{ "glytoucan_ac": "G08110WX", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "368", "url": "https://glyconnect.expasy.org/browser/compositions/368" }, { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "PubMed", "id": "8130392", "url": "https://glygen.org/publication/PubMed/8130392" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "368", "url": "https://glyconnect.expasy.org/browser/compositions/368" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "368", "url": "https://glyconnect.expasy.org/browser/compositions/368" }, { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "368", "url": "https://glyconnect.expasy.org/browser/compositions/368" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 2159.8, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 3, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "WEnNSCVEK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "WEnNSCVEK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "WEnNSCVEK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "9", "chr_pos": "135562826", "evidence": [ { "id": "rs1832374425", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1832374425" }, { "id": "rs1832374425", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1832374425" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "WEnNSCVEK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "9", "chr_pos": "135562826", "evidence": [ { "id": "rs1832374425", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1832374425" }, { "id": "rs1832374425", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1832374425" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P09466-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "7592613", "url": "https://glygen.org/publication/PubMed/7592613" }, { "database": "GlyConnect", "id": "177", "url": "https://glyconnect.expasy.org/browser/proteins/177" } ], "protein_name": "Glycodelin", "gene_name": "PAEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 180, "chemical_mass": 20624.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "YSSEFCSTPACSEGNSDCYFGnGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "AGKYSSEFCSTPACSEGNSDCYFGNGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLnR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLNR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "YSSEFCSTPACSEGNSDCYFGnGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "AGKYSSEFCSTPACSEGNSDCYFGNGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLnR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLNR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "YSSEFCSTPACSEGNSDCYFGnGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "AGKYSSEFCSTPACSEGNSDCYFGNGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLnR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLNR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "", "site_lbl": "N219", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "8", "chr_pos": "42182866", "evidence": [ { "id": "rs1805306076", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1805306076" }, { "id": "rs1805306076", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1805306076#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "", "site_lbl": "N483", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "8", "chr_pos": "42178980", "evidence": [ { "id": "rs1805092933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1805092933" }, { "id": "rs1805092933", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1805092933#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "N", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "YSSEFCSTPACSEGNSDCYFGnGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "AGKYSSEFCSTPACSEGNSDCYFGNGSAYR", "site_lbl": "Asn219", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "N", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLnR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "CTSQHLLNR", "site_lbl": "Asn483", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "219", "site_seq": "", "site_lbl": "N219", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "8", "chr_pos": "42182866", "evidence": [ { "id": "rs1805306076", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1805306076" }, { "id": "rs1805306076", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1805306076#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 219, "end_pos": 219, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "483", "site_seq": "", "site_lbl": "N483", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "8", "chr_pos": "42178980", "evidence": [ { "id": "rs1805092933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1805092933" }, { "id": "rs1805092933", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1805092933#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00750-1", "start_pos": 483, "end_pos": 483, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1823160", "url": "https://glygen.org/publication/PubMed/1823160" }, { "database": "GlyConnect", "id": "603", "url": "https://glyconnect.expasy.org/browser/proteins/603" } ], "protein_name": "Tissue-type plasminogen activator", "gene_name": "PLAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 562, "chemical_mass": 62917.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03956-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "GlyConnect", "id": "301", "url": "https://glyconnect.expasy.org/browser/proteins/301" } ], "protein_name": "Interstitial collagenase", "gene_name": "MMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 469, "chemical_mass": 54007.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03956-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "GlyConnect", "id": "301", "url": "https://glyconnect.expasy.org/browser/proteins/301" } ], "protein_name": "Interstitial collagenase", "gene_name": "MMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 469, "chemical_mass": 54007.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03956-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "GlyConnect", "id": "301", "url": "https://glyconnect.expasy.org/browser/proteins/301" } ], "protein_name": "Interstitial collagenase", "gene_name": "MMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 469, "chemical_mass": 54007.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03956-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10092871", "url": "https://glygen.org/publication/PubMed/10092871" }, { "database": "GlyConnect", "id": "301", "url": "https://glyconnect.expasy.org/browser/proteins/301" } ], "protein_name": "Interstitial collagenase", "gene_name": "MMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 469, "chemical_mass": 54007.