVLDVnNSTLMFVGGLGGQIK", "site_lbl": "Asn2243", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2243, "end_pos": 2243, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2243", "site_seq": "N", "site_lbl": "Asn2243", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2243, "end_pos": 2243, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2408", "site_seq": "QGVLAVIDAYnTSNK", "site_lbl": "Asn2408", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2408, "end_pos": 2408, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2408", "site_seq": "KQGVLAVIDAYNTSNK", "site_lbl": "Asn2408", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2408, "end_pos": 2408, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2619", "site_seq": "TInVSNLYVGGIPEGEGTSLLTMR", "site_lbl": "Asn2619", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2619, "end_pos": 2619, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2852", "site_seq": "IGnITHSIPACIGDVTVNSK", "site_lbl": "Asn2852", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2852, "end_pos": 2852, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2852", "site_seq": "KIGNITHSIPACIGDVTVNSK", "site_lbl": "Asn2852", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2852, "end_pos": 2852, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2852", "site_seq": "N", "site_lbl": "Asn2852", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2852, "end_pos": 2852, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSInNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSINNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "N", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2243", "site_seq": "", "site_lbl": "N2243", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "18", "chr_pos": "6973104", "evidence": [ { "id": "rs1600361352", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600361352" }, { "id": "rs1600361352", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600361352" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2243, "end_pos": 2243, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2408", "site_seq": "", "site_lbl": "N2408", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "18", "chr_pos": "6964776", "evidence": [ { "id": "rs2057624969", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2057624969" }, { "id": "rs2057624969", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2057624969#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2408, "end_pos": 2408, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "2852", "site_seq": "", "site_lbl": "N2852", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "18", "chr_pos": "6949102", "evidence": [ { "id": "rs374227019", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374227019" }, { "id": "rs374227019", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374227019" }, { "id": "rs374227019", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374227019#frequency_tab" }, { "id": "rs374227019", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374227019" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 2852, "end_pos": 2852, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "", "site_lbl": "N555", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "18", "chr_pos": "7037651", "evidence": [ { "id": "rs1568041333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1568041333" }, { "id": "rs1568041333", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1568041333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "19", "chr_pos": "10284819", "evidence": [ { "id": "rs368566175", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368566175" }, { "id": "rs368566175", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368566175#frequency_tab" }, { "id": "rs368566175", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368566175" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "212", "site_seq": "LTnNSNQFQTEVGK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "212", "site_seq": "LTNNSNQFQTEVGK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LnFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LNFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->DNS).", "chr_id": "21", "chr_pos": "44901599", "evidence": [ { "id": "rs376609171", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376609171" }, { "id": "rs376609171", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376609171" }, { "id": "rs376609171", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376609171#frequency_tab" }, { "id": "rs376609171", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376609171" } ], "disease": [ { "disease_id": "DOID:0110910", "name": "leukocyte adhesion deficiency 1", "description": "A leukocyte adhesion deficiency that has_material_basis_in mutation of the ITGB2 gene on chromosome 21q22.3.", "url": "http://disease-ontology.org/term/DOID:0110910", "evidence": [ { "id": "0110910", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110910" } ] }, { "disease_id": "DOID:0110910", "name": "leukocyte adhesion deficiency 1", "description": "A leukocyte adhesion deficiency that has_material_basis_in mutation of the ITGB2 gene on chromosome 21q22.3.", "url": "http://disease-ontology.org/term/DOID:0110910", "evidence": [ { "id": "0110910", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110910" } ] }, { "disease_id": "DOID:0110910", "name": "leukocyte adhesion deficiency 1", "description": "A leukocyte adhesion deficiency that has_material_basis_in mutation of the ITGB2 gene on chromosome 21q22.3.", "url": "http://disease-ontology.org/term/DOID:0110910", "evidence": [ { "id": "0110910", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110910" } ] }, { "disease_id": "DOID:0110910", "name": "leukocyte adhesion deficiency 1", "description": "A leukocyte adhesion deficiency that has_material_basis_in mutation of the ITGB2 gene on chromosome 21q22.3.", "url": "http://disease-ontology.org/term/DOID:0110910", "evidence": [ { "id": "0110910", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110910" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->YFT).", "chr_id": "21", "chr_pos": "44907095", "evidence": [ { "id": "rs199810704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199810704" }, { "id": "rs199810704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199810704" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1200", "site_seq": "nVTWQECCCTVGEGWGSGCR", "site_lbl": "Asn1200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1200, "end_pos": 1200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1200", "site_seq": "N", "site_lbl": "Asn1200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1200, "end_pos": 1200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1339", "site_seq": "CVSnESQSLDDNLGVCWQEVGADLVCSHPR", "site_lbl": "Asn1339", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1339, "end_pos": 1339, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1339", "site_seq": "N", "site_lbl": "Asn1339", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1339, "end_pos": 1339, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "352", "site_seq": "VSAPDGPCPTGFERVnGSCEDVDECATGGR", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "352", "site_seq": "VnGSCEDVDECATGGR", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "352", "site_seq": "VNGSCEDVDECATGGR", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1200", "site_seq": "", "site_lbl": "N1200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "19", "chr_pos": "40622580", "evidence": [ { "id": "rs1390445131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1390445131" }, { "id": "rs1390445131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1390445131#frequency_tab" }, { "id": "rs1390445131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1390445131" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1200, "end_pos": 1200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1339", "site_seq": "", "site_lbl": "N1339", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "19", "chr_pos": "40624064", "evidence": [ { "id": "rs1448771108", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1448771108" }, { "id": "rs1448771108", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1448771108#frequency_tab" }, { "id": "rs1448771108", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1448771108" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "19", "chr_pos": "40624065", "evidence": [ { "id": "rs766422441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766422441" }, { "id": "rs766422441", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766422441" }, { "id": "rs766422441", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766422441" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 1339, "end_pos": 1339, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "352", "site_seq": "", "site_lbl": "N352", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "19", "chr_pos": "40606293", "evidence": [ { "id": "rs757515562", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757515562" }, { "id": "rs757515562", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757515562" }, { "id": "rs757515562", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757515562" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "19", "chr_pos": "40606292", "evidence": [ { "id": "rs1184228628", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1184228628" }, { "id": "rs1184228628", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1184228628" }, { "id": "rs1184228628", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1184228628" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8N2S1-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 4", "gene_name": "LTBP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1624, "chemical_mass": 173435.0 } ] }, { "start_pos": "1355", "site_seq": "LNLYLDSVnETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "N", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "KVEYDHGKLNLYLDSVNETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "419", "site_seq": "InYTVPQSGTFK", "site_lbl": "Asn419", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "419", "site_seq": "N", "site_lbl": "Asn419", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "419", "site_seq": "INYTVPQSGTFK", "site_lbl": "Asn419", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "TASnLTVSVLEAEGVFEK", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "N", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "TASNLTVSVLEAEGVFEK", "site_lbl": "Asn68", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "", "site_lbl": "N1355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "419", "site_seq": "", "site_lbl": "N419", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "6", "chr_pos": "73766078", "evidence": [ { "id": "rs763542055", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763542055" }, { "id": "rs763542055", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763542055" }, { "id": "rs763542055", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763542055#frequency_tab" }, { "id": "rs763542055", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763542055" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 419, "end_pos": 419, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "68", "site_seq": "", "site_lbl": "N68", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "73697527", "evidence": [ { "id": "rs1002167718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1002167718" }, { "id": "rs1002167718", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1002167718#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "73697527", "evidence": [ { "id": "rs1002167718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1002167718" }, { "id": "rs1002167718", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1002167718#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 68, "end_pos": 68, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "333", "site_seq": "LDnYSTQELGK", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21589-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "5'-nucleotidase", "gene_name": "NT5E", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 63368.0 } ] }, { "start_pos": "333", "site_seq": "IKLDNYSTQELGK", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21589-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "5'-nucleotidase", "gene_name": "NT5E", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 63368.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21589-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "5'-nucleotidase", "gene_name": "NT5E", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 63368.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "6", "chr_pos": "85487383", "evidence": [ { "id": "P21589", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P21589" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21589-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "5'-nucleotidase", "gene_name": "NT5E", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 574, "chemical_mass": 63368.0 } ] }, { "start_pos": "1755", "site_seq": "NLHQSnTSR", "site_lbl": "Asn1755", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 1755, "end_pos": 1755, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "1755", "site_seq": "NLHQSNTSR", "site_lbl": "Asn1755", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 1755, "end_pos": 1755, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "1755", "site_seq": "N", "site_lbl": "Asn1755", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 1755, "end_pos": 1755, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "1755", "site_seq": "", "site_lbl": "N1755", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "1", "chr_pos": "21859596", "evidence": [ { "id": "rs1639631897", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1639631897" }, { "id": "rs1639631897", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1639631897" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "1", "chr_pos": "21859595", "evidence": [ { "id": "rs1471314533", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471314533" }, { "id": "rs1471314533", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1471314533#frequency_tab" }, { "id": "rs1471314533", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1471314533" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 1755, "end_pos": 1755, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "52", "site_seq": "VFHINQPAEFIEDQSILnLTFSDCK", "site_lbl": "Asn52", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 52, "end_pos": 52, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "52", "site_seq": "N", "site_lbl": "Asn52", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 52, "end_pos": 52, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "530", "site_seq": "DPAGWLNINPInGTVDTTAVLDR", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "530", "site_seq": "N", "site_lbl": "Asn530", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "598", "site_seq": "nLSVVILGASDK", "site_lbl": "Asn598", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "598", "site_seq": "N", "site_lbl": "Asn598", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "671", "site_seq": "ANYNLPIMVTDSGKPPMTnITDLR", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "671", "site_seq": "N", "site_lbl": "Asn671", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "52", "site_seq": "", "site_lbl": "N52", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "16", "chr_pos": "82858471", "evidence": [ { "id": "rs2039794722", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2039794722" }, { "id": "rs2039794722", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2039794722" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 52, "end_pos": 52, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "530", "site_seq": "", "site_lbl": "N530", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "16", "chr_pos": "83748158", "evidence": [ { "id": "rs949898354", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs949898354" }, { "id": "rs949898354", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs949898354#frequency_tab" }, { "id": "rs949898354", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs949898354" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "16", "chr_pos": "83748158", "evidence": [ { "id": "rs949898354", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs949898354" }, { "id": "rs949898354", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs949898354#frequency_tab" }, { "id": "rs949898354", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs949898354" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 530, "end_pos": 530, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "598", "site_seq": "", "site_lbl": "N598", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "16", "chr_pos": "83780080", "evidence": [ { "id": "rs1181604361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181604361" }, { "id": "rs1181604361", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1181604361#frequency_tab" }, { "id": "rs1181604361", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181604361" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 598, "end_pos": 598, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "671", "site_seq": "", "site_lbl": "N671", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "16", "chr_pos": "83783349", "evidence": [ { "id": "rs1431065194", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1431065194" }, { "id": "rs1431065194", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1431065194#frequency_tab" }, { "id": "rs1431065194", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1431065194" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "83783350", "evidence": [ { "id": "rs1330128600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1330128600" }, { "id": "rs1330128600", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1330128600#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55290-1", "start_pos": 671, "end_pos": 671, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-13", "gene_name": "CDH13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 713, "chemical_mass": 78287.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "932", "site_seq": "CVEESGSAHCVCPMLTCPEAnATK", "site_lbl": "Asn932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 932, "end_pos": 932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "932", "site_seq": "N", "site_lbl": "Asn932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 932, "end_pos": 932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "932", "site_seq": "CVEESGSAHCVCPMLTCPEANATK", "site_lbl": "Asn932", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 932, "end_pos": 932, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "360", "site_seq": "QLVLnLTGNTLCAGGASDEK", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "7", "chr_pos": "131508973", "evidence": [ { "id": "rs960596154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs960596154" }, { "id": "rs960596154", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs960596154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "371", "site_seq": "nVTMGQSSAR", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "371", "site_seq": "GDKNVTMGQSSAR", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "371", "site_seq": "N", "site_lbl": "Asn371", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "453", "site_seq": "LSAVNSIFLSHnNTK", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "453", "site_seq": "LSAVNSIFLSHNNTK", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "453", "site_seq": "RLSAVNSIFLSHnNTK", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "371", "site_seq": "", "site_lbl": "N371", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "19", "chr_pos": "14401690", "evidence": [ { "id": "rs61733711", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733711" }, { "id": "rs61733711", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61733711" }, { "id": "rs61733711", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733711" }, { "id": "rs61733711", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61733711#frequency_tab" }, { "id": "rs61733711", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61733711" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 371, "end_pos": 371, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "19", "chr_pos": "14402771", "evidence": [ { "id": "rs141666295", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141666295" }, { "id": "rs141666295", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141666295" }, { "id": "rs141666295", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141666295#frequency_tab" }, { "id": "rs141666295", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141666295" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P48960-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E5", "gene_name": "ADGRE5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 835, "chemical_mass": 91869.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "RnWTEAEVK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "nWTEAEVK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "89637535", "evidence": [ { "id": "P16444", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16444" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "16", "chr_pos": "89637902", "evidence": [ { "id": "rs1341032596", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1341032596" }, { "id": "rs1341032596", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1341032596" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "16", "chr_pos": "89637901", "evidence": [ { "id": "rs746299372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746299372" }, { "id": "rs746299372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746299372" }, { "id": "rs746299372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746299372#frequency_tab" }, { "id": "rs746299372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746299372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "125", "site_seq": "FTFTSHTPGEHQICLHSnSTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "FTFTSHTPGEHQICLHSNSTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "5", "chr_pos": "177593738", "evidence": [ { "id": "rs755812768", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755812768" }, { "id": "rs755812768", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755812768#frequency_tab" }, { "id": "rs755812768", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755812768" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "5", "chr_pos": "177593738", "evidence": [ { "id": "rs755812768", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755812768" }, { "id": "rs755812768", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755812768#frequency_tab" }, { "id": "rs755812768", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755812768" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BVK6-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 27277.0 } ] }, { "start_pos": "485", "site_seq": "CDGWADCTDHSDELnCSCDAGHQFTCK", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Y6-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 855, "chemical_mass": 94770.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Y6-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 855, "chemical_mass": 94770.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "3", "chr_pos": "149210360", "evidence": [ { "id": "rs757785679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757785679#frequency_tab" }, { "id": "rs757785679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757785679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "3", "chr_pos": "149206185", "evidence": [ { "id": "rs146229133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs146229133" }, { "id": "rs146229133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146229133#frequency_tab" }, { "id": "rs146229133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146229133" } ], "disease": [ { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "89", "site_seq": "GSnYTSK", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "16", "chr_pos": "30475519", "evidence": [ { "id": "rs2151141095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2151141095" }, { "id": "rs2151141095", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2151141095" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "16", "chr_pos": "30475520", "evidence": [ { "id": "rs2050457701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2050457701" }, { "id": "rs2050457701", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2050457701#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20701-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 128770.0 } ] }, { "start_pos": "766", "site_seq": "ETnTTSQMQAALLEK", "site_lbl": "Asn766", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6C2-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EMILIN-1", "gene_name": "EMILIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1016, "chemical_mass": 106695.0 } ] }, { "start_pos": "766", "site_seq": "N", "site_lbl": "Asn766", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6C2-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EMILIN-1", "gene_name": "EMILIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1016, "chemical_mass": 106695.0 } ] }, { "start_pos": "766", "site_seq": "", "site_lbl": "N766", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "2", "chr_pos": "27083867", "evidence": [ { "id": "rs369893643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369893643" }, { "id": "rs369893643", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369893643#frequency_tab" }, { "id": "rs369893643", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369893643" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "27083868", "evidence": [ { "id": "rs1025098049", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1025098049" }, { "id": "rs1025098049", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1025098049#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "2", "chr_pos": "27083867", "evidence": [ { "id": "Q9Y6C2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y6C2" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6C2-1", "start_pos": 766, "end_pos": 766, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EMILIN-1", "gene_name": "EMILIN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1016, "chemical_mass": 106695.