{ "glytoucan_ac": "G04854VP", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G04670NE", "url": "https://www.glygen.org/glycan/G04670NE" }, { "database": "Subsumption", "id": "G76329HL", "url": "https://www.glygen.org/glycan/G76329HL" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G76329HL", "url": "https://www.glygen.org/glycan/G76329HL" }, { "database": "Subsumption", "id": "G13484HA", "url": "https://www.glygen.org/glycan/G13484HA" }, { "database": "Subsumption", "id": "G61278VW", "url": "https://www.glygen.org/glycan/G61278VW" }, { "database": "Subsumption", "id": "G65186SE", "url": "https://www.glygen.org/glycan/G65186SE" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G76329HL", "url": "https://www.glygen.org/glycan/G76329HL" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G76329HL", "url": "https://www.glygen.org/glycan/G76329HL" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 2452.91, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 8, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "118", "site_seq": "GSVALVIHNVTAQENGIYR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "GSVALVIHNVTAQENGIYR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "GSVALVIHNVTAQENGIYR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "6", "chr_pos": "26385273", "evidence": [ { "id": "Q8WVV5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8WVV5" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "GSVALVIHNVTAQENGIYR", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "6", "chr_pos": "26385273", "evidence": [ { "id": "Q8WVV5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8WVV5" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8WVV5-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 59070.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVnNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVNNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "HGEnYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "KHGENYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVnNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVNNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "HGEnYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "KHGENYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVnNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVNNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "HGEnYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "KHGENYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "12", "chr_pos": "64747838", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" }, { "id": "rs1199190795", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199190795" }, { "id": "rs1199190795", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1199190795#frequency_tab" }, { "id": "rs1199190795", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1199190795" }, { "id": "rs1199190795", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1199190795" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "12", "chr_pos": "64744840", "evidence": [ { "id": "rs1869850356", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869850356" }, { "id": "rs1869850356", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1869850356#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVnNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "YPHNHHVVNNTLEGNCSSK", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "HGEnYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "KHGENYSVDYLTDVLANVSLDFLDYK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "111", "site_seq": "", "site_lbl": "N111", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "12", "chr_pos": "64747838", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" }, { "id": "rs1199190795", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199190795" }, { "id": "rs1199190795", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1199190795#frequency_tab" }, { "id": "rs1199190795", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1199190795" }, { "id": "rs1199190795", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1199190795" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3.", "url": "http://disease-ontology.org/term/DOID:0111402", "evidence": [ { "id": "0009658", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658" }, { "id": "252940", "database": "MIM", "url": "https://www.omim.org/entry/252940" }, { "id": "2799", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2799#disease" }, { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "12", "chr_pos": "64744840", "evidence": [ { "id": "rs1869850356", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869850356" }, { "id": "rs1869850356", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1869850356#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "226", "site_seq": "PSESVSGANSSAVLPSVKSPSVTSSQAMLAKGTNTSSNQSK", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6N043-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger protein 280D", "gene_name": "ZNF280D", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 109285.0 } ] }, { "start_pos": "226", "site_seq": "PSESVSGANSSAVLPSVKSPSVTSSQAMLAKGTNTSSNQSK", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6N043-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger protein 280D", "gene_name": "ZNF280D", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 109285.0 } ] }, { "start_pos": "226", "site_seq": "PSESVSGANSSAVLPSVKSPSVTSSQAMLAKGTNTSSNQSK", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6N043-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger protein 280D", "gene_name": "ZNF280D", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 109285.0 } ] }, { "start_pos": "226", "site_seq": "PSESVSGANSSAVLPSVKSPSVTSSQAMLAKGTNTSSNQSK", "site_lbl": "Asn226", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6N043-1", "start_pos": 226, "end_pos": 226, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger protein 280D", "gene_name": "ZNF280D", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 979, "chemical_mass": 109285.0 } ] }, { "start_pos": "106", "site_seq": "SPNLSKHDFLGQVFCTLGEIVGSQGSR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "106", "site_seq": "SPNLSKHDFLGQVFCTLGEIVGSQGSR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "106", "site_seq": "SPNLSKHDFLGQVFCTLGEIVGSQGSR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->ILS).", "chr_id": "12", "chr_pos": "38839929", "evidence": [ { "id": "Q86YQ8", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86YQ8" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "12", "chr_pos": "38839929", "evidence": [ { "id": "rs754910633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754910633" }, { "id": "rs754910633", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754910633" }, { "id": "rs754910633", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754910633" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "106", "site_seq": "SPNLSKHDFLGQVFCTLGEIVGSQGSR", "site_lbl": "Asn106", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "106", "site_seq": "", "site_lbl": "N106", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->ILS).", "chr_id": "12", "chr_pos": "38839929", "evidence": [ { "id": "Q86YQ8", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86YQ8" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "12", "chr_pos": "38839929", "evidence": [ { "id": "rs754910633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754910633" }, { "id": "rs754910633", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754910633" }, { "id": "rs754910633", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754910633" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86YQ8-1", "start_pos": 106, "end_pos": 106, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Copine-8", "gene_name": "CPNE8", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 