{ "glytoucan_ac": "G05609XV", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 2749.97, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Truncated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 7, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 5, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 2, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "2868", "site_seq": "QEGILYVDGASnR", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASNRTISPK", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "N", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASnR", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASNRTISPK", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "N", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASnR", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASNRTISPK", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "N", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "", "site_lbl": "N2868", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "129505255", "evidence": [ { "id": "P24043", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24043" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->nullRT).", "chr_id": "6", "chr_pos": "129505255", "evidence": [ { "id": "rs2533549889", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2533549889" } ], "disease": [ { "disease_id": "DOID:0110636", "name": "congenital merosin-deficient muscular dystrophy 1A", "description": "A congenital muscular dystrophy characterized by autosomal recessive inheritance of muscle weakness that is apparent at birth or in the first 6 months of life and frequent development of periventricular white matter abnormalities that has_material_basis_in homozygous or compound heterozygous mutation in the LAMA2 gene on chromosome 6q22.", "url": "http://disease-ontology.org/term/DOID:0110636", "evidence": [ { "id": "607855", "database": "MIM", "url": "https://www.omim.org/entry/607855" }, { "id": "0110636", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110636" } ] }, { "disease_id": "DOID:0061132", "name": "autosomal recessive limb-girdle muscular dystrophy type 23", "description": "An autosomal recessive limb-girdle muscular dystrophy characterized by slowly progressive proximal muscle weakness primarily affecting the lower limbs and resulting in gait difficulties that has_material_basis_in y homozygous or compound heterozygous mutation in the LAMA2 gene on chromosome 6q22.", "url": "http://disease-ontology.org/term/DOID:0061132", "evidence": [ { "id": "618138", "database": "MIM", "url": "https://www.omim.org/entry/618138" }, { "id": "0061132", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0061132" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASnR", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "QEGILYVDGASNRTISPK", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "N", "site_lbl": "Asn2868", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "2868", "site_seq": "", "site_lbl": "N2868", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "129505255", "evidence": [ { "id": "P24043", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24043" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->nullRT).", "chr_id": "6", "chr_pos": "129505255", "evidence": [ { "id": "rs2533549889", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2533549889" } ], "disease": [ { "disease_id": "DOID:0110636", "name": "congenital merosin-deficient muscular dystrophy 1A", "description": "A congenital muscular dystrophy characterized by autosomal recessive inheritance of muscle weakness that is apparent at birth or in the first 6 months of life and frequent development of periventricular white matter abnormalities that has_material_basis_in homozygous or compound heterozygous mutation in the LAMA2 gene on chromosome 6q22.", "url": "http://disease-ontology.org/term/DOID:0110636", "evidence": [ { "id": "607855", "database": "MIM", "url": "https://www.omim.org/entry/607855" }, { "id": "0110636", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110636" } ] }, { "disease_id": "DOID:0061132", "name": "autosomal recessive limb-girdle muscular dystrophy type 23", "description": "An autosomal recessive limb-girdle muscular dystrophy characterized by slowly progressive proximal muscle weakness primarily affecting the lower limbs and resulting in gait difficulties that has_material_basis_in y homozygous or compound heterozygous mutation in the LAMA2 gene on chromosome 6q22.", "url": "http://disease-ontology.org/term/DOID:0061132", "evidence": [ { "id": "618138", "database": "MIM", "url": "https://www.omim.org/entry/618138" }, { "id": "0061132", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0061132" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 2868, "end_pos": 2868, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "133", "site_seq": "FNPNISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPnISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPNISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPnISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPNISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPnISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "11", "chr_pos": "47245734", "evidence": [ { "id": "rs753770611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753770611#frequency_tab" }, { "id": "rs753770611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753770611" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "11", "chr_pos": "47245734", "evidence": [ { "id": "rs753770611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753770611#frequency_tab" }, { "id": "rs753770611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753770611" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPNISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "FNPnISWQPIPVHTVPITEDR", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "11", "chr_pos": "47245734", "evidence": [ { "id": "rs753770611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753770611#frequency_tab" }, { "id": "rs753770611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753770611" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "11", "chr_pos": "47245734", "evidence": [ { "id": "rs753770611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753770611" }, { "id": "rs753770611", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753770611#frequency_tab" }, { "id": "rs753770611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753770611" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11117-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "ACP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 48344.0 } ] }, { "start_pos": "355", "site_seq": "PEPPQLVLAYDYSREVNTTEELEALITDPDEMR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "355", "site_seq": "PEPPQLVLAYDYSREVNTTEELEALITDPDEMR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "355", "site_seq": "PEPPQLVLAYDYSREVNTTEELEALITDPDEMR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "355", "site_seq": "", "site_lbl": "N355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "19", "chr_pos": "4792917", "evidence": [ { "id": "rs2093556336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093556336" }, { "id": "rs2093556336", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2093556336" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "19", "chr_pos": "4792918", "evidence": [ { "id": "Q9BSK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BSK4" }, { "id": "rs2093556338", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093556338" }, { "id": "rs2093556338", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2093556338" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "355", "site_seq": "PEPPQLVLAYDYSREVNTTEELEALITDPDEMR", "site_lbl": "Asn355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "355", "site_seq": "", "site_lbl": "N355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "19", "chr_pos": "4792917", "evidence": [ { "id": "rs2093556336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093556336" }, { "id": "rs2093556336", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2093556336" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "19", "chr_pos": "4792918", "evidence": [ { "id": "Q9BSK4", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BSK4" }, { "id": "rs2093556338", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2093556338" }, { "id": "rs2093556338", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2093556338" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BSK4-1", "start_pos": 355, "end_pos": 355, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 669, "chemical_mass": 73639.0 } ] }, { "start_pos": "98", "site_seq": "ANCSGRYELAGLPGK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "ANCSGRYELAGLPGK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "ANCSGRYELAGLPGK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "ANCSGRYELAGLPGK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C419-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glycine receptor", "gene_name": "Gpr158", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1200, "chemical_mass": 134426.0 } ] }, { "start_pos": "975", "site_seq": "LSGPSNSSMEDFTKR", "site_lbl": "Asn975", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PW37-1", "start_pos": 975, "end_pos": 975, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "RAS protein activator like 2", "gene_name": "Rasal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1286, "chemical_mass": 144587.0 } ] }, { "start_pos": "975", "site_seq": "LSGPSNSSMEDFTKR", "site_lbl": "Asn975", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PW37-1", "start_pos": 975, "end_pos": 975, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "RAS protein activator like 2", "gene_name": "Rasal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1286, "chemical_mass": 144587.0 } ] }, { "start_pos": "975", "site_seq": "LSGPSNSSMEDFTKR", "site_lbl": "Asn975", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PW37-1", "start_pos": 975, "end_pos": 975, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "RAS protein activator like 2", "gene_name": "Rasal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1286, "chemical_mass": 144587.0 } ] }, { "start_pos": "975", "site_seq": "LSGPSNSSMEDFTKR", "site_lbl": "Asn975", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "E9PW37-1", "start_pos": 975, "end_pos": 975, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "RAS protein activator like 2", "gene_name": "Rasal2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1286, "chemical_mass": 144587.0 } ] }, { "start_pos": "187", "site_seq": "LVNTNENLSK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88384-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vesicle transport through interaction with t-SNAREs homolog 1B", "gene_name": "Vti1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 232, "chemical_mass": 26713.0 } ] }, { "start_pos": "187", "site_seq": "LVNTNENLSK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88384-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vesicle transport through interaction with t-SNAREs homolog 1B", "gene_name": "Vti1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 232, "chemical_mass": 26713.0 } ] }, { "start_pos": "187", "site_seq": "LVNTNENLSK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88384-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vesicle transport through interaction with t-SNAREs homolog 1B", "gene_name": "Vti1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 232, "chemical_mass": 26713.0 } ] }, { "start_pos": "187", "site_seq": "LVNTNENLSK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O88384-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vesicle transport through interaction with t-SNAREs homolog 1B", "gene_name": "Vti1b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 232, "chemical_mass": 26713.0 } ] }, { "start_pos": "331", "site_seq": "SNAEFVIHSGFFFDNNSHDR", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WC0-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 594, "chemical_mass": 67176.0 } ] }, { "start_pos": "331", "site_seq": "SNAEFVIHSGFFFDNNSHDR", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WC0-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 594, "chemical_mass": 67176.0 } ] }, { "start_pos": "331", "site_seq": "SNAEFVIHSGFFFDNNSHDR", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WC0-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 594, "chemical_mass": 67176.0 } ] }, { "start_pos": "331", "site_seq": "SNAEFVIHSGFFFDNNSHDR", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91WC0-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 594, "chemical_mass": 67176.0 } ] } ], "record_id": "G05609XV" }