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFnLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFNLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "N", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "AACAVKPQEVQMVnGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "N", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "PQEVQMVNGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "626", "site_seq": "TEGEnCTVFDSQAGFSFDLSPLTK", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "626", "site_seq": "N", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "626", "site_seq": "TEGENCTVFDSQAGFSFDLSPLTK", "site_lbl": "Asn626", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "747", "site_seq": "DAGVGFPEYQEEDnSTYNFR", "site_lbl": "Asn747", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 747, "end_pos": 747, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "747", "site_seq": "ATLITFLCDRDAGVGFPEYQEEDnSTYNFR", "site_lbl": "Asn747", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 747, "end_pos": 747, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "747", "site_seq": "N", "site_lbl": "Asn747", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 747, "end_pos": 747, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "747", "site_seq": "DAGVGFPEYQEEDNSTYNFR", "site_lbl": "Asn747", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 747, "end_pos": 747, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "", "site_lbl": "N1816", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "6", "chr_pos": "160078330", "evidence": [ { "id": "rs747144122", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747144122" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "6", "chr_pos": "160078331", "evidence": [ { "id": "rs1778899449", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778899449" }, { "id": "rs1778899449", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1778899449" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "626", "site_seq": "", "site_lbl": "N626", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "6", "chr_pos": "160045857", "evidence": [ { "id": "P11717", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11717" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "6", "chr_pos": "160045856", "evidence": [ { "id": "rs1346954194", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1346954194" }, { "id": "rs1346954194", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1346954194#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 626, "end_pos": 626, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "160050569", "evidence": [ { "id": "rs1778172796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778172796" }, { "id": "rs1778172796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1778172796#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "273", "site_seq": "GFYLDGSDTIVCDSnSTWDPPVPK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "273", "site_seq": "GFYLDGSDTIVCDSNSTWDPPVPK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "273", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Strongly decreases cytoprotective function. Abolishes Neisseria binding. No effect on Measles virus binding.", "evidence": [ { "database": "UniProtKB", "id": "P15529", "url": "https://www.uniprot.org/uniprotkb/P15529" }, { "database": "PubMed", "id": "11260136", "url": "https://glygen.org/publication/PubMed/11260136" }, { "database": "PubMed", "id": "9759896", "url": "https://glygen.org/publication/PubMed/9759896" }, { "database": "PubMed", "id": "8764003", "url": "https://glygen.org/publication/PubMed/8764003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on cytoprotective function. No effect on Neisseria binding. No effect on Measles virus binding.", "evidence": [ { "database": "UniProtKB", "id": "P15529", "url": "https://www.uniprot.org/uniprotkb/P15529" }, { "database": "PubMed", "id": "11260136", "url": "https://glygen.org/publication/PubMed/11260136" }, { "database": "PubMed", "id": "9759896", "url": "https://glygen.org/publication/PubMed/9759896" }, { "database": "PubMed", "id": "8764003", "url": "https://glygen.org/publication/PubMed/8764003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "130", "site_seq": "MATPLLMQALPMGALPQGPMQnATK", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "136", "site_seq": "YGnMTEDHVMHLLQNADPLK", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->YAT).", "chr_id": "5", "chr_pos": "150406312", "evidence": [ { "id": "rs1234104385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234104385" }, { "id": "rs1234104385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234104385" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04233-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 296, "chemical_mass": 33516.0 } ] }, { "start_pos": "394", "site_seq": "IIQQTWnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "394", "site_seq": "IIQQTWNR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "86", "site_seq": "SVEGnGTGR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "5", "chr_pos": "32712033", "evidence": [ { "id": "P17342", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17342" }, { "id": "rs1424099431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1424099431" }, { "id": "rs1424099431", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1424099431" }, { "id": "rs1424099431", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1424099431" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17342-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "NPR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 541, "chemical_mass": 59808.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "673", "site_seq": "IVAGSCVDCQALnTSTCPPNSVK", "site_lbl": "Asn673", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 673, "end_pos": 673, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "673", "site_seq": "N", "site_lbl": "Asn673", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 673, "end_pos": 673, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "712", "site_seq": "GCASYCnQTIMEQGCCK", "site_lbl": "Asn712", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 712, "end_pos": 712, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "712", "site_seq": "N", "site_lbl": "Asn712", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 712, "end_pos": 712, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "816", "site_seq": "FCnESMGDCGPTGLAQHCHLHAR", "site_lbl": "Asn816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 816, "end_pos": 816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "816", "site_seq": "N", "site_lbl": "Asn816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 816, "end_pos": 816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "712", "site_seq": "", "site_lbl": "N712", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "52508012", "evidence": [ { "id": "rs1709004831", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1709004831" }, { "id": "rs1709004831", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1709004831" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "3", "chr_pos": "52508014", "evidence": [ { "id": "rs1207373477", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207373477" }, { "id": "rs1207373477", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1207373477#frequency_tab" }, { "id": "rs1207373477", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1207373477" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY15-1", "start_pos": 712, "end_pos": 712, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Stabilin-1", "gene_name": "STAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2570, "chemical_mass": 275482.0 } ] }, { "start_pos": "83", "site_seq": "GSEGGnGSNPVAGLETDDHGGK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TBP5-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane protein FAM174A", "gene_name": "FAM174A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 19954.0 } ] }, { "start_pos": "83", "site_seq": "GSEGGNGSNPVAGLETDDHGGK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TBP5-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane protein FAM174A", "gene_name": "FAM174A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 19954.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8TBP5-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane protein FAM174A", "gene_name": "FAM174A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 19954.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "100535777", "evidence": [ { "id": "rs1745930504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1745930504" }, { "id": "rs1745930504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1745930504" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8TBP5-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane protein FAM174A", "gene_name": "FAM174A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 19954.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "EHEAQSnASLDVFLGHTNVEELMK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "", "site_lbl": "N514", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "12", "chr_pos": "7081108", "evidence": [ { "id": "rs762138868", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762138868#frequency_tab" }, { "id": "rs762138868", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762138868" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "12", "chr_pos": "7081109", "evidence": [ { "id": "rs1305246309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305246309" }, { "id": "rs1305246309", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305246309#frequency_tab" }, { "id": "rs1305246309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305246309" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "125", "site_seq": "DAGVVCTnETR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "ALGFEnATQALGR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "17", "chr_pos": "78974689", "evidence": [ { "id": "rs778454792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778454792" }, { "id": "rs778454792", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778454792#frequency_tab" }, { "id": "rs778454792", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778454792" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "17", "chr_pos": "78974690", "evidence": [ { "id": "Q08380", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q08380" }, { "id": "rs1461262648", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1461262648" }, { "id": "rs1461262648", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1461262648" }, { "id": "rs1461262648", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1461262648" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "17", "chr_pos": "78972140", "evidence": [ { "id": "rs923974095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs923974095" }, { "id": "rs923974095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs923974095#frequency_tab" }, { "id": "rs923974095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs923974095" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "17", "chr_pos": "78976002", "evidence": [ { "id": "rs770079138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770079138" }, { "id": "rs770079138", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770079138#frequency_tab" }, { "id": "rs770079138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770079138" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "78976003", "evidence": [ { "id": "rs968684090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs968684090" }, { "id": "rs968684090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs968684090#frequency_tab" }, { "id": "rs968684090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs968684090" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "TnFTSK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "SRTnFTSK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "79", "site_seq": "", "site_lbl": "N79", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "NC_000011.10", "chr_pos": "119420188", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "373", "site_seq": "VIDGTPCDQnGTAICVSGQCK", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "373", "site_seq": "N", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "373", "site_seq": "VIDGTPCDQNGTAICVSGQCK", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "215", "site_seq": "nTTGFK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "315", "site_seq": "N", "site_lbl": "Asn315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "315", "site_seq": "HVNEInATIYLLK", "site_lbl": "Asn315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "315", "site_seq": "HVNEINATIYLLK", "site_lbl": "Asn315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "531", "site_seq": "VREQMEVVnMSLSTSADSLTTPR", "site_lbl": "Asn531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 531, "end_pos": 531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "531", "site_seq": "EQMEVVnMSLSTSADSLTTPR", "site_lbl": "Asn531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 531, "end_pos": 531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "531", "site_seq": "EQMEVVNMSLSTSADSLTTPR", "site_lbl": "Asn531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 531, "end_pos": 531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "531", "site_seq": "N", "site_lbl": "Asn531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 531, "end_pos": 531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "742", "site_seq": "LITEEAnR", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "742", "site_seq": "N", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "742", "site_seq": "LITEEANR", "site_lbl": "Asn742", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "787", "site_seq": "DAVRnLTEVVPQLLDQLR", "site_lbl": "Asn787", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 787, "end_pos": 787, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "787", "site_seq": "N", "site_lbl": "Asn787", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 787, "end_pos": 787, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "787", "site_seq": "nLTEVVPQLLDQLR", "site_lbl": "Asn787", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 787, "end_pos": 787, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "787", "site_seq": "NLTEVVPQLLDQLR", "site_lbl": "Asn787", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 787, "end_pos": 787, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "215", "site_seq": "", "site_lbl": "N215", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "6", "chr_pos": "112191710", "evidence": [ { "id": "rs1340244712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1340244712" }, { "id": "rs1340244712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1340244712#frequency_tab" }, { "id": "rs1340244712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1340244712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "315", "site_seq": "", "site_lbl": "N315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "6", "chr_pos": "112187471", "evidence": [ { "id": "rs782772720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782772720" }, { "id": "rs782772720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782772720" }, { "id": "rs782772720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782772720#frequency_tab" }, { "id": "rs782772720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782772720" } ], "disease": [ { "disease_id": "DOID:0081164", "name": "obsolete dilated cardiomyopathy 3B", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the gene encoding dystrophin (DMD) on chromosome Xp21.", "url": "http://disease-ontology.org/term/DOID:0081164", "evidence": [ { "id": "302045", "database": "MIM", "url": "https://www.omim.org/entry/302045" } ] }, { "disease_id": "DOID:0081164", "name": "obsolete dilated cardiomyopathy 3B", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the gene encoding dystrophin (DMD) on chromosome Xp21.", "url": "http://disease-ontology.org/term/DOID:0081164", "evidence": [ { "id": "302045", "database": "MIM", "url": "https://www.omim.org/entry/302045" } ] }, { "disease_id": "DOID:0081164", "name": "obsolete dilated cardiomyopathy 3B", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the gene encoding dystrophin (DMD) on chromosome Xp21.", "url": "http://disease-ontology.org/term/DOID:0081164", "evidence": [ { "id": "302045", "database": "MIM", "url": "https://www.omim.org/entry/302045" } ] }, { "disease_id": "DOID:0081164", "name": "obsolete dilated cardiomyopathy 3B", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the gene encoding dystrophin (DMD) on chromosome Xp21.", "url": "http://disease-ontology.org/term/DOID:0081164", "evidence": [ { "id": "302045", "database": "MIM", "url": "https://www.omim.org/entry/302045" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "6", "chr_pos": "112187472", "evidence": [ { "id": "rs1029188462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1029188462" }, { "id": "rs1029188462", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1029188462#frequency_tab" }, { "id": "rs1029188462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1029188462" } ], "disease": [ { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 315, "end_pos": 315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "", "site_lbl": "N557", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "112158878", "evidence": [ { "id": "rs1554337654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337654" }, { "id": "rs1554337654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337654" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "6", "chr_pos": "112158879", "evidence": [ { "id": "rs1554337657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337657" }, { "id": "rs1554337657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337657" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "742", "site_seq": "", "site_lbl": "N742", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "6", "chr_pos": "112148285", "evidence": [ { "id": "rs374279330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374279330" }, { "id": "rs374279330", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374279330" }, { "id": "rs374279330", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374279330#frequency_tab" }, { "id": "rs374279330", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374279330" } ], "disease": [ { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 742, "end_pos": 742, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "208", "site_seq": "LFEFSLDDLPSEFQQVnITPSK", "site_lbl": "Asn208", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P0K1-1", "start_pos": 208, "end_pos": 208, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "ADAM22", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 100433.0 } ] }, { "start_pos": "208", "site_seq": "", "site_lbl": "N208", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "7", "chr_pos": "88125605", "evidence": [ { "id": "rs747485610", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747485610" }, { "id": "rs747485610", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747485610" }, { "id": "rs747485610", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747485610#frequency_tab" }, { "id": "rs747485610", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747485610" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9P0K1-1", "start_pos": 208, "end_pos": 208, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 22", "gene_name": "ADAM22", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 906, "chemical_mass": 100433.0 } ] }, { "start_pos": "261", "site_seq": "nLSLDVEANR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "261", "site_seq": "NLSLDVEANR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTnGSLVLATPGAGARPEPDSLQAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTNGSLVLATPGAGAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "472", "site_seq": "QLLELnLTLQHLQGGHADLIK", "site_lbl": "Asn472", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 472, "end_pos": 472, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "472", "site_seq": "N", "site_lbl": "Asn472", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 472, "end_pos": 472, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "845", "site_seq": "FnTTYINIGSSYFPEHGYFR", "site_lbl": "Asn845", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 845, "end_pos": 845, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "845", "site_seq": "N", "site_lbl": "Asn845", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 845, "end_pos": 845, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "10", "chr_pos": "86944003", "evidence": [ { "id": "rs1420278294", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420278294" }, { "id": "rs1420278294", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1420278294#frequency_tab" }, { "id": "rs1420278294", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420278294" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "", "site_lbl": "N350", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "10", "chr_pos": "86943736", "evidence": [ { "id": "rs1844020028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1844020028" }, { "id": "rs1844020028", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1844020028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "86943735", "evidence": [ { "id": "rs768730692", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768730692" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "472", "site_seq": "", "site_lbl": "N472", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "10", "chr_pos": "86943368", "evidence": [ { "id": "rs1441335291", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1441335291" }, { "id": "rs1441335291", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1441335291#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 472, "end_pos": 472, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "845", "site_seq": "", "site_lbl": "N845", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "10", "chr_pos": "86937059", "evidence": [ { "id": "rs1370137978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370137978" }, { "id": "rs1370137978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1370137978#frequency_tab" }, { "id": "rs1370137978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370137978" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 845, "end_pos": 845, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "286", "site_seq": "nVSVAEGK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "286", "site_seq": "NVSVAEGK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "413", "site_seq": "VAEAVSSPAGVGVTWLEPDYQVYLnASK", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "413", "site_seq": "N", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "413", "site_seq": "", "site_lbl": "N413", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "1", "chr_pos": "116961266", "evidence": [ { "id": "rs746607951", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746607951" }, { "id": "rs746607951", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746607951" }, { "id": "rs746607951", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746607951#frequency_tab" }, { "id": "rs746607951", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746607951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9P2B2-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin F2 receptor negative regulator", "gene_name": "PTGFRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 98556.0 } ] }, { "start_pos": "182", "site_seq": "InATDADEPNTLNSK", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "182", "site_seq": "INATDADEPNTLNSK", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "182", "site_seq": "", "site_lbl": "N182", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "18", "chr_pos": "31522105", "evidence": [ { "id": "rs2510911569", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2510911569" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "18", "chr_pos": "31522104", "evidence": [ { "id": "rs368512832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368512832" }, { "id": "rs368512832", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs368512832" }, { "id": "rs368512832", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368512832" }, { "id": "rs368512832", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368512832#frequency_tab" }, { "id": "rs368512832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368512832" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "", "site_lbl": "N462", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "18", "chr_pos": "31536255", "evidence": [ { "id": "rs2144341490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2144341490" }, { "id": "rs2144341490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2144341490" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "18", "chr_pos": "31535375", "evidence": [ { "id": "rs745484404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745484404" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "18", "chr_pos": "31536256", "evidence": [ { "id": "rs375679311", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375679311#frequency_tab" }, { "id": "rs375679311", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375679311" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->nullGT).", "chr_id": "18", "chr_pos": "31535374", "evidence": [ { "id": "rs2510917341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2510917341" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969P0-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "IGSF8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 65034.0 } ] }, { "start_pos": "327", "site_seq": "IGPGEPLELLCnVSGALPPAGR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969P0-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "IGSF8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 65034.0 } ] }, { "start_pos": "327", "site_seq": "IGPGEPLELLCNVSGALPPAGR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q969P0-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "IGSF8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 65034.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "1", "chr_pos": "160093256", "evidence": [ { "id": "rs1650137410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1650137410" }, { "id": "rs1650137410", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1650137410#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q969P0-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "IGSF8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 65034.0 } ] }, { "start_pos": "79", "site_seq": "nTTAECWDEK", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13361-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibrillar-associated protein 5", "gene_name": "MFAP5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 173, "chemical_mass": 19612.