564, "chemical_mass": 63108.0 } ] }, { "start_pos": "178", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "EEVKPVGDPGGNATEVSVTTAMTTMSENK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 523, "chemical_mass": 56694.0 } ] }, { "start_pos": "246", "site_seq": "RPQTEAITHPVTGLILNTSTVTLPPTGNVTR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CBH5-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Major facilitator superfamily domain-containing protein 6", "gene_name": "Mfsd6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 86076.0 } ] }, { "start_pos": "246", "site_seq": "RPQTEAITHPVTGLILNTSTVTLPPTGNVTR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CBH5-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Major facilitator superfamily domain-containing protein 6", "gene_name": "Mfsd6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 86076.0 } ] }, { "start_pos": "246", "site_seq": "RPQTEAITHPVTGLILNTSTVTLPPTGNVTR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CBH5-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Major facilitator superfamily domain-containing protein 6", "gene_name": "Mfsd6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 86076.0 } ] }, { "start_pos": "246", "site_seq": "RPQTEAITHPVTGLILNTSTVTLPPTGNVTR", "site_lbl": "Asn246", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8CBH5-1", "start_pos": 246, "end_pos": 246, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Major facilitator superfamily domain-containing protein 6", "gene_name": "Mfsd6", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 775, "chemical_mass": 86076.0 } ] }, { "start_pos": "364", "site_seq": "PLQFLDASSNTGNNSFFLK", "site_lbl": "Asn364", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TQA1-1", "start_pos": 364, "end_pos": 364, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily member 1", "gene_name": "Igsf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1317, "chemical_mass": 147010.0 } ] }, { "start_pos": "364", "site_seq": "PLQFLDASSNTGNNSFFLK", "site_lbl": "Asn364", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TQA1-1", "start_pos": 364, "end_pos": 364, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily member 1", "gene_name": "Igsf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1317, "chemical_mass": 147010.0 } ] }, { "start_pos": "364", "site_seq": "PLQFLDASSNTGNNSFFLK", "site_lbl": "Asn364", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TQA1-1", "start_pos": 364, "end_pos": 364, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily member 1", "gene_name": "Igsf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1317, "chemical_mass": 147010.0 } ] }, { "start_pos": "364", "site_seq": "PLQFLDASSNTGNNSFFLK", "site_lbl": "Asn364", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7TQA1-1", "start_pos": 364, "end_pos": 364, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Immunoglobulin superfamily member 1", "gene_name": "Igsf1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1317, "chemical_mass": 147010.0 } ] }, { "start_pos": "432", "site_seq": "ILVATDAIGMGLNLSIR", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YD1-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-dependent RNA helicase SUPV3L1, mitochondrial", "gene_name": "Supv3l1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 779, "chemical_mass": 87005.0 } ] }, { "start_pos": "432", "site_seq": "ILVATDAIGMGLNLSIR", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YD1-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-dependent RNA helicase SUPV3L1, mitochondrial", "gene_name": "Supv3l1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 779, "chemical_mass": 87005.0 } ] }, { "start_pos": "432", "site_seq": "ILVATDAIGMGLNLSIR", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YD1-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-dependent RNA helicase SUPV3L1, mitochondrial", "gene_name": "Supv3l1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 779, "chemical_mass": 87005.0 } ] }, { "start_pos": "432", "site_seq": "ILVATDAIGMGLNLSIR", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q80YD1-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "ATP-dependent RNA helicase SUPV3L1, mitochondrial", "gene_name": "Supv3l1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 779, "chemical_mass": 87005.0 } ] }, { "start_pos": "334", "site_seq": "INGTVTENMSLTDAR", "site_lbl": "Asn334", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0U1-1", "start_pos": 334, "end_pos": 334, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tight junction protein 2", "gene_name": "Tjp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 131280.0 } ] }, { "start_pos": "334", "site_seq": "INGTVTENMSLTDAR", "site_lbl": "Asn334", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0U1-1", "start_pos": 334, "end_pos": 334, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tight junction protein 2", "gene_name": "Tjp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 131280.0 } ] }, { "start_pos": "334", "site_seq": "INGTVTENMSLTDAR", "site_lbl": "Asn334", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0U1-1", "start_pos": 334, "end_pos": 334, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tight junction protein 2", "gene_name": "Tjp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 131280.0 } ] }, { "start_pos": "334", "site_seq": "INGTVTENMSLTDAR", "site_lbl": "Asn334", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Z0U1-1", "start_pos": 334, "end_pos": 334, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Tight junction protein 2", "gene_name": "Tjp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1167, "chemical_mass": 131280.0 } ] }, { "start_pos": "81", "site_seq": "TVSLNNLSADEVTR", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQ75-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2", "gene_name": "Ndufa2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 99, "chemical_mass": 10916.0 } ] }, { "start_pos": "81", "site_seq": "TVSLNNLSADEVTR", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQ75-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2", "gene_name": "Ndufa2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 99, "chemical_mass": 10916.0 } ] }, { "start_pos": "81", "site_seq": "TVSLNNLSADEVTR", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQ75-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2", "gene_name": "Ndufa2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 99, "chemical_mass": 10916.0 } ] }, { "start_pos": "81", "site_seq": "TVSLNNLSADEVTR", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQ75-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2", "gene_name": "Ndufa2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 99, "chemical_mass": 10916.0 } ] }, { "start_pos": "102", "site_seq": "EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYJ0-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 45746.0 } ] }, { "start_pos": "102", "site_seq": "EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYJ0-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 45746.0 } ] }, { "start_pos": "102", "site_seq": "EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYJ0-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 45746.0 } ] }, { "start_pos": "102", "site_seq": "EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR", "site_lbl": "Asn102", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYJ0-1", "start_pos": 102, "end_pos": 102, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 412, "chemical_mass": 45746.0 } ] }, { "start_pos": "274", "site_seq": "PEDLAGLTALQELDVSNLSLQALPSDLSSLFPRLRLLAAAR", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "PEDLAGLTALQELDVSNLSLQALPSDLSSLFPRLRLLAAAR