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "172", "site_seq": "LLnTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLNTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLnTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLNTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLnTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLNTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "", "site_lbl": "N172", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "rs1910983710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1910983710" }, { "id": "rs1910983710", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1910983710" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" }, { "id": "rs1460795208", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "O75976", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75976" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLnTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "N", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "LLNTTDVYLLPSLNPDGFER", "site_lbl": "Asn172", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "172", "site_seq": "", "site_lbl": "N172", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "rs1910983710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1910983710" }, { "id": "rs1910983710", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1910983710" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "17", "chr_pos": "30379495", "evidence": [ { "id": "rs1460795208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460795208" }, { "id": "rs1460795208", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460795208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "17", "chr_pos": "30379494", "evidence": [ { "id": "O75976", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75976" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O75976-1", "start_pos": 172, "end_pos": 172, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1066", "url": "https://glyconnect.expasy.org/browser/proteins/1066" } ], "protein_name": "Carboxypeptidase D", "gene_name": "CPD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1380, "chemical_mass": 152931.0 } ] }, { "start_pos": "59", "site_seq": "N", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETnFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETNFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "N", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETnFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETNFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "N", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETnFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETNFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "", "site_lbl": "N59", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "10", "chr_pos": "116270980", "evidence": [ { "id": "rs1843875838", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1843875838" }, { "id": "rs1843875838", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1843875838" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "N", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETnFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "ETNFSLASGLEAK", "site_lbl": "Asn59", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "59", "site_seq": "", "site_lbl": "N59", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "10", "chr_pos": "116270980", "evidence": [ { "id": "rs1843875838", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1843875838" }, { "id": "rs1843875838", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1843875838" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56159-1", "start_pos": 59, "end_pos": 59, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1265", "url": "https://glyconnect.expasy.org/browser/proteins/1265" } ], "protein_name": "GDNF family receptor alpha-1", "gene_name": "GFRA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 465, "chemical_mass": 51456.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "TYTYADTPDDFQLHNFSLPEEDTK", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "TYTYADTPDDFQLHNFSLPEEDTK", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "TYTYADTPDDFQLHNFSLPEEDTK", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "N", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "185", "site_seq": "TYTYADTPDDFQLHNFSLPEEDTK", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04062-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1271", "url": "https://glyconnect.expasy.org/browser/proteins/1271" } ], "protein_name": "Lysosomal acid glucosylceramidase", "gene_name": "GBA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 536, "chemical_mass": 59716.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "GnGTILK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "GnGTILK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "GnGTILK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "", "site_lbl": "N273", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "4", "chr_pos": "105942360", "evidence": [ { "id": "rs767229008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767229008" }, { "id": "rs767229008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767229008" }, { "id": "rs767229008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767229008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "N", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "GnGTILK", "site_lbl": "Asn273", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "273", "site_seq": "", "site_lbl": "N273", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "4", "chr_pos": "105942360", "evidence": [ { "id": "rs767229008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767229008" }, { "id": "rs767229008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767229008" }, { "id": "rs767229008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767229008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6UXI9-1", "start_pos": 273, "end_pos": 273, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1540", "url": "https://glyconnect.expasy.org/browser/proteins/1540" } ], "protein_name": "Nephronectin", "gene_name": "NPNT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 565, "chemical_mass": 61907.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1599", "url": "https://glyconnect.expasy.org/browser/proteins/1599" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "62", "site_seq": "nTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "NTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "nTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "NTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "nTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "NTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "15", "chr_pos": "42272084", "evidence": [ { "id": "rs750301944", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750301944" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "nTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "NTTIFLK", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "15", "chr_pos": "42272084", "evidence": [ { "id": "rs750301944", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750301944" }, { "id": "rs750301944", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750301944" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBN3-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1854", "url": "https://glyconnect.expasy.org/browser/proteins/1854" } ], "protein_name": "Transmembrane protein 87A", "gene_name": "TMEM87A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 555, "chemical_mass": 63430.