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13361-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibrillar-associated protein 5", "gene_name": "MFAP5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 173, "chemical_mass": 19612.0 } ] }, { "start_pos": "79", "site_seq": "", "site_lbl": "N79", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "12", "chr_pos": "8651673", "evidence": [ { "id": "rs139330366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139330366" }, { "id": "rs139330366", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139330366" }, { "id": "rs139330366", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139330366" }, { "id": "rs139330366", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139330366#frequency_tab" }, { "id": "rs139330366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139330366" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "12", "chr_pos": "8651673", "evidence": [ { "id": "rs139330366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139330366" }, { "id": "rs139330366", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139330366" }, { "id": "rs139330366", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139330366" }, { "id": "rs139330366", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139330366#frequency_tab" }, { "id": "rs139330366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139330366" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->nullTT).", "chr_id": "12", "chr_pos": "8651679", "evidence": [ { "id": "rs746355340", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746355340" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13361-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibrillar-associated protein 5", "gene_name": "MFAP5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 173, "chemical_mass": 19612.0 } ] }, { "start_pos": "695", "site_seq": "NMQIAnHTLK", "site_lbl": "Asn695", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 695, "end_pos": 695, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "695", "site_seq": "N", "site_lbl": "Asn695", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 695, "end_pos": 695, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "695", "site_seq": "NMQIANHTLK", "site_lbl": "Asn695", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 695, "end_pos": 695, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "942", "site_seq": "EADDFFTSLGLLPVPPEFWnK", "site_lbl": "Asn942", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 942, "end_pos": 942, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "942", "site_seq": "N", "site_lbl": "Asn942", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 942, "end_pos": 942, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "695", "site_seq": "", "site_lbl": "N695", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "17", "chr_pos": "63486582", "evidence": [ { "id": "rs762256846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762256846" }, { "id": "rs762256846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762256846" }, { "id": "rs762256846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762256846#frequency_tab" }, { "id": "rs762256846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762256846" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 695, "end_pos": 695, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "942", "site_seq": "", "site_lbl": "N942", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->DKS).", "chr_id": "17", "chr_pos": "63491293", "evidence": [ { "id": "rs1290388486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290388486" }, { "id": "rs1290388486", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1290388486#frequency_tab" }, { "id": "rs1290388486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1290388486" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->HKS).", "chr_id": "17", "chr_pos": "63491293", "evidence": [ { "id": "rs1290388486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290388486" }, { "id": "rs1290388486", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1290388486#frequency_tab" }, { "id": "rs1290388486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1290388486" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "17", "chr_pos": "63491295", "evidence": [ { "id": "rs201517271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201517271" }, { "id": "rs201517271", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201517271" }, { "id": "rs201517271", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201517271" }, { "id": "rs201517271", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201517271#frequency_tab" }, { "id": "rs201517271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201517271" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "17", "chr_pos": "63491294", "evidence": [ { "id": "rs2030363936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2030363936" }, { "id": "rs2030363936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2030363936#frequency_tab" }, { "id": "rs2030363936", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2030363936" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 942, "end_pos": 942, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "55", "site_seq": "N", "site_lbl": "Asn55", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "55", "site_seq": "GCVLLSYLnETVTVSASLESVR", "site_lbl": "Asn55", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "55", "site_seq": "GCVLLSYLnETVTVSASLESVRGNR", "site_lbl": "Asn55", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "55", "site_seq": "GCVLLSYLNETVTVSASLESVR", "site_lbl": "Asn55", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 55, "end_pos": 55, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAARNPVK", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "437", "site_seq": "IFNIDSGnGSIFTSK", "site_lbl": "Asn437", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 437, "end_pos": 437, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "437", "site_seq": "N", "site_lbl": "Asn437", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 437, "end_pos": 437, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "LLDRETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "ETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "", "site_lbl": "N399", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "5", "chr_pos": "31305369", "evidence": [ { "id": "rs1306227333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1306227333" }, { "id": "rs1306227333", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1306227333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "437", "site_seq": "", "site_lbl": "N437", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->TGS).", "chr_id": "5", "chr_pos": "31313374", "evidence": [ { "id": "rs776053051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776053051" }, { "id": "rs776053051", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776053051" }, { "id": "rs776053051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776053051#frequency_tab" }, { "id": "rs776053051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776053051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 437, "end_pos": 437, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "1160", "site_seq": "VWIALNSnLTDNQYTWTDK", "site_lbl": "Asn1160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1160, "end_pos": 1160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "1160", "site_seq": "N", "site_lbl": "Asn1160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1160, "end_pos": 1160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "1205", "site_seq": "TAHCnESFYFLCK", "site_lbl": "Asn1205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1205, "end_pos": 1205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "1205", "site_seq": "N", "site_lbl": "Asn1205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1205, "end_pos": 1205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "1160", "site_seq": "", "site_lbl": "N1160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->TLT); n-glyco-sequon-gain (NSN->NST).", "chr_id": "10", "chr_pos": "17898262", "evidence": [ { "id": "P22897", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P22897" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P22897-1", "start_pos": 1160, "end_pos": 1160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage mannose receptor 1", "gene_name": "MRC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1456, "chemical_mass": 166012.0 } ] }, { "start_pos": "153", "site_seq": "QIATGVSDTICEPCPVGFFSnVSSAFEK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "", "site_lbl": "N153", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "20", "chr_pos": "46123179", "evidence": [ { "id": "rs2085353847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085353847" }, { "id": "rs2085353847", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085353847#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "199", "site_seq": "VMYTTQGGGEAWGISVLNPnK", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "N", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "213", "site_seq": "LnTSAGNVDIYK", "site_lbl": "Asn213", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15393-1", "start_pos": 213, "end_pos": 213, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 53859.0 } ] }, { "start_pos": "213", "site_seq": "N", "site_lbl": "Asn213", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15393-1", "start_pos": 213, "end_pos": 213, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 53859.0 } ] }, { "start_pos": "213", "site_seq": "", "site_lbl": "N213", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "21", "chr_pos": "41479216", "evidence": [ { "id": "rs1326192818", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326192818" }, { "id": "rs1326192818", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1326192818#frequency_tab" }, { "id": "rs1326192818", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1326192818" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15393-1", "start_pos": 213, "end_pos": 213, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 492, "chemical_mass": 53859.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "AVLVNnITTGER", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "AVLVNNITTGER", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "9", "chr_pos": "86052575", "evidence": [ { "id": "rs1833790584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1833790584" }, { "id": "rs1833790584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1833790584#frequency_tab" }, { "id": "rs1833790584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1833790584" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBJ4-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi membrane protein 1", "gene_name": "GOLM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 401, "chemical_mass": 45333.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "NEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "WFYIASAFRNEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "", "site_lbl": "N56", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->HKS).", "chr_id": "9", "chr_pos": "114323714", "evidence": [ { "id": "rs1829721324", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829721324" }, { "id": "rs1829721324", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1829721324#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "9", "chr_pos": "114323716", "evidence": [ { "id": "rs1333212608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333212608" }, { "id": "rs1333212608", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1333212608#frequency_tab" }, { "id": "rs1333212608", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1333212608" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "9", "chr_pos": "114323715", "evidence": [ { "id": "rs775749216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775749216" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "211", "site_seq": "ASPPSSSCnISSGEMQK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "GLQPTLTNPGECRPnFTCACR", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "N", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "nVSCPQLEVPVCPSGFQLSCK", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "N", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2635", "site_seq": "TTCNPCPLGYKEEnNTGECCGR", "site_lbl": "Asn2635", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2635, "end_pos": 2635, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2635", "site_seq": "EEnNTGECCGR", "site_lbl": "Asn2635", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2635, "end_pos": 2635, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2635", "site_seq": "N", "site_lbl": "Asn2635", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2635, "end_pos": 2635, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "WnCTDHVCDATCSTIGMAHYLTFDGLK", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "12", "chr_pos": "6095485", "evidence": [ { "id": "P04275", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04275" }, { "id": "rs753796586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753796586#frequency_tab" }, { "id": "rs753796586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753796586" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "", "site_lbl": "N2357", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "12", "chr_pos": "5983160", "evidence": [ { "id": "rs765168583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765168583#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "", "site_lbl": "N2546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "12", "chr_pos": "5969304", "evidence": [ { "id": "rs61751298", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61751298" }, { "id": "rs61751298", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61751298" } ], "disease": [ { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "", "site_lbl": "N2585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "12", "chr_pos": "5968143", "evidence": [ { "id": "rs2136354943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136354943" }, { "id": "rs2136354943", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136354943" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2635", "site_seq": "", "site_lbl": "N2635", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "12", "chr_pos": "5953577", "evidence": [ { "id": "P04275", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04275" }, { "id": "rs201953086", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201953086" }, { "id": "rs201953086", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201953086" }, { "id": "rs201953086", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201953086#frequency_tab" }, { "id": "rs201953086", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201953086" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2635, "end_pos": 2635, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "", "site_lbl": "N857", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "12", "chr_pos": "6034803", "evidence": [ { "id": "rs765163545", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765163545#frequency_tab" }, { "id": "rs765163545", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765163545" } ], "disease": [ { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "YIQVVYLHNNnISVVGSSDFCPPGHNTK", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "N", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "164", "site_seq": "ILnQTADMLQLASK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "192", "site_seq": "YQHLATLAHnQSEIIAQLEEHCQR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "164", "site_seq": "", "site_lbl": "N164", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "9", "chr_pos": "127108241", "evidence": [ { "id": "rs1589519889", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589519889" }, { "id": "rs1589519889", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589519889" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "192", "site_seq": "", "site_lbl": "N192", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "9", "chr_pos": "127108156", "evidence": [ { "id": "rs2054418339", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2054418339" }, { "id": "rs2054418339", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2054418339" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UKU9-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 2", "gene_name": "ANGPTL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 57104.0 } ] }, { "start_pos": "693", "site_seq": "DYSLTFGAInQTWSYR", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "N", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "DYSLTFGAINQTWSYR", "site_lbl": "Asn693", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQnITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "N", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "703", "site_seq": "IHQNITYQVCR", "site_lbl": "Asn703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 703, "end_pos": 703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "693", "site_seq": "", "site_lbl": "N693", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "14", "chr_pos": "52038927", "evidence": [ { "id": "rs768965058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768965058" }, { "id": "rs768965058", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768965058" }, { "id": "rs768965058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768965058" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "14", "chr_pos": "52038925", "evidence": [ { "id": "rs1274839377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1274839377" }, { "id": "rs1274839377", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1274839377#frequency_tab" }, { "id": "rs1274839377", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1274839377" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14112-1", "start_pos": 693, "end_pos": 693, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Nidogen-2", "gene_name": "NID2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1375, "chemical_mass": 151254.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "1249", "site_seq": "nTSAASTAQLVEATEELRR", "site_lbl": "Asn1249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1249, "end_pos": 1249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1249", "site_seq": "nTSAASTAQLVEATEELR", "site_lbl": "Asn1249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1249, "end_pos": 1249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1249", "site_seq": "NTSAASTAQLVEATEELRR", "site_lbl": "Asn1249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1249, "end_pos": 1249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1249", "site_seq": "N", "site_lbl": "Asn1249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1249, "end_pos": 1249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "RAnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "AnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "ANTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "N", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1249", "site_seq": "", "site_lbl": "N1249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "NC_000003.12", "chr_pos": "49123780", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1249, "end_pos": 1249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "", "site_lbl": "N1348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->ITS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ], "disease": [ { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "252", "site_seq": "QVIQnVTHK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "252", "site_seq": "QVIQNVTHK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "37", "site_seq": "VHInTTSDSILLK", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "37", "site_seq": "VHINTTSDSILLK", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "37", "site_seq": "N", "site_lbl": "Asn37", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "37", "site_seq": "", "site_lbl": "N37", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "3", "chr_pos": "100926451", "evidence": [ { "id": "rs1234097840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234097840" }, { "id": "rs1234097840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1234097840#frequency_tab" }, { "id": "rs1234097840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234097840" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7G0-1", "start_pos": 37, "end_pos": 37, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Target of Nesh-SH3", "gene_name": "ABI3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1068, "chemical_mass": 117895.0 } ] }, { "start_pos": "1029", "site_seq": "N", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "AGEQVTYTCATYYKMDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASNVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGKWSSPPQCEGLPCK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEENETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "", "site_lbl": "N911", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "196737610", "evidence": [ { "id": "rs1240893783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1240893783" }, { "id": "rs1240893783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1240893783" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "107", "site_seq": "CLSPDVTPCFCTInFTLEK", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "107", "site_seq": "", "site_lbl": "N107", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "6", "chr_pos": "75267667", "evidence": [ { "id": "rs1426369513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426369513" }, { "id": "rs1426369513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426369513#frequency_tab" }, { "id": "rs1426369513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426369513" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "6", "chr_pos": "75267667", "evidence": [ { "id": "rs1426369513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426369513" }, { "id": "rs1426369513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426369513#frequency_tab" }, { "id": "rs1426369513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426369513" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NV96-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 361, "chemical_mass": 40684.0 } ] }, { "start_pos": "138", "site_seq": "TLLnASCDNMLMGIK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UWY5-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 1", "gene_name": "OLFML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 45951.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UWY5-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 1", "gene_name": "OLFML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 45951.0 } ] }, { "start_pos": "138", "site_seq": "TLLNASCDNMLMGIK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UWY5-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 1", "gene_name": "OLFML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 45951.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "NC_000011.10", "chr_pos": "7488409", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "7488411", "evidence": [ { "id": "Q6UWY5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6UWY5" }, { "id": "rs1848554218", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1848554218" }, { "id": "rs1848554218", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1848554218#frequency_tab" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UWY5-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 1", "gene_name": "OLFML1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 45951.0 } ] }, { "start_pos": "137", "site_seq": "SVNPnDTCLASCVK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95857-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-13", "gene_name": "TSPAN13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 204, "chemical_mass": 22147.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95857-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-13", "gene_name": "TSPAN13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 204, "chemical_mass": 22147.0 } ] }, { "start_pos": "137", "site_seq": "SVNPNDTCLASCVK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95857-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-13", "gene_name": "TSPAN13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 204, "chemical_mass": 22147.0 } ] }, { "start_pos": "137", "site_seq": "", "site_lbl": "N137", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "7", "chr_pos": "16777894", "evidence": [ { "id": "rs556754928", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556754928" }, { "id": "rs556754928", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556754928" }, { "id": "rs556754928", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556754928" }, { "id": "rs556754928", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556754928" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95857-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-13", "gene_name": "TSPAN13", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 204, "chemical_mass": 22147.0 } ] }, { "start_pos": "424", "site_seq": "GETLEIGnYSFYALDNQNLR", "site_lbl": "Asn424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 424, "end_pos": 424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "424", "site_seq": "N", "site_lbl": "Asn424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 424, "end_pos": 424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "HnLTITQGK", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "N", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "445", "site_seq": "HNLTITQGK", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "651", "site_seq": "WKPPSDPNGnITHYLVFWER", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "651", "site_seq": "WKPPSDPNGNITHYLVFWER", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "651", "site_seq": "N", "site_lbl": "Asn651", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06213-1", "start_pos": 651, "end_pos": 651, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Insulin receptor", "gene_name": "INSR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1382, "chemical_mass": 156333.0 } ] }, { "start_pos": "69", "site_seq": "NACCSTnTSQEAHK", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15328-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 257, "chemical_mass": 29819.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15328-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 257, "chemical_mass": 29819.0 } ] }, { "start_pos": "69", "site_seq": "NACCSTNTSQEAHKDVSYLYR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15328-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 257, "chemical_mass": 29819.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "11", "chr_pos": "72195307", "evidence": [ { "id": "rs780742785", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780742785" }, { "id": "rs780742785", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780742785" }, { "id": "rs780742785", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780742785#frequency_tab" }, { "id": "rs780742785", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780742785" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15328-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 257, "chemical_mass": 29819.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "1057", "site_seq": "TASCSnVTCWLK", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1057", "site_seq": "N", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "1057", "site_seq": "TASCSNVTCWLK", "site_lbl": "Asn1057", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 1057, "end_pos": 1057, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "105", "site_seq": "LNLQTSTSIPnVTEMK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "105", "site_seq": "LNLQTSTSIPNVTEMK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "5", "chr_pos": "53045019", "evidence": [ { "id": "rs771091240", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771091240" }, { "id": "rs771091240", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771091240" }, { "id": "rs771091240", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771091240#frequency_tab" }, { "id": "rs771091240", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771091240" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->TVT).", "chr_id": "5", "chr_pos": "53045019", "evidence": [ { "id": "rs771091240", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771091240" }, { "id": "rs771091240", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771091240" }, { "id": "rs771091240", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771091240#frequency_tab" }, { "id": "rs771091240", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771091240" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17301-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-2", "gene_name": "ITGA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1181, "chemical_mass": 129296.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "", "site_lbl": "N596", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "119049575", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "11", "chr_pos": "119049576", "evidence": [ { "id": "rs2133574126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133574126" }, { "id": "rs2133574126", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133574126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "488", "site_seq": "ARPVITVNAGLEVYPSILNQDnK", "site_lbl": "Asn488", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 488, "end_pos": 488, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "488", "site_seq": "N", "site_lbl": "Asn488", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 488, "end_pos": 488, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "488", "site_seq": "ARPVITVNAGLEVYPSILNQDNK", "site_lbl": "Asn488", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 488, "end_pos": 488, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "488", "site_seq": "", "site_lbl": "N488", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "2", "chr_pos": "186652047", "evidence": [ { "id": "rs200705825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200705825" }, { "id": "rs200705825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200705825" }, { "id": "rs200705825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200705825#frequency_tab" }, { "id": "rs200705825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200705825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->TKT).", "chr_id": "2", "chr_pos": "186652047", "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P06756" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "2", "chr_pos": "186652046", "evidence": [ { "id": "rs142779223", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142779223" }, { "id": "rs142779223", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142779223" }, { "id": "rs142779223", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142779223#frequency_tab" }, { "id": "rs142779223", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142779223" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 488, "end_pos": 488, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "186602056", "evidence": [ { "id": "rs1686923072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686923072" }, { "id": "rs1686923072", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1686923072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "GELnTSIFSSRPIDK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "353", "site_seq": "", "site_lbl": "N353", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "2", "chr_pos": "70276932", "evidence": [ { "id": "rs1696679990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1696679990" }, { "id": "rs1696679990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1696679990#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "279", "site_seq": "EGEHDLVQGSGQQPQAGLSQAnFTLGPVSR", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75023-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte immunoglobulin-like receptor subfamily B member 5", "gene_name": "LILRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 590, "chemical_mass": 64067.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75023-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte immunoglobulin-like receptor subfamily B member 5", "gene_name": "LILRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 590, "chemical_mass": 64067.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "19", "chr_pos": "54255402", "evidence": [ { "id": "O75023", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75023" }, { "id": "rs1026649197", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1026649197" }, { "id": "rs1026649197", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1026649197#frequency_tab" }, { "id": "rs1026649197", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1026649197" }, { "id": "rs1026649197", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1026649197" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75023-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leukocyte immunoglobulin-like receptor subfamily B member 5", "gene_name": "LILRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 590, "chemical_mass": 64067.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "535", "site_seq": "NCQDIDECVTGIHnCSINETCFNIQGGFR", "site_lbl": "Asn535", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 535, "end_pos": 535, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "535", "site_seq": "N", "site_lbl": "Asn535", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 535, "end_pos": 535, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "535", "site_seq": "NCQDIDECVTGIHNCSINETCFNIQGGFR", "site_lbl": "Asn535", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 535, "end_pos": 535, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "98", "site_seq": "CATPHGDnASLEATFVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "98", "site_seq": "CATPHGDNASLEATFVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "535", "site_seq": "", "site_lbl": "N535", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "22", "chr_pos": "45550522", "evidence": [ { "id": "P23142", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P23142" }, { "id": "rs2088687837", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2088687837" }, { "id": "rs2088687837", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2088687837#frequency_tab" }, { "id": "rs2088687837", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2088687837" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 535, "end_pos": 535, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->IAS).", "chr_id": "22", "chr_pos": "45525650", "evidence": [ { "id": "rs2088316861", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2088316861" }, { "id": "rs2088316861", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2088316861#frequency_tab" }, { "id": "rs2088316861", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2088316861" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->YAS).", "chr_id": "22", "chr_pos": "45525649", "evidence": [ { "id": "rs2088316810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2088316810" }, { "id": "rs2088316810", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2088316810#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P23142-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-1", "gene_name": "FBLN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 703, "chemical_mass": 77214.0 } ] }, { "start_pos": "325", "site_seq": "VAYSnDSANWTEYQDPR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08431-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 387, "chemical_mass": 43105.0 } ] }, { "start_pos": "288", "site_seq": "nVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "NVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "644", "site_seq": "HYHSMEVFTHYDLLNLnGTK", "site_lbl": "Asn644", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "644", "site_seq": "HYHSMEVFTHYDLLNLNGTK", "site_lbl": "Asn644", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "644", "site_seq": "N", "site_lbl": "Asn644", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "644", "site_seq": "", "site_lbl": "N644", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT); n-glyco-sequon-gain (NLN->NLS).", "chr_id": "8", "chr_pos": "23303347", "evidence": [ { "id": "rs774165042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774165042" }, { "id": "rs774165042", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774165042" }, { "id": "rs774165042", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774165042#frequency_tab" }, { "id": "rs774165042", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774165042" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "8", "chr_pos": "23303346", "evidence": [ { "id": "rs1803171628", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803171628" }, { "id": "rs1803171628", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1803171628#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "", "site_lbl": "N288", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "23333504", "evidence": [ { "id": "rs747808882", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747808882" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "644", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Inhibits secretion.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y4K0", "url": "https://www.uniprot.org/uniprotkb/Q9Y4K0" }, { "database": "PubMed", "id": "23319596", "url": "https://glygen.org/publication/PubMed/23319596" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 644, "end_pos": 644, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "324", "site_seq": "VAnLTEPVVLTFQHQLQPK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y653-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "ADGRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 693, "chemical_mass": 77738.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y653-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "ADGRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 693, "chemical_mass": 77738.0 } ] }, { "start_pos": "324", "site_seq": "VANLTEPVVLTFQHQLQPK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y653-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "ADGRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 693, "chemical_mass": 77738.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "16", "chr_pos": "57655947", "evidence": [ { "id": "rs954118432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs954118432" }, { "id": "rs954118432", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs954118432#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "57655946", "evidence": [ { "id": "rs763833865", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763833865" }, { "id": "rs763833865", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763833865" }, { "id": "rs763833865", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763833865" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y653-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "ADGRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 693, "chemical_mass": 77738.0 } ] }, { "start_pos": "66", "site_seq": "nCTAIWEAFK", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q10588-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2", "gene_name": "BST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35724.0 } ] }, { "start_pos": "66", "site_seq": "N", "site_lbl": "Asn66", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q10588-1", "start_pos": 66, "end_pos": 66, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2", "gene_name": "BST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35724.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "LHEITnETFR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "LHEITNETFR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "117", "site_seq": "", "site_lbl": "N117", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "16", "chr_pos": "4381227", "evidence": [ { "id": "Q6EMK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6EMK4" }, { "id": "rs1288526677", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1288526677" }, { "id": "rs1288526677", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1288526677#frequency_tab" }, { "id": "rs1288526677", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1288526677" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6EMK4-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vasorin", "gene_name": "VASN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 673, "chemical_mass": 71713.0 } ] }, { "start_pos": "538", "site_seq": "LEnITNPWSPR", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "538", "site_seq": "N", "site_lbl": "Asn538", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "538", "site_seq": "", "site_lbl": "N538", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "7", "chr_pos": "150858805", "evidence": [ { "id": "rs1799872201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799872201" }, { "id": "rs1799872201", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1799872201#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19801-1", "start_pos": 538, "end_pos": 538, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Diamine oxidase [copper-containing]", "gene_name": "AOC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 751, "chemical_mass": 85378.0 } ] }, { "start_pos": "115", "site_seq": "ELLLHLIDYLVTSDGKDPEITNLInSTR", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14384-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase M", "gene_name": "CPM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 50514.0 } ] }, { "start_pos": "115", "site_seq": "DPEITNLINSTR", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14384-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase M", "gene_name": "CPM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 50514.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14384-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase M", "gene_name": "CPM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 50514.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "12", "chr_pos": "68871871", "evidence": [ { "id": "rs371647855", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371647855" }, { "id": "rs371647855", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371647855" }, { "id": "rs371647855", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371647855#frequency_tab" }, { "id": "rs371647855", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371647855" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14384-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase M", "gene_name": "CPM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 50514.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "1830", "site_seq": "N", "site_lbl": "Asn1830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 1830, "end_pos": 1830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "1830", "site_seq": "NPNNDQVFPnGTLAPSIPIWGGSWR", "site_lbl": "Asn1830", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 1830, "end_pos": 1830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "75", "site_seq": "LLISSLSESPASVSILSQADnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "1830", "site_seq": "", "site_lbl": "N1830", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "19", "chr_pos": "39894273", "evidence": [ { "id": "Q9Y6R7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y6R7" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "19", "chr_pos": "39894272", "evidence": [ { "id": "rs1859787743", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1859787743" }, { "id": "rs1859787743", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1859787743#frequency_tab" }, { "id": "rs1859787743", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1859787743" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 1830, "end_pos": 1830, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "75", "site_seq": "", "site_lbl": "N75", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "39928139", "evidence": [ { "id": "rs760800031", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760800031" }, { "id": "rs760800031", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760800031" }, { "id": "rs760800031", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760800031#frequency_tab" }, { "id": "rs760800031", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760800031" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6R7-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgGFc-binding protein", "gene_name": "FCGBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5405, "chemical_mass": 572017.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "50361733", "evidence": [ { "id": "rs1214907251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214907251" }, { "id": "rs1214907251", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214907251#frequency_tab" }, { "id": "rs1214907251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214907251" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "1093", "site_seq": "NLGFnCTTSQGK", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49641-3", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-mannosidase 2x", "gene_name": "MAN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1150, "chemical_mass": 130539.0 } ] }, { "start_pos": "1093", "site_seq": "NLGFNCTTSQGK", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49641-3", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-mannosidase 2x", "gene_name": "MAN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1150, "chemical_mass": 130539.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49641-3", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-mannosidase 2x", "gene_name": "MAN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1150, "chemical_mass": 130539.0 } ] }, { "start_pos": "1093", "site_seq": "", "site_lbl": "N1093", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "15", "chr_pos": "90918732", "evidence": [ { "id": "rs2035378430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2035378430" }, { "id": "rs2035378430", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2035378430" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "15", "chr_pos": "90918733", "evidence": [ { "id": "P49641", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P49641" }, { "id": "rs1453545491", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1453545491" }, { "id": "rs1453545491", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1453545491#frequency_tab" }, { "id": "rs1453545491", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1453545491" }, { "id": "rs1453545491", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1453545491" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49641-3", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-mannosidase 2x", "gene_name": "MAN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1150, "chemical_mass": 130539.0 } ] }, { "start_pos": "1183", "site_seq": "LTLnGSK", "site_lbl": "Asn1183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1183, "end_pos": 1183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1183", "site_seq": "LTLNGSK", "site_lbl": "Asn1183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1183, "end_pos": 1183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1183", "site_seq": "N", "site_lbl": "Asn1183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1183, "end_pos": 1183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1253", "site_seq": "N", "site_lbl": "Asn1253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1253, "end_pos": 1253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1253", "site_seq": "YTLDPnITSAGPTK", "site_lbl": "Asn1253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1253, "end_pos": 1253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1253", "site_seq": "YTLDPNITSAGPTK", "site_lbl": "Asn1253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1253, "end_pos": 1253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "1253", "site_seq": "", "site_lbl": "N1253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "3", "chr_pos": "48415619", "evidence": [ { "id": "rs1256351609", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256351609" }, { "id": "rs1256351609", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1256351609#frequency_tab" }, { "id": "rs1256351609", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256351609" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "NC_000003.12", "chr_pos": "48415618", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "48415619", "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O43157" }, { "id": "rs1256351609", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256351609" }, { "id": "rs1256351609", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1256351609#frequency_tab" }, { "id": "rs1256351609", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256351609" }, { "id": "rs1256351609", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1256351609" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43157-1", "start_pos": 1253, "end_pos": 1253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B1", "gene_name": "PLXNB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2135, "chemical_mass": 232298.0 } ] }, { "start_pos": "150", "site_seq": "RGPECSQnYTTPSGVIK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "150", "site_seq": "GPECSQNYTTPSGVIK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "261", "site_seq": "EGFSAnYSVLQSSVSEDFK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "261", "site_seq": "EGFSANYSVLQSSVSEDFK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "522", "site_seq": "IGYSNnGSDWK", "site_lbl": "Asn522", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 522, "end_pos": 522, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "522", "site_seq": "IGYSNNGSDWK", "site_lbl": "Asn522", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 522, "end_pos": 522, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "522", "site_seq": "N", "site_lbl": "Asn522", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 522, "end_pos": 522, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "NC_000010.11", "chr_pos": "33263856", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "522", "site_seq": "", "site_lbl": "N522", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "33213435", "evidence": [ { "id": "rs1588737721", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588737721" }, { "id": "rs1588737721", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588737721" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14786-1", "start_pos": 522, "end_pos": 522, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 923, "chemical_mass": 103134.0 } ] }, { "start_pos": "214", "site_seq": "LNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "KLNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "198", "site_seq": "FITSILYENNVITIDLVQnSSQK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "AEMnGSK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "AEMnGSKLGR", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "P16422", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16422" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "rs1671503097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1671503097" }, { "id": "rs1671503097", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1671503097" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "2", "chr_pos": "47373845", "evidence": [ { "id": "rs2103747074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103747074" }, { "id": "rs2103747074", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103747074" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "2", "chr_pos": "47373844", "evidence": [ { "id": "rs780532486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780532486" }, { "id": "rs780532486", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780532486" }, { "id": "rs780532486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780532486" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "2", "chr_pos": "47373843", "evidence": [ { "id": "rs2103747069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103747069" }, { "id": "rs2103747069", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103747069" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Decreased glycosylation, reduced protein stability and significant decrease in protein expression. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-74 and A-111.", "evidence": [ { "database": "UniProtKB", "id": "P16422", "url": "https://www.uniprot.org/uniprotkb/P16422" }, { "database": "PubMed", "id": "18508581", "url": "https://glygen.org/publication/PubMed/18508581" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Changed glycosylation pattern. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-111 and A-198.", "evidence": [ { "database": "UniProtKB", "id": "P16422", "url": "https://www.uniprot.org/uniprotkb/P16422" }, { "database": "PubMed", "id": "18508581", "url": "https://glygen.org/publication/PubMed/18508581" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVnVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVNVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "", "site_lbl": "N395", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "1", "chr_pos": "35466626", "evidence": [ { "id": "Q8IZA0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IZA0" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "421", "site_seq": "N", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "DECWCPAnSTGK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "616", "site_seq": "RLnLTHCQDINECLTLGLCK", "site_lbl": "Asn616", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "616", "site_seq": "N", "site_lbl": "Asn616", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 616, "end_pos": 616, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "", "site_lbl": "N421", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "74552325", "evidence": [ { "id": "rs2087671361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087671361" }, { "id": "rs2087671361", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2087671361#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "74552323", "evidence": [ { "id": "Q14767", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14767" }, { "id": "rs746580964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746580964" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "74552324", "evidence": [ { "id": "rs1194656181", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1194656181" }, { "id": "rs1194656181", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1194656181" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "42", "site_seq": "NAnSSPVASTTPSASATTNPASATTLDQSK", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "42", "site_seq": "", "site_lbl": "N42", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS); n-glyco-sequon-gain (NAN->NAS).", "chr_id": "15", "chr_pos": "89806459", "evidence": [ { "id": "rs755278198", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755278198" }, { "id": "rs755278198", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755278198" }, { "id": "rs755278198", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755278198" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVnQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVNQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "", "site_lbl": "N101", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "23", "chr_pos": "47585305", "evidence": [ { "id": "P01033", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01033" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "386", "site_seq": "nCTTLQGLAPGTAYLVTVTAAFR", "site_lbl": "Asn386", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCB0-1", "start_pos": 386, "end_pos": 386, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor A domain-containing protein 1", "gene_name": "VWA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 445, "chemical_mass": 46804.0 } ] }, { "start_pos": "386", "site_seq": "", "site_lbl": "N386", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "1", "chr_pos": "1439606", "evidence": [ { "id": "rs1638617104", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1638617104" }, { "id": "rs1638617104", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1638617104#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCB0-1", "start_pos": 386, "end_pos": 386, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor A domain-containing protein 1", "gene_name": "VWA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 445, "chemical_mass": 46804.0 } ] }, { "start_pos": "257", "site_seq": "RQNITNQLEK", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CQ7-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glycosyltransferase 8 domain-containing protein 1", "gene_name": "GLT8D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 371, "chemical_mass": 41935.0 } ] }, { "start_pos": "257", "site_seq": "RQnITNQLEK", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CQ7-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glycosyltransferase 8 domain-containing protein 1", "gene_name": "GLT8D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 371, "chemical_mass": 41935.