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "TGVCPELQADQnCTQECVSDSECADNLK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14508-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "1902", "url": "https://glyconnect.expasy.org/browser/proteins/1902" } ], "protein_name": "WAP four-disulfide core domain protein 2", "gene_name": "WFDC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 124, "chemical_mass": 12993.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "518", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "WFSAGLASnSSWLR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "WFSAGLASnSSWLR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "WFSAGLASnSSWLR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "", "site_lbl": "N51", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "N", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "WFSAGLASnSSWLR", "site_lbl": "Asn51", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "51", "site_seq": "", "site_lbl": "N51", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "9", "chr_pos": "136979030", "evidence": [ { "id": "rs754669790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754669790" }, { "id": "rs754669790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754669790#frequency_tab" }, { "id": "rs754669790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754669790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 51, "end_pos": 51, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "83", "site_seq": "AnLTNFPENGTFVVNIAQLSQDDSGR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "AnLTNFPENGTFVVNIAQLSQDDSGR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "AnLTNFPENGTFVVNIAQLSQDDSGR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "1", "chr_pos": "206939258", "evidence": [ { "id": "rs765015616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765015616" }, { "id": "rs765015616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765015616" }, { "id": "rs765015616", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765015616#frequency_tab" }, { "id": "rs765015616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765015616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "", "site_lbl": "N90", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "206939238", "evidence": [ { "id": "rs1293700693", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1293700693" }, { "id": "rs1293700693", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1293700693" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "AnLTNFPENGTFVVNIAQLSQDDSGR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "N", "site_lbl": "Asn90", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "1", "chr_pos": "206939258", "evidence": [ { "id": "rs765015616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765015616" }, { "id": "rs765015616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765015616" }, { "id": "rs765015616", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765015616#frequency_tab" }, { "id": "rs765015616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765015616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "90", "site_seq": "", "site_lbl": "N90", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "206939238", "evidence": [ { "id": "rs1293700693", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1293700693" }, { "id": "rs1293700693", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1293700693" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 90, "end_pos": 90, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" }, { "database": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "195", "site_seq": "N", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "VNFSCLAELDLR", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "N", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "VNFSCLAELDLR", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "N", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "VNFSCLAELDLR", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "N", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "195", "site_seq": "VNFSCLAELDLR", "site_lbl": "Asn195", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q60625-1", "start_pos": 195, "end_pos": 195, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2409", "url": "https://glyconnect.expasy.org/browser/proteins/2409" } ], "protein_name": "Intercellular adhesion molecule 5", "gene_name": "Icam5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 917, "chemical_mass": 96946.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35495-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "360", "url": "https://glyconnect.expasy.org/browser/proteins/360" } ], "protein_name": "Major seminal plasma glycoprotein PSP-I", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 133, "chemical_mass": 14501.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35495-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "360", "url": "https://glyconnect.expasy.org/browser/proteins/360" } ], "protein_name": "Major seminal plasma glycoprotein PSP-I", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 133, "chemical_mass": 14501.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35495-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "360", "url": "https://glyconnect.expasy.org/browser/proteins/360" } ], "protein_name": "Major seminal plasma glycoprotein PSP-I", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 133, "chemical_mass": 14501.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35495-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "360", "url": "https://glyconnect.expasy.org/browser/proteins/360" } ], "protein_name": "Major seminal plasma glycoprotein PSP-I", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 133, "chemical_mass": 14501.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35496-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "361", "url": "https://glyconnect.expasy.org/browser/proteins/361" } ], "protein_name": "Major seminal plasma glycoprotein PSP-II", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 137, "chemical_mass": 14816.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35496-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "361", "url": "https://glyconnect.expasy.org/browser/proteins/361" } ], "protein_name": "Major seminal plasma glycoprotein PSP-II", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 137, "chemical_mass": 14816.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35496-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "361", "url": "https://glyconnect.expasy.org/browser/proteins/361" } ], "protein_name": "Major seminal plasma glycoprotein PSP-II", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 137, "chemical_mass": 14816.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35496-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "10504403", "url": "https://glygen.org/publication/PubMed/10504403" }, { "database": "GlyConnect", "id": "361", "url": "https://glyconnect.expasy.org/browser/proteins/361" } ], "protein_name": "Major seminal plasma glycoprotein PSP-II", "gene_name": "", "tax_id": 9823, "tax_name": "Sus scrofa", "tax_common_name": "Pig", "length": 137, "chemical_mass": 14816.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] } ], "record_id": "G08110WX" }