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68CQ7-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glycosyltransferase 8 domain-containing protein 1", "gene_name": "GLT8D1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 371, "chemical_mass": 41935.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILnETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "N", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "KLDFIILNETK", "site_lbl": "Asn520", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "685", "site_seq": "YMGLPTPEDNLDHYRnSTVMSR", "site_lbl": "Asn685", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "685", "site_seq": "N", "site_lbl": "Asn685", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "685", "site_seq": "nSTVMSR", "site_lbl": "Asn685", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "N520", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "162016776", "evidence": [ { "id": "rs199543870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199543870" }, { "id": "rs199543870", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199543870" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "162016777", "evidence": [ { "id": "P27487", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27487" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "685", "site_seq": "", "site_lbl": "N685", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->IST).", "chr_id": "2", "chr_pos": "161995371", "evidence": [ { "id": "rs150213586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150213586" }, { "id": "rs150213586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150213586#frequency_tab" }, { "id": "rs150213586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150213586" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "520", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not inhibit dipeptidyl peptidase activity, interaction with ADA and homodimer formation.", "evidence": [ { "database": "UniProtKB", "id": "P27487", "url": "https://www.uniprot.org/uniprotkb/P27487" }, { "database": "PubMed", "id": "14691230", "url": "https://glygen.org/publication/PubMed/14691230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 520, "end_pos": 520, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "685", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not inhibit dipeptidyl peptidase activity, interaction with ADA and homodimer formation.", "evidence": [ { "database": "UniProtKB", "id": "P27487", "url": "https://www.uniprot.org/uniprotkb/P27487" }, { "database": "PubMed", "id": "14691230", "url": "https://glygen.org/publication/PubMed/14691230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27487-1", "start_pos": 685, "end_pos": 685, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 4", "gene_name": "DPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 766, "chemical_mass": 88279.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "", "site_lbl": "N1581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "15", "chr_pos": "48467943", "evidence": [ { "id": "rs2505501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505501431" } ], "disease": [ { "disease_id": "DOID:14323", "name": "Marfan syndrome", "description": "A connective tissue disease that is characterized by tall stature, elongated extremities, mitral valve prolapse, aortic dilatation, aortic dissection, and subluxation of the lens.", "url": "http://disease-ontology.org/term/DOID:14323", "evidence": [ { "id": "14323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "182", "site_seq": "EPLSDPVGTCYLSTDnFTR", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "182", "site_seq": "TEKEPLSDPVGTCYLSTDNFTR", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "182", "site_seq": "N", "site_lbl": "Asn182", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 182, "end_pos": 182, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "868", "site_seq": "VTGLnCTTNHPINPK", "site_lbl": "Asn868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 868, "end_pos": 868, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "868", "site_seq": "N", "site_lbl": "Asn868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 868, "end_pos": 868, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "868", "site_seq": "VTGLNCTTNHPINPK", "site_lbl": "Asn868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 868, "end_pos": 868, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "868", "site_seq": "", "site_lbl": "N868", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "12", "chr_pos": "54400886", "evidence": [ { "id": "P08648", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08648" }, { "id": "rs756867133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756867133" }, { "id": "rs756867133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756867133" }, { "id": "rs756867133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756867133#frequency_tab" }, { "id": "rs756867133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756867133" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "12", "chr_pos": "54400886", "evidence": [ { "id": "rs756867133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756867133" }, { "id": "rs756867133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756867133" }, { "id": "rs756867133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756867133#frequency_tab" }, { "id": "rs756867133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756867133" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08648-1", "start_pos": 868, "end_pos": 868, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 114536.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "48", "site_seq": "CHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "HECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "FLEYSTSECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "ECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "RECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "", "site_lbl": "N48", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "6", "chr_pos": "32584336", "evidence": [ { "id": "rs1776055186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1776055186" }, { "id": "rs1776055186", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1776055186" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "86", "site_seq": "ELAVPDGYTnR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "86", "site_seq": "ELAVPDGYTNR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "TSIPTINMEnK", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "TSIPTINMENK", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "N", "site_lbl": "Asn969", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "969", "site_seq": "", "site_lbl": "N969", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "17", "chr_pos": "50081395", "evidence": [ { "id": "rs1447627958", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447627958" }, { "id": "rs1447627958", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1447627958#frequency_tab" }, { "id": "rs1447627958", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1447627958" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P26006-2", "start_pos": 969, "end_pos": 969, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-3", "gene_name": "ITGA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1051, "chemical_mass": 116612.0 } ] }, { "start_pos": "1093", "site_seq": "LnWTAADQAYEHFIIQVQEANK", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1366", "site_seq": "LnWTAADNAYEHFVIQVQEVNK", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQnLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "N", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1392", "site_seq": "VEAAQNLTLPGSLR", "site_lbl": "Asn1392", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1392, "end_pos": 1392, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "GnFSTEGCGCVCEPGWK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1093", "site_seq": "", "site_lbl": "N1093", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "9", "chr_pos": "115064856", "evidence": [ { "id": "rs1832827042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1832827042" }, { "id": "rs1832827042", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1832827042#frequency_tab" }, { "id": "rs1832827042", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1832827042" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1366", "site_seq": "", "site_lbl": "N1366", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "9", "chr_pos": "115059939", "evidence": [ { "id": "rs1372895331", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1372895331" }, { "id": "rs1372895331", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1372895331#frequency_tab" }, { "id": "rs1372895331", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1372895331" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "9", "chr_pos": "115087233", "evidence": [ { "id": "rs1484018579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1484018579" }, { "id": "rs1484018579", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1484018579" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "9", "chr_pos": "115087180", "evidence": [ { "id": "rs778574555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778574555#frequency_tab" }, { "id": "rs778574555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778574555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1979", "site_seq": "GFDPDCnK", "site_lbl": "Asn1979", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYQ6-1", "start_pos": 1979, "end_pos": 1979, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 1", "gene_name": "CELSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3014, "chemical_mass": 329486.0 } ] }, { "start_pos": "1979", "site_seq": "N", "site_lbl": "Asn1979", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYQ6-1", "start_pos": 1979, "end_pos": 1979, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 1", "gene_name": "CELSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3014, "chemical_mass": 329486.0 } ] }, { "start_pos": "1979", "site_seq": "", "site_lbl": "N1979", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->DKT).", "chr_id": "22", "chr_pos": "46394171", "evidence": [ { "id": "rs757459340", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757459340" }, { "id": "rs757459340", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757459340" }, { "id": "rs757459340", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757459340" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "22", "chr_pos": "46394169", "evidence": [ { "id": "rs2079124063", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2079124063" }, { "id": "rs2079124063", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2079124063" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "22", "chr_pos": "46394170", "evidence": [ { "id": "rs754363166", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754363166" }, { "id": "rs754363166", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754363166" }, { "id": "rs754363166", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754363166#frequency_tab" }, { "id": "rs754363166", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754363166" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYQ6-1", "start_pos": 1979, "end_pos": 1979, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 1", "gene_name": "CELSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3014, "chemical_mass": 329486.0 } ] }, { "start_pos": "492", "site_seq": "WnDSPCNQSLPSICK", "site_lbl": "Asn492", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 492, "end_pos": 492, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "492", "site_seq": "N", "site_lbl": "Asn492", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 492, "end_pos": 492, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "492", "site_seq": "WNDSPCNQSLPSICK", "site_lbl": "Asn492", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 492, "end_pos": 492, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "VTPACnTSLPAQR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "VTPACNTSLPAQR", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "17", "chr_pos": "62664635", "evidence": [ { "id": "rs1276394239", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1276394239" }, { "id": "rs1276394239", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1276394239#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "AVnITSENLIDDVVSLIR", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHnCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "N", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHNCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "", "site_lbl": "N1035", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "3", "chr_pos": "13636475", "evidence": [ { "id": "rs1706475038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1706475038" }, { "id": "rs1706475038", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1706475038" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->YCS).", "chr_id": "3", "chr_pos": "13636474", "evidence": [ { "id": "rs1264877212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1264877212" }, { "id": "rs1264877212", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1264877212#frequency_tab" }, { "id": "rs1264877212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1264877212" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "208", "site_seq": "FVAAVHYEQPTIQIELRQnTSQK", "site_lbl": "Asn208", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09758-1", "start_pos": 208, "end_pos": 208, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor-associated calcium signal transducer 2", "gene_name": "TACSTD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35709.0 } ] }, { "start_pos": "208", "site_seq": "N", "site_lbl": "Asn208", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09758-1", "start_pos": 208, "end_pos": 208, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor-associated calcium signal transducer 2", "gene_name": "TACSTD2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35709.0 } ] }, { "start_pos": "330", "site_seq": "FFAEnETWVVDSCTTCTCK", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "330", "site_seq": "N", "site_lbl": "Asn330", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 330, "end_pos": 330, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "19", "chr_pos": "49514259", "evidence": [ { "id": "rs758794510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758794510#frequency_tab" }, { "id": "rs758794510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758794510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "439", "site_seq": "TQnFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "TQNFTLLVQGSPELK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "439", "site_seq": "", "site_lbl": "N439", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "NC_000019.10", "chr_pos": "44818862", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50895-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basal cell adhesion molecule", "gene_name": "BCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 67405.0 } ] }, { "start_pos": "785", "site_seq": "nMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "N", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "NMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "", "site_lbl": "N785", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->HMT).", "chr_id": "21", "chr_pos": "46126168", "evidence": [ { "id": "rs777443196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777443196" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" }, { "id": "rs746466184", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs746466184" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->TMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "321", "site_seq": "nCTSYGVLDISK", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "321", "site_seq": "N", "site_lbl": "Asn321", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "321", "site_seq": "", "site_lbl": "N321", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "7", "chr_pos": "80671119", "evidence": [ { "id": "rs149492740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149492740#frequency_tab" }, { "id": "rs149492740", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149492740" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "7", "chr_pos": "80671121", "evidence": [ { "id": "P16671", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16671" }, { "id": "rs374208165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374208165" }, { "id": "rs374208165", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374208165" }, { "id": "rs374208165", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs374208165" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "7", "chr_pos": "80671119", "evidence": [ { "id": "rs149492740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149492740" }, { "id": "rs149492740", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149492740#frequency_tab" }, { "id": "rs149492740", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149492740" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16671-1", "start_pos": 321, "end_pos": 321, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 53053.0 } ] }, { "start_pos": "448", "site_seq": "NIETFTCDTQnITYR", "site_lbl": "Asn448", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08575-3", "start_pos": 448, "end_pos": 448, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase C", "gene_name": "PTPRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 147486.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGnASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "104", "site_seq": "TALFPDLLAQGNASLR", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5ZPR3-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD276 antigen", "gene_name": "CD276", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 57235.0 } ] }, { "start_pos": "411", "site_seq": "LnDTTLQVLNTWYTK", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "411", "site_seq": "N", "site_lbl": "Asn411", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "411", "site_seq": "", "site_lbl": "N411", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "13", "chr_pos": "53050470", "evidence": [ { "id": "Q6UX06", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q6UX06" }, { "id": "rs928073819", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928073819" }, { "id": "rs928073819", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs928073819#frequency_tab" }, { "id": "rs928073819", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs928073819" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX06-1", "start_pos": 411, "end_pos": 411, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-4", "gene_name": "OLFM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 510, "chemical_mass": 57280.0 } ] }, { "start_pos": "405", "site_seq": "RQDVnITVATVPSWLK", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "405", "site_seq": "N", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "405", "site_seq": "QDVnITVATVPSWLK", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "405", "site_seq": "RQDVNITVATVPSWLK", "site_lbl": "Asn405", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "405", "site_seq": "", "site_lbl": "N405", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "6", "chr_pos": "43132673", "evidence": [ { "id": "rs138575208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138575208" }, { "id": "rs138575208", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138575208" }, { "id": "rs138575208", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138575208" }, { "id": "rs138575208", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138575208#frequency_tab" }, { "id": "rs138575208", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138575208" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13308-1", "start_pos": 405, "end_pos": 405, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inactive tyrosine-protein kinase 7", "gene_name": "PTK7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1070, "chemical_mass": 118392.0 } ] }, { "start_pos": "333", "site_seq": "TVYVHAnQTGYPDPSSR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16112-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aggrecan core protein", "gene_name": "ACAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2530, "chemical_mass": 261329.0 } ] }, { "start_pos": "333", "site_seq": "TVYVHANQTGYPDPSSR", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16112-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aggrecan core protein", "gene_name": "ACAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2530, "chemical_mass": 261329.0 } ] }, { "start_pos": "333", "site_seq": "N", "site_lbl": "Asn333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16112-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aggrecan core protein", "gene_name": "ACAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2530, "chemical_mass": 261329.0 } ] }, { "start_pos": "333", "site_seq": "", "site_lbl": "N333", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "15", "chr_pos": "88843595", "evidence": [ { "id": "rs776721559", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776721559" }, { "id": "rs776721559", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776721559" }, { "id": "rs776721559", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776721559#frequency_tab" }, { "id": "rs776721559", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776721559" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16112-1", "start_pos": 333, "end_pos": 333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aggrecan core protein", "gene_name": "ACAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2530, "chemical_mass": 261329.0 } ] }, { "start_pos": "111", "site_seq": "nESENTCQDVDECQQNPR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHX3-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E2", "gene_name": "ADGRE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 823, "chemical_mass": 90472.0 } ] }, { "start_pos": "111", "site_seq": "TFKnESENTCQDVDECQQNPR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHX3-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E2", "gene_name": "ADGRE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 823, "chemical_mass": 90472.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHX3-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E2", "gene_name": "ADGRE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 823, "chemical_mass": 90472.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "19", "chr_pos": "14772365", "evidence": [ { "id": "Q9UHX3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UHX3" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHX3-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor E2", "gene_name": "ADGRE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 823, "chemical_mass": 90472.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "666", "site_seq": "LNLVPGEnITCQDPVIGVGEPGK", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "6", "chr_pos": "46863090", "evidence": [ { "id": "rs751766229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751766229" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "157", "site_seq": "VVnMSSSGGR", "site_lbl": "Asn157", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NEX9-1", "start_pos": 157, "end_pos": 157, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Short-chain dehydrogenase/reductase family 9C member 7", "gene_name": "SDR9C7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 313, "chemical_mass": 35263.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "508", "site_seq": "TLFPNYFnGSEIIIAGK", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "508", "site_seq": "N", "site_lbl": "Asn508", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "508", "site_seq": "", "site_lbl": "N508", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "10", "chr_pos": "7576907", "evidence": [ { "id": "Q86UX2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86UX2" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "7576908", "evidence": [ { "id": "rs765900247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765900247" }, { "id": "rs765900247", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765900247" }, { "id": "rs765900247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765900247" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86UX2-1", "start_pos": 508, "end_pos": 508, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H5", "gene_name": "ITIH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 942, "chemical_mass": 104576.0 } ] }, { "start_pos": "239", "site_seq": "ASCnCSNSIY", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54108-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cysteine-rich secretory protein 3", "gene_name": "CRISP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 27630.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54108-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cysteine-rich secretory protein 3", "gene_name": "CRISP3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 27630.0 } ] }, { "start_pos": "316", "site_seq": "ITnISAVEMTPLPTCLQFNR", "site_lbl": "Asn316", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX71-1", "start_pos": 316, "end_pos": 316, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin domain-containing protein 2", "gene_name": "PLXDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 59583.0 } ] }, { "start_pos": "316", "site_seq": "N", "site_lbl": "Asn316", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX71-1", "start_pos": 316, "end_pos": 316, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin domain-containing protein 2", "gene_name": "PLXDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 59583.0 } ] }, { "start_pos": "316", "site_seq": "ITNISAVEMTPLPTCLQFNR", "site_lbl": "Asn316", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX71-1", "start_pos": 316, "end_pos": 316, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin domain-containing protein 2", "gene_name": "PLXDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 59583.0 } ] }, { "start_pos": "316", "site_seq": "", "site_lbl": "N316", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "10", "chr_pos": "20177062", "evidence": [ { "id": "rs1834537517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1834537517" }, { "id": "rs1834537517", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1834537517#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UX71-1", "start_pos": 316, "end_pos": 316, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin domain-containing protein 2", "gene_name": "PLXDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 59583.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLnCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLNCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "13", "chr_pos": "28433880", "evidence": [ { "id": "rs767050810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767050810#frequency_tab" }, { "id": "rs767050810", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767050810" }, { "id": "rs767050810", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs767050810" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "145", "site_seq": "VLnASAEAQR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NI99-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 6", "gene_name": "ANGPTL6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 51694.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NI99-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 6", "gene_name": "ANGPTL6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 51694.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "19", "chr_pos": "10096130", "evidence": [ { "id": "rs778107781", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778107781" }, { "id": "rs778107781", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778107781" }, { "id": "rs778107781", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778107781" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NI99-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiopoietin-related protein 6", "gene_name": "ANGPTL6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 470, "chemical_mass": 51694.0 } ] }, { "start_pos": "281", "site_seq": "ELYLQNNYLTDEGLDnETFWK", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "", "site_lbl": "N281", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "1", "chr_pos": "53077787", "evidence": [ { "id": "rs1364224974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1364224974" }, { "id": "rs1364224974", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1364224974#frequency_tab" }, { "id": "rs1364224974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1364224974" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "53077789", "evidence": [ { "id": "rs567995586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs567995586" }, { "id": "rs567995586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs567995586#frequency_tab" }, { "id": "rs567995586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs567995586" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "3727", "site_seq": "GGPQSLVILLnK", "site_lbl": "Asn3727", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3727, "end_pos": 3727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "3727", "site_seq": "GGPQSLVILLNK", "site_lbl": "Asn3727", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3727, "end_pos": 3727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "3727", "site_seq": "N", "site_lbl": "Asn3727", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3727, "end_pos": 3727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "3727", "site_seq": "", "site_lbl": "N3727", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "1", "chr_pos": "186114027", "evidence": [ { "id": "rs1007619979", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1007619979" }, { "id": "rs1007619979", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1007619979#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96RW7-1", "start_pos": 3727, "end_pos": 3727, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemicentin-1", "gene_name": "HMCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 5635, "chemical_mass": 613390.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "174", "site_seq": "CGnCSLTTLK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "174", "site_seq": "CGNCSLTTLKDEDFCK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "174", "site_seq": "", "site_lbl": "N174", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "5", "chr_pos": "42804668", "evidence": [ { "id": "P49908", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P49908" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "173911863", "evidence": [ { "id": "rs1657783494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657783494" }, { "id": "rs1657783494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657783494#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVnTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVNTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "NC_000018.10", "chr_pos": "7949263", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "551", "site_seq": "EGICNGFTALCPASDPKPnFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "PNFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "167", "site_seq": "LGDCISEDSYPDGnITWYR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "167", "site_seq": "KLGDCISEDSYPDGNITWYR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "167", "site_seq": "KLGDCISEDSYPDGnITWYR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "167", "site_seq": "LGDCISEDSYPDGnITWYRNGK", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "nATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "N", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "RnATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "RNATGDYK", "site_lbl": "Asn306", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "N", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "nATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "QIGDALPVSCTISASRnATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "NATVVWMK", "site_lbl": "Asn361", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "105533643", "evidence": [ { "id": "rs1386021816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386021816" }, { "id": "rs1386021816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1386021816" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "3", "chr_pos": "105533642", "evidence": [ { "id": "rs1576226589", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576226589" }, { "id": "rs1576226589", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576226589" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "306", "site_seq": "", "site_lbl": "N306", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "105541691", "evidence": [ { "id": "rs781323112", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781323112" }, { "id": "rs781323112", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs781323112" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 306, "end_pos": 306, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "361", "site_seq": "", "site_lbl": "N361", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "105545312", "evidence": [ { "id": "rs1276648550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1276648550" }, { "id": "rs1276648550", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1276648550" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 361, "end_pos": 361, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "", "site_lbl": "N480", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "105550191", "evidence": [ { "id": "Q13740", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13740" }, { "id": "rs1940358284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1940358284" }, { "id": "rs1940358284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1940358284#frequency_tab" }, { "id": "rs1940358284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1940358284" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "335", "site_seq": "VMVEAYPGLQGFnWTYLGPFSDHQPEPK", "site_lbl": "Asn335", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 335, "end_pos": 335, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "335", "site_seq": "N", "site_lbl": "Asn335", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 335, "end_pos": 335, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "335", "site_seq": "", "site_lbl": "N335", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "5", "chr_pos": "150073378", "evidence": [ { "id": "P07333", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07333" }, { "id": "rs1385795374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1385795374" }, { "id": "rs1385795374", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1385795374#frequency_tab" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NWT->TWT).", "chr_id": "5", "chr_pos": "150073379", "evidence": [ { "id": "P07333", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07333" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 335, "end_pos": 335, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "", "site_lbl": "N227", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "8", "chr_pos": "73067456", "evidence": [ { "id": "rs773889462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773889462#frequency_tab" }, { "id": "rs773889462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773889462" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "42", "site_seq": "KQnDSVIAECSNR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR97-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1041, "chemical_mass": 119828.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NR97-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1041, "chemical_mass": 119828.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQnITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQNITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "", "site_lbl": "N966", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "1", "chr_pos": "43604049", "evidence": [ { "id": "rs1654449880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1654449880" }, { "id": "rs1654449880", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1654449880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATNCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "", "site_lbl": "N163", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->HCS).", "chr_id": "12", "chr_pos": "95787037", "evidence": [ { "id": "rs2079172773", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2079172773" }, { "id": "rs2079172773", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2079172773#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "3920", "site_seq": "GPnLTSPASITFTTGLEAPR", "site_lbl": "Asn3920", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22105-3", "start_pos": 3920, "end_pos": 3920, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin-X", "gene_name": "TNXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4244, "chemical_mass": 458388.0 } ] }, { "start_pos": "3920", "site_seq": "N", "site_lbl": "Asn3920", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22105-3", "start_pos": 3920, "end_pos": 3920, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin-X", "gene_name": "TNXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4244, "chemical_mass": 458388.0 } ] }, { "start_pos": "3920", "site_seq": "GLRGPnLTSPASITFTTGLEAPR", "site_lbl": "Asn3920", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P22105-3", "start_pos": 3920, "end_pos": 3920, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin-X", "gene_name": "TNXB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4244, "chemical_mass": 458388.0 } ] }, { "start_pos": "1049", "site_seq": "EAESLQPMTVVGTDYVFHnDTK", "site_lbl": "Asn1049", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1049, "end_pos": 1049, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1049", "site_seq": "N", "site_lbl": "Asn1049", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1049, "end_pos": 1049, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1049", "site_seq": "EAESLQPMTVVGTDYVFHNDTK", "site_lbl": "Asn1049", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1049, "end_pos": 1049, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYnLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYNLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "N", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "127", "site_seq": "ALSnISLR", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "127", "site_seq": "ALSNISLR", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQnMSRR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "SCVAVTSAQPQNMSR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "733", "site_seq": "LSHDAnETLPLHLYVK", "site_lbl": "Asn733", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 733, "end_pos": 733, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "733", "site_seq": "N", "site_lbl": "Asn733", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 733, "end_pos": 733, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "733", "site_seq": "LSHDANETLPLHLYVK", "site_lbl": "Asn733", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 733, "end_pos": 733, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1049", "site_seq": "", "site_lbl": "N1049", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "22", "chr_pos": "50282054", "evidence": [ { "id": "rs1166542517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1166542517" }, { "id": "rs1166542517", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1166542517#frequency_tab" }, { "id": "rs1166542517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1166542517" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "NC_000022.11", "chr_pos": "50282053", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "22", "chr_pos": "50282053", "evidence": [ { "id": "rs1428841737", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1428841737" }, { "id": "rs1428841737", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1428841737#frequency_tab" }, { "id": "rs1428841737", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1428841737" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1049, "end_pos": 1049, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->HIS).", "chr_id": "22", "chr_pos": "50290206", "evidence": [ { "id": "rs2066766735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2066766735" }, { "id": "rs2066766735", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2066766735#frequency_tab" }, { "id": "rs2066766735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2066766735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "22", "chr_pos": "50287693", "evidence": [ { "id": "rs920837059", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs920837059" }, { "id": "rs920837059", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs920837059" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "117", "site_seq": "FTFTSHTPGDHQICLHSnSTR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "N", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "FTFTSHTPGDHQICLHSNSTR", "site_lbl": "Asn117", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "117", "site_seq": "", "site_lbl": "N117", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "44581486", "evidence": [ { "id": "rs778354191", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778354191#frequency_tab" }, { "id": "rs778354191", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778354191" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "7", "chr_pos": "44581486", "evidence": [ { "id": "rs778354191", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778354191" }, { "id": "rs778354191", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778354191#frequency_tab" }, { "id": "rs778354191", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778354191" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z7H5-1", "start_pos": 117, "end_pos": 117, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane emp24 domain-containing protein 4", "gene_name": "TMED4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 227, "chemical_mass": 25943.0 } ] }, { "start_pos": "445", "site_seq": "IQATNTWLFLSSCNGnETSLWDCK", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "445", "site_seq": "N", "site_lbl": "Asn445", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 445, "end_pos": 445, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "301", "site_seq": "AVYSVMAMVEHSGnYTCK", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "301", "site_seq": "N", "site_lbl": "Asn301", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 301, "end_pos": 301, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "453", "site_seq": "VLEnSTK", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "217", "site_seq": "QTQVGIVQYGEnVTHEFNLNK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "QTQVGIVQYGENVTHEFNLNK", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "VYVYALnQTR", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "VYVYALNQTR", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "N", "site_lbl": "Asn532", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "5", "chr_pos": "52881897", "evidence": [ { "id": "rs569021701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569021701" }, { "id": "rs569021701", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs569021701" }, { "id": "rs569021701", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs569021701" }, { "id": "rs569021701", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs569021701" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "5", "chr_pos": "52881899", "evidence": [ { "id": "rs762276627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762276627" }, { "id": "rs762276627", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762276627" }, { "id": "rs762276627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762276627#frequency_tab" }, { "id": "rs762276627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762276627" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "532", "site_seq": "", "site_lbl": "N532", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "5", "chr_pos": "52909038", "evidence": [ { "id": "rs1268595142", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1268595142" }, { "id": "rs1268595142", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1268595142#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "5", "chr_pos": "52909037", "evidence": [ { "id": "rs758786220", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758786220" }, { "id": "rs758786220", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758786220" }, { "id": "rs758786220", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758786220#frequency_tab" }, { "id": "rs758786220", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758786220" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 532, "end_pos": 532, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "566", "site_seq": "N", "site_lbl": "Asn566", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14210-1", "start_pos": 566, "end_pos": 566, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor", "gene_name": "HGF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 728, "chemical_mass": 83134.0 } ] }, { "start_pos": "566", "site_seq": "QVLnVSQLVYGPEGSDLVLMK", "site_lbl": "Asn566", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14210-1", "start_pos": 566, "end_pos": 566, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor", "gene_name": "HGF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 728, "chemical_mass": 83134.0 } ] }, { "start_pos": "566", "site_seq": "", "site_lbl": "N566", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "7", "chr_pos": "81706347", "evidence": [ { "id": "P14210", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14210" }, { "id": "rs1789426310", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1789426310" }, { "id": "rs1789426310", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1789426310" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14210-1", "start_pos": 566, "end_pos": 566, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor", "gene_name": "HGF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 728, "chemical_mass": 83134.0 } ] }, { "start_pos": "2558", "site_seq": "QLINALQInNTAVGHALVLPAGR", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "N", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "", "site_lbl": "N2558", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "237342157", "evidence": [ { "id": "P12111", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P12111" }, { "id": "rs1022266665", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1022266665" }, { "id": "rs1022266665", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1022266665" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "53", "site_seq": "DVnCSVMGPQEK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "DVNCSVMGPQEKK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "88337514", "evidence": [ { "id": "rs1857833438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1857833438" }, { "id": "rs1857833438", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1857833438#frequency_tab" }, { "id": "rs1857833438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1857833438" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "11", "chr_pos": "88337515", "evidence": [ { "id": "rs766806566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766806566" }, { "id": "rs766806566", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766806566" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "314", "site_seq": "DQnATNNGCAMASR", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "802", "site_seq": "DGDDEWTSVVVAnVSK", "site_lbl": "Asn802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 802, "end_pos": 802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "802", "site_seq": "N", "site_lbl": "Asn802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 802, "end_pos": 802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "802", "site_seq": "QKDGDDEWTSVVVANVSK", "site_lbl": "Asn802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 802, "end_pos": 802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "858", "site_seq": "VNVVnSTLAEVHWDPVPLK", "site_lbl": "Asn858", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 858, "end_pos": 858, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "858", "site_seq": "VNVVNSTLAEVHWDPVPLK", "site_lbl": "Asn858", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 858, "end_pos": 858, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "858", "site_seq": "N", "site_lbl": "Asn858", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 858, "end_pos": 858, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "802", "site_seq": "", "site_lbl": "N802", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "7", "chr_pos": "108182821", "evidence": [ { "id": "rs199526051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199526051" }, { "id": "rs199526051", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199526051" }, { "id": "rs199526051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199526051#frequency_tab" }, { "id": "rs199526051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199526051" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "7", "chr_pos": "108182820", "evidence": [ { "id": "rs979566081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs979566081" }, { "id": "rs979566081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs979566081#frequency_tab" }, { "id": "rs979566081", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs979566081" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 802, "end_pos": 802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "858", "site_seq": "", "site_lbl": "N858", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "7", "chr_pos": "108181896", "evidence": [ { "id": "rs758227136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758227136" }, { "id": "rs758227136", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758227136" }, { "id": "rs758227136", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758227136#frequency_tab" }, { "id": "rs758227136", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758227136" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->IST).", "chr_id": "7", "chr_pos": "108181895", "evidence": [ { "id": "rs1385785265", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1385785265" }, { "id": "rs1385785265", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1385785265" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92823-1", "start_pos": 858, "end_pos": 858, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1304, "chemical_mass": 143890.0 } ] }, { "start_pos": "38", "site_seq": "TnLTDR", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14780-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrix metalloproteinase-9", "gene_name": "MMP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 78458.0 } ] }, { "start_pos": "38", "site_seq": "N", "site_lbl": "Asn38", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14780-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrix metalloproteinase-9", "gene_name": "MMP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 78458.0 } ] }, { "start_pos": "38", "site_seq": "", "site_lbl": "N38", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "20", "chr_pos": "46009040", "evidence": [ { "id": "rs761037128", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761037128" }, { "id": "rs761037128", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761037128#frequency_tab" }, { "id": "rs761037128", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761037128" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "20", "chr_pos": "46009039", "evidence": [ { "id": "P14780", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14780" }, { "id": "rs41427445", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs41427445" }, { "id": "rs41427445", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs41427445" }, { "id": "rs41427445", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs41427445" }, { "id": "rs41427445", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs41427445#frequency_tab" }, { "id": "rs41427445", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs41427445" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14780-1", "start_pos": 38, "end_pos": 38, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrix metalloproteinase-9", "gene_name": "MMP9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 707, "chemical_mass": 78458.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "1", "chr_pos": "113981079", "evidence": [ { "id": "rs746449303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746449303#frequency_tab" }, { "id": "rs746449303", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746449303" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "539", "site_seq": "CQEAInATCK", "site_lbl": "Asn539", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "539", "site_seq": "N", "site_lbl": "Asn539", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "539", "site_seq": "KCQEAINATCK", "site_lbl": "Asn539", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "539", "site_seq": "", "site_lbl": "N539", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "2", "chr_pos": "9502206", "evidence": [ { "id": "P78536", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P78536" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "2", "chr_pos": "9502206", "evidence": [ { "id": "rs2124990856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124990856" }, { "id": "rs2124990856", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2124990856" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "2", "chr_pos": "9502205", "evidence": [ { "id": "rs755721769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755721769" }, { "id": "rs755721769", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755721769" }, { "id": "rs755721769", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755721769#frequency_tab" }, { "id": "rs755721769", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755721769" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P78536-1", "start_pos": 539, "end_pos": 539, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 17", "gene_name": "ADAM17", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 824, "chemical_mass": 93021.0 } ] }, { "start_pos": "1500", "site_seq": "SDGInVTGGCLVMSQPDADR", "site_lbl": "Asn1500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UPZ6-1", "start_pos": 1500, "end_pos": 1500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 7A", "gene_name": "THSD7A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1657, "chemical_mass": 185363.0 } ] }, { "start_pos": "1500", "site_seq": "N", "site_lbl": "Asn1500", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UPZ6-1", "start_pos": 1500, "end_pos": 1500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 7A", "gene_name": "THSD7A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1657, "chemical_mass": 185363.0 } ] }, { "start_pos": "1500", "site_seq": "", "site_lbl": "N1500", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "7", "chr_pos": "11382528", "evidence": [ { "id": "rs1782558755", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1782558755" }, { "id": "rs1782558755", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1782558755#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UPZ6-1", "start_pos": 1500, "end_pos": 1500, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 7A", "gene_name": "THSD7A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1657, "chemical_mass": 185363.0 } ] }, { "start_pos": "413", "site_seq": "EITGFLLIQAWPEnR", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "413", "site_seq": "EITGFLLIQAWPENR", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "413", "site_seq": "N", "site_lbl": "Asn413", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "413", "site_seq": "", "site_lbl": "N413", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "55157692", "evidence": [ { "id": "rs895496054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs895496054" }, { "id": "rs895496054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs895496054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "7", "chr_pos": "55157694", "evidence": [ { "id": "P00533", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00533" }, { "id": "rs2128939657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2128939657" }, { "id": "rs2128939657", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2128939657" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "7", "chr_pos": "55157693", "evidence": [ { "id": "rs770466526", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770466526" }, { "id": "rs770466526", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770466526" }, { "id": "rs770466526", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770466526" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "7", "chr_pos": "55157693", "evidence": [ { "id": "rs770466526", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770466526" }, { "id": "rs770466526", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770466526" }, { "id": "rs770466526", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770466526" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "7", "chr_pos": "55157692", "evidence": [ { "id": "rs895496054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs895496054" }, { "id": "rs895496054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs895496054#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00533-1", "start_pos": 413, "end_pos": 413, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1210, "chemical_mass": 134277.0 } ] }, { "start_pos": "386", "site_seq": "TCSSnLTLTSGSK", "site_lbl": "Asn386", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 386, "end_pos": 386, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "386", "site_seq": "N", "site_lbl": "Asn386", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 386, "end_pos": 386, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "386", "site_seq": "", "site_lbl": "N386", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "45095436", "evidence": [ { "id": "rs1272493694", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1272493694" }, { "id": "rs1272493694", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1272493694#frequency_tab" }, { "id": "rs1272493694", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1272493694" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H5V8-1", "start_pos": 386, "end_pos": 386, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CUB domain-containing protein 1", "gene_name": "CDCP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 92932.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "592", "site_seq": "N", "site_lbl": "Asn592", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 592, "end_pos": 592, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "592", "site_seq": "YLYLASnHSNK", "site_lbl": "Asn592", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 592, "end_pos": 592, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "592", "site_seq": "LLEMEEQAAFLVGSATPRYLYLASnHSNK", "site_lbl": "Asn592", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 592, "end_pos": 592, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "592", "site_seq": "", "site_lbl": "N592", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "17", "chr_pos": "42854622", "evidence": [ { "id": "rs746368967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746368967" }, { "id": "rs746368967", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746368967" }, { "id": "rs746368967", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746368967#frequency_tab" }, { "id": "rs746368967", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746368967" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16853-1", "start_pos": 592, "end_pos": 592, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amine oxidase [copper-containing] 3", "gene_name": "AOC3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 763, "chemical_mass": 84622.0 } ] }, { "start_pos": "112", "site_seq": "LRVYGQNINnETWSR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8M5-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metal transporter CNNM2", "gene_name": "CNNM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 875, "chemical_mass": 96623.0 } ] }, { "start_pos": "112", "site_seq": "VYGQNINnETWSR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8M5-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metal transporter CNNM2", "gene_name": "CNNM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 875, "chemical_mass": 96623.0 } ] }, { "start_pos": "112", "site_seq": "VYGQNINNETWSR", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8M5-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metal transporter CNNM2", "gene_name": "CNNM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 875, "chemical_mass": 96623.0 } ] }, { "start_pos": "112", "site_seq": "N", "site_lbl": "Asn112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8M5-1", "start_pos": 112, "end_pos": 112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metal transporter CNNM2", "gene_name": "CNNM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 875, "chemical_mass": 96623.0 } ] }, { "start_pos": "131", "site_seq": "nLSCIVNEGKK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "131", "site_seq": "nLSCIVNEGK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "131", "site_seq": "NLSCIVNEGK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "131", "site_seq": "", "site_lbl": "N131", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "5", "chr_pos": "55968376", "evidence": [ { "id": "P40189", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P40189" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "NC_000005.10", "chr_pos": "55968374", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->TLS).", "chr_id": "5", "chr_pos": "55968375", "evidence": [ { "id": "rs1317590575", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317590575" }, { "id": "rs1317590575", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1317590575" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P40189-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 918, "chemical_mass": 103537.0 } ] }, { "start_pos": "276", "site_seq": "InRTEVYNK", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6X5-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Bis(5'-adenosyl)-triphosphatase ENPP4", "gene_name": "ENPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51641.0 } ] }, { "start_pos": "276", "site_seq": "INRTEVYNK", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6X5-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Bis(5'-adenosyl)-triphosphatase ENPP4", "gene_name": "ENPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51641.0 } ] }, { "start_pos": "276", "site_seq": "N", "site_lbl": "Asn276", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6X5-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Bis(5'-adenosyl)-triphosphatase ENPP4", "gene_name": "ENPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51641.0 } ] }, { "start_pos": "276", "site_seq": "", "site_lbl": "N276", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "6", "chr_pos": "46140409", "evidence": [ { "id": "rs1764041216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1764041216" }, { "id": "rs1764041216", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1764041216#frequency_tab" }, { "id": "rs1764041216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1764041216" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "6", "chr_pos": "46141052", "evidence": [ { "id": "rs150522182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150522182" }, { "id": "rs150522182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150522182" }, { "id": "rs150522182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150522182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "46141052", "evidence": [ { "id": "rs150522182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150522182" }, { "id": "rs150522182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150522182" }, { "id": "rs150522182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150522182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "6", "chr_pos": "46140409", "evidence": [ { "id": "rs1764041216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1764041216" }, { "id": "rs1764041216", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1764041216#frequency_tab" }, { "id": "rs1764041216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1764041216" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6X5-1", "start_pos": 276, "end_pos": 276, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Bis(5'-adenosyl)-triphosphatase ENPP4", "gene_name": "ENPP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51641.0 } ] }, { "start_pos": "1501", "site_seq": "FGSVLGnYSCAAQGTQGGSK", "site_lbl": "Asn1501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCU4-1", "start_pos": 1501, "end_pos": 1501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "CELSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2923, "chemical_mass": 317453.0 } ] }, { "start_pos": "1501", "site_seq": "N", "site_lbl": "Asn1501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCU4-1", "start_pos": 1501, "end_pos": 1501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "CELSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2923, "chemical_mass": 317453.0 } ] }, { "start_pos": "1501", "site_seq": "FGSVLGNYSCAAQGTQGGSK", "site_lbl": "Asn1501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCU4-1", "start_pos": 1501, "end_pos": 1501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "CELSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2923, "chemical_mass": 317453.0 } ] }, { "start_pos": "1501", "site_seq": "", "site_lbl": "N1501", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "1", "chr_pos": "109262401", "evidence": [ { "id": "rs1052908831", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1052908831" }, { "id": "rs1052908831", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1052908831#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCU4-1", "start_pos": 1501, "end_pos": 1501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin EGF LAG seven-pass G-type receptor 2", "gene_name": "CELSR2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2923, "chemical_mass": 317453.0 } ] }, { "start_pos": "2528", "site_seq": "MLEAYnLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "N", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "IEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEK", "site_lbl": "Asn2528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "N", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "EAGnITTDGYEILGK", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "EAGNITTDGYEILGK", "site_lbl": "Asn2679", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2528", "site_seq": "", "site_lbl": "N2528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "75115899", "evidence": [ { "id": "rs754177385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754177385" }, { "id": "rs754177385", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754177385#frequency_tab" }, { "id": "rs754177385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754177385" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "6", "chr_pos": "75115897", "evidence": [ { "id": "rs2149361441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2149361441" }, { "id": "rs2149361441", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2149361441" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "6", "chr_pos": "75115898", "evidence": [ { "id": "rs1168175119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168175119" }, { "id": "rs1168175119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168175119#frequency_tab" }, { "id": "rs1168175119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1168175119" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2528, "end_pos": 2528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "2679", "site_seq": "", "site_lbl": "N2679", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->HIT).", "chr_id": "6", "chr_pos": "75109083", "evidence": [ { "id": "Q99715", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q99715" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "6", "chr_pos": "75109082", "evidence": [ { "id": "rs1232271738", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1232271738" }, { "id": "rs1232271738", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1232271738" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 2679, "end_pos": 2679, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "166", "site_seq": "HLLEnSTASVSEAERK", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "HLLEnSTASVSEAER", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "166", "site_seq": "HLLENSTASVSEAER", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42892-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endothelin-converting enzyme 1", "gene_name": "ECE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 770, "chemical_mass": 87164.0 } ] }, { "start_pos": "96", "site_seq": "IDFSGSQDnLTITMHR", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09564-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "T-cell antigen CD7", "gene_name": "CD7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25409.0 } ] }, { "start_pos": "96", "site_seq": "N", "site_lbl": "Asn96", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09564-1", "start_pos": 96, "end_pos": 96, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "T-cell antigen CD7", "gene_name": "CD7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25409.0 } ] }, { "start_pos": "407", "site_seq": "LGFLGnQSQGCLPAR", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "407", "site_seq": "N", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "407", "site_seq": "LGFLGNQSQGCLPAR", "site_lbl": "Asn407", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49746-1", "start_pos": 407, "end_pos": 407, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-3", "gene_name": "THBS3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 104201.0 } ] }, { "start_pos": "103", "site_seq": "SnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "RSnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "6", "chr_pos": "32442673", "evidence": [ { "id": "P01903", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01903" }, { "id": "rs1450907470", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450907470" }, { "id": "rs1450907470", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450907470#frequency_tab" }, { "id": "rs1450907470", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1450907470" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "245", "site_seq": "GAFFPLTERnWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "N", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "nWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "245", "site_seq": "NWSLPNR", "site_lbl": "Asn245", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 245, "end_pos": 245, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "398", "site_seq": "IYSnHSALESLALIPLQAPLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "398", "site_seq": "FRIYSnHSALESLALIPLQAPLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "398", "site_seq": "IYSNHSALESLALIPLQAPLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "64", "site_seq": "EGHFYYnISEVK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "64", "site_seq": "EGHFYYNISEVK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "20", "chr_pos": "45899860", "evidence": [ { "id": "rs1329820751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1329820751" }, { "id": "rs1329820751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1329820751" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "NC_000020.11", "chr_pos": "45899861", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->HIS).", "chr_id": "20", "chr_pos": "45911162", "evidence": [ { "id": "rs750855229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750855229" }, { "id": "rs750855229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750855229" }, { "id": "rs750855229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750855229#frequency_tab" }, { "id": "rs750855229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750855229" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "20", "chr_pos": "45911161", "evidence": [ { "id": "P55058", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P55058" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "20", "chr_pos": "45911161", "evidence": [ { "id": "P55058", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P55058" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "20", "chr_pos": "45911162", "evidence": [ { "id": "rs750855229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750855229" }, { "id": "rs750855229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750855229" }, { "id": "rs750855229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750855229#frequency_tab" }, { "id": "rs750855229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750855229" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Increased nuclear localization; when associated with A-94; A-117 and A-143.", "evidence": [ { "database": "UniProtKB", "id": "P55058", "url": "https://www.uniprot.org/uniprotkb/P55058" }, { "database": "PubMed", "id": "19321130", "url": "https://glygen.org/publication/PubMed/19321130" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55058-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 493, "chemical_mass": 54739.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "MPSQAPTGNFYPQPLLnSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "GPVKMPSQAPTGNFYPQPLLNSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTIQIMYGCDVGSDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEDGSHTIQIMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "29943013", "evidence": [ { "id": "rs199474467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474467" }, { "id": "rs199474467", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474467" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "29943012", "evidence": [ { "id": "rs199474466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474466" }, { "id": "rs199474466", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs the recruitment of HLA-A*02 in the peptide-loading complex.", "evidence": [ { "database": "UniProtKB", "id": "P04439", "url": "https://www.uniprot.org/uniprotkb/P04439" }, { "database": "PubMed", "id": "21263072", "url": "https://glygen.org/publication/PubMed/21263072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "354", "site_seq": "QGNnHTCTWK", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "354", "site_seq": "QGNNHTCTWK", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16610-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular matrix protein 1", "gene_name": "ECM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 540, "chemical_mass": 60674.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "575", "site_seq": "nDSHYVVYTR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "575", "site_seq": "", "site_lbl": "N575", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "2", "chr_pos": "44320305", "evidence": [ { "id": "rs771849667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771849667" }, { "id": "rs771849667", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771849667" }, { "id": "rs771849667", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771849667#frequency_tab" }, { "id": "rs771849667", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771849667" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "YHYnGTFEDGK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "EVQMGDFVRYHYnGTFEDGK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "17", "chr_pos": "41813244", "evidence": [ { "id": "rs373594621", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373594621" }, { "id": "rs373594621", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373594621" }, { "id": "rs373594621", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373594621#frequency_tab" }, { "id": "rs373594621", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373594621" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "17", "chr_pos": "41813243", "evidence": [ { "id": "rs145424241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145424241" }, { "id": "rs145424241", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145424241" }, { "id": "rs145424241", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145424241" }, { "id": "rs145424241", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145424241#frequency_tab" }, { "id": "rs145424241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145424241" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96AY3-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP10", "gene_name": "FKBP10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 582, "chemical_mass": 64245.0 } ] }, { "start_pos": "256", "site_seq": "QAEILEYAYHGQIAIVAPEALLAGHnYTLK", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "256", "site_seq": "", "site_lbl": "N256", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "5", "chr_pos": "96979884", "evidence": [ { "id": "rs184257448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184257448" }, { "id": "rs184257448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs184257448" }, { "id": "rs184257448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184257448" }, { "id": "rs184257448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs184257448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "5", "chr_pos": "96979885", "evidence": [ { "id": "rs779914524", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779914524" }, { "id": "rs779914524", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779914524" }, { "id": "rs779914524", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779914524" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "5", "chr_pos": "96979886", "evidence": [ { "id": "rs540613230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs540613230" }, { "id": "rs540613230", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs540613230" }, { "id": "rs540613230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs540613230" }, { "id": "rs540613230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs540613230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UIQ6-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1025, "chemical_mass": 117349.0 } ] }, { "start_pos": "179", "site_seq": "NPSTnVSVVVFDSTK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3T906-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunits alpha/beta", "gene_name": "GNPTAB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1256, "chemical_mass": 143622.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3T906-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunits alpha/beta", "gene_name": "GNPTAB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1256, "chemical_mass": 143622.0 } ] }, { "start_pos": "179", "site_seq": "NPSTNVSVVVFDSTK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3T906-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-1-phosphotransferase subunits alpha/beta", "gene_name": "GNPTAB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1256, "chemical_mass": 143622.0 } ] }, { "start_pos": "1388", "site_seq": "GLnMSMCHPGQMSLLGR", "site_lbl": "Asn1388", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86UU0-1", "start_pos": 1388, "end_pos": 1388, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1499, "chemical_mass": 157129.0 } ] }, { "start_pos": "664", "site_seq": "EVVSQMLGLnVTSLALPDYEIIK", "site_lbl": "Asn664", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IYT3-1", "start_pos": 664, "end_pos": 664, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coiled-coil domain-containing protein 170", "gene_name": "CCDC170", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 715, "chemical_mass": 82277.0 } ] }, { "start_pos": "118", "site_seq": "LCDEGHGLEVEInCTR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25445-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 37732.0 } ] }, { "start_pos": "118", "site_seq": "LCDEGHGLEVEINCTR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25445-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 37732.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25445-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 37732.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "10", "chr_pos": "89008907", "evidence": [ { "id": "rs121913083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121913083" }, { "id": "rs121913083", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121913083" }, { "id": "10620127", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10620127" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25445-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 37732.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "155138234", "evidence": [ { "id": "rs1339178202", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339178202" }, { "id": "rs1339178202", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339178202" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "155138236", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" }, { "id": "rs1434664230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434664230" }, { "id": "rs1434664230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434664230" }, { "id": "rs1434664230", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1434664230" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ], "disease": [ { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "6586092", "evidence": [ { "id": "rs147009720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147009720#frequency_tab" }, { "id": "rs147009720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147009720" }, { "id": "rs147009720", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs147009720" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreased expression and decreased binding to CD27.", "evidence": [ { "database": "UniProtKB", "id": "P32970", "url": "https://www.uniprot.org/uniprotkb/P32970" }, { "database": "PubMed", "id": "34419446", "url": "https://glygen.org/publication/PubMed/34419446" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "254", "site_seq": "ITnISSDDSGK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16620-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "NTRK2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 91999.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16620-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "NTRK2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 91999.0 } ] }, { "start_pos": "254", "site_seq": "", "site_lbl": "N254", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "9", "chr_pos": "84724264", "evidence": [ { "id": "Q16620", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16620" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "9", "chr_pos": "84724263", "evidence": [ { "id": "Q16620", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16620" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16620-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "NTRK2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 822, "chemical_mass": 91999.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "198", "site_seq": "CQCEPGFQLGPNnR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95967-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EGF-containing fibulin-like extracellular matrix protein 2", "gene_name": "EFEMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 49405.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95967-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EGF-containing fibulin-like extracellular matrix protein 2", "gene_name": "EFEMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 49405.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "11", "chr_pos": "65870134", "evidence": [ { "id": "O95967", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95967" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95967-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "EGF-containing fibulin-like extracellular matrix protein 2", "gene_name": "EFEMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 443, "chemical_mass": 49405.0 } ] }, { "start_pos": "2028", "site_seq": "LSAIPnDTAAK", "site_lbl": "Asn2028", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2028, "end_pos": 2028, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2028", "site_seq": "N", "site_lbl": "Asn2028", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2028, "end_pos": 2028, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2028", "site_seq": "LSAIPNDTAAK", "site_lbl": "Asn2028", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2028, "end_pos": 2028, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2126", "site_seq": "nISEIK", "site_lbl": "Asn2126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2126, "end_pos": 2126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2126", "site_seq": "N", "site_lbl": "Asn2126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2126, "end_pos": 2126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2028", "site_seq": "", "site_lbl": "N2028", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "6", "chr_pos": "129438759", "evidence": [ { "id": "rs1781958520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1781958520" }, { "id": "rs1781958520", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1781958520" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2028, "end_pos": 2028, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "770", "site_seq": "QLSCVANQnGSQADCELGNPFK", "site_lbl": "Asn770", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 770, "end_pos": 770, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "770", "site_seq": "N", "site_lbl": "Asn770", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 770, "end_pos": 770, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "770", "site_seq": "QLSCVANQnGSQADCELGNPFKR", "site_lbl": "Asn770", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 770, "end_pos": 770, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "770", "site_seq": "QLSCVANQNGSQADCELGNPFKR", "site_lbl": "Asn770", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P23229-1", "start_pos": 770, "end_pos": 770, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-6", "gene_name": "ITGA6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1130, "chemical_mass": 126606.0 } ] }, { "start_pos": "249", "site_seq": "TTEFDTnSTDIALK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HBW9-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor L4", "gene_name": "ADGRL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 690, "chemical_mass": 77811.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HBW9-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor L4", "gene_name": "ADGRL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 690, "chemical_mass": 77811.0 } ] }, { "start_pos": "197", "site_seq": "SEGAnGTVATAAIQPK", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96B97-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 665, "chemical_mass": 73126.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "X", "chr_pos": "19683959", "evidence": [ { "id": "rs187106457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187106457" }, { "id": "rs187106457", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs187106457" }, { "id": "rs187106457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187106457" }, { "id": "rs187106457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs187106457" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96B97-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 665, "chemical_mass": 73126.0 } ] }, { "start_pos": "189", "site_seq": "YQFEVLCPAPRPGAASnLSYR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "", "site_lbl": "N189", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "14", "chr_pos": "38255456", "evidence": [ { "id": "rs751425995", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751425995" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "14", "chr_pos": "38255457", "evidence": [ { "id": "Q86T13", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86T13" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "17", "chr_pos": "66216813", "evidence": [ { "id": "rs1307136735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307136735" }, { "id": "rs1307136735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1307136735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "33134893", "evidence": [ { "id": "Q14766", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14766" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "210", "site_seq": "GnITEYQCHQYITK", "site_lbl": "Asn210", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 210, "end_pos": 210, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "210", "site_seq": "N", "site_lbl": "Asn210", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 210, "end_pos": 210, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "210", "site_seq": "", "site_lbl": "N210", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "16", "chr_pos": "74503675", "evidence": [ { "id": "rs753921101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753921101" }, { "id": "rs753921101", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753921101" }, { "id": "rs753921101", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753921101" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "74503676", "evidence": [ { "id": "rs2016496388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2016496388" }, { "id": "rs2016496388", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2016496388#frequency_tab" }, { "id": "rs2016496388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2016496388" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 210, "end_pos": 210, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "251", "site_seq": "DFEDLYTPVnGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "KDFEDLYTPVNGSIVIVR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "196069505", "evidence": [ { "id": "rs764716764", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764716764" }, { "id": "rs764716764", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764716764" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02786-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 760, "chemical_mass": 84871.0 } ] }, { "start_pos": "1070", "site_seq": "DLDTDFTNnASQPETK", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "1070", "site_seq": "N", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "1070", "site_seq": "GKDLDTDFTNNASQPETK", "site_lbl": "Asn1070", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 1070, "end_pos": 1070, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLnTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLNTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "978", "site_seq": "HIWSLEISNKPnVSEPEEPK", "site_lbl": "Asn978", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 978, "end_pos": 978, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "978", "site_seq": "HIWSLEISNKPNVSEPEEPK", "site_lbl": "Asn978", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 978, "end_pos": 978, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "978", "site_seq": "N", "site_lbl": "Asn978", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 978, "end_pos": 978, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "", "site_lbl": "N172", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "rs1910983710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1910983710" }, { "id": "rs1910983710", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1910983710" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" }, { "id": "rs1460795208", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "O75976", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75976" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "978", "site_seq": "", "site_lbl": "N978", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "17", "chr_pos": "30449612", "evidence": [ { "id": "rs1286804435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1286804435" }, { "id": "rs1286804435", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1286804435#frequency_tab" }, { "id": "rs1286804435", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1286804435" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 978, "end_pos": 978, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "54", "site_seq": "AEGWEEGPPTVLSDSPWTnISGSCK", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13822-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Autotaxin", "gene_name": "ENPP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 863, "chemical_mass": 98994.0 } ] }, { "start_pos": "54", "site_seq": "N", "site_lbl": "Asn54", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13822-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Autotaxin", "gene_name": "ENPP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 863, "chemical_mass": 98994.0 } ] }, { "start_pos": "54", "site_seq": "", "site_lbl": "N54", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "8", "chr_pos": "119626696", "evidence": [ { "id": "rs762477048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762477048" }, { "id": "rs762477048", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762477048" }, { "id": "rs762477048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762477048" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13822-1", "start_pos": 54, "end_pos": 54, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Autotaxin", "gene_name": "ENPP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 863, "chemical_mass": 98994.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "GAFISnFSMTVDGK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->IFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "10", "chr_pos": "7709183", "evidence": [ { "id": "rs768596600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768596600#frequency_tab" }, { "id": "rs768596600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768596600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "P19823", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19823" }, { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" }, { "id": "rs749501304", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs749501304" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "221", "site_seq": "SIGSEPHEDHVFLVAnFSQIETLTSVFQK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "8", "chr_pos": "97931471", "evidence": [ { "id": "rs760010717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760010717#frequency_tab" }, { "id": "rs760010717", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760010717" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "418", "site_seq": "CVASVPSIPGLnR", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "418", "site_seq": "N", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "418", "site_seq": "CVASVPSIPGLNR", "site_lbl": "Asn418", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "418", "site_seq": "", "site_lbl": "N418", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "11", "chr_pos": "119311840", "evidence": [ { "id": "rs1391298330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1391298330" }, { "id": "rs1391298330", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1391298330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43121-1", "start_pos": 418, "end_pos": 418, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 646, "chemical_mass": 71607.0 } ] }, { "start_pos": "840", "site_seq": "YQQnMSHLEEK", "site_lbl": "Asn840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 840, "end_pos": 840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "840", "site_seq": "N", "site_lbl": "Asn840", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 840, "end_pos": 840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "840", "site_seq": "", "site_lbl": "N840", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->IMS).", "chr_id": "4", "chr_pos": "89936199", "evidence": [ { "id": "rs1244428335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244428335" }, { "id": "rs1244428335", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1244428335#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 840, "end_pos": 840, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "149", "site_seq": "IISnASCTTNCLAPLAK", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04406-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 36053.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04406-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 36053.0 } ] }, { "start_pos": "149", "site_seq": "", "site_lbl": "N149", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "12", "chr_pos": "6537311", "evidence": [ { "id": "rs1213257920", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1213257920" }, { "id": "rs1213257920", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1213257920#frequency_tab" }, { "id": "rs1213257920", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1213257920" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04406-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 335, "chemical_mass": 36053.0 } ] }, { "start_pos": "170", "site_seq": "DEGLCSAnVTR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48307-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue factor pathway inhibitor 2", "gene_name": "TFPI2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 26934.0 } ] }, { "start_pos": "170", "site_seq": "DEGLCSANVTR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48307-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue factor pathway inhibitor 2", "gene_name": "TFPI2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 26934.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P48307-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue factor pathway inhibitor 2", "gene_name": "TFPI2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 26934.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "93887384", "evidence": [ { "id": "rs1330815192", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1330815192" }, { "id": "rs1330815192", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1330815192#frequency_tab" }, { "id": "rs1330815192", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1330815192" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "93887383", "evidence": [ { "id": "rs1439276812", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1439276812" }, { "id": "rs1439276812", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1439276812" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P48307-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue factor pathway inhibitor 2", "gene_name": "TFPI2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 235, "chemical_mass": 26934.0 } ] }, { "start_pos": "42", "site_seq": "AQAVETnK", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "42", "site_seq": "", "site_lbl": "N42", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "15", "chr_pos": "58538370", "evidence": [ { "id": "rs1458586455", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1458586455" }, { "id": "rs1458586455", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1458586455" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "171", "site_seq": "N", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "171", "site_seq": "FVnVTVTPEDQCRPNNVCTGVLTR", "site_lbl": "Asn171", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "171", "site_seq": "", "site_lbl": "N171", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "19", "chr_pos": "830860", "evidence": [ { "id": "rs141614223", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141614223" }, { "id": "rs141614223", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141614223" }, { "id": "rs141614223", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141614223" }, { "id": "rs141614223", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141614223#frequency_tab" }, { "id": "rs141614223", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141614223" }, { "id": "rs141614223", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141614223" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "830859", "evidence": [ { "id": "rs556744148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556744148" }, { "id": "rs556744148", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556744148" }, { "id": "rs556744148", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556744148" }, { "id": "rs556744148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556744148#frequency_tab" }, { "id": "rs556744148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556744148" }, { "id": "rs556744148", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556744148" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20160-1", "start_pos": 171, "end_pos": 171, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 251, "chemical_mass": 26886.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "50", "site_seq": "EIFVANGTQGK", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "EIFVAnGTQGK", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "1", "chr_pos": "167765640", "evidence": [ { "id": "O95297", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95297" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "1", "chr_pos": "167765639", "evidence": [ { "id": "rs1661099816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1661099816" }, { "id": "rs1661099816", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1661099816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95297-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Myelin protein zero-like protein 1", "gene_name": "MPZL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 269, "chemical_mass": 29082.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTNTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "", "site_lbl": "N75", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "12", "chr_pos": "121217222", "evidence": [ { "id": "rs761894408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761894408" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "12", "chr_pos": "121217223", "evidence": [ { "id": "rs1365692488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1365692488" }, { "id": "rs1365692488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1365692488" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "YSSEFCSTPACSEGNSDCYFGnGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "AGKYSSEFCSTPACSEGNSDCYFGNGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "", "site_lbl": "N219", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "8", "chr_pos": "42182866", "evidence": [ { "id": "rs1805306076", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1805306076" }, { "id": "rs1805306076", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1805306076#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "265", "site_seq": "NILPGELVTLTCQVnSSYPAVSSIK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BZZ2-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialoadhesin", "gene_name": "SIGLEC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1709, "chemical_mass": 182624.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BZZ2-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialoadhesin", "gene_name": "SIGLEC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1709, "chemical_mass": 182624.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "20", "chr_pos": "3704003", "evidence": [ { "id": "Q9BZZ2", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BZZ2" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "20", "chr_pos": "3704004", "evidence": [ { "id": "rs1362043690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1362043690" }, { "id": "rs1362043690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1362043690#frequency_tab" }, { "id": "rs1362043690", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1362043690" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "20", "chr_pos": "3704005", "evidence": [ { "id": "rs2087874009", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087874009" }, { "id": "rs2087874009", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2087874009#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BZZ2-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sialoadhesin", "gene_name": "SIGLEC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1709, "chemical_mass": 182624.0 } ] }, { "start_pos": "124", "site_seq": "LVGPSSVVCLPnGTWTGEQPHCR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53RD9-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-7", "gene_name": "FBLN7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 47376.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53RD9-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-7", "gene_name": "FBLN7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 47376.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "2", "chr_pos": "112165136", "evidence": [ { "id": "rs778824189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778824189" }, { "id": "rs778824189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778824189" }, { "id": "rs778824189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778824189#frequency_tab" }, { "id": "rs778824189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778824189" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "2", "chr_pos": "112165136", "evidence": [ { "id": "rs778824189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778824189" }, { "id": "rs778824189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778824189" }, { "id": "rs778824189", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778824189#frequency_tab" }, { "id": "rs778824189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778824189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q53RD9-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-7", "gene_name": "FBLN7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 47376.0 } ] } ], "record_id": "G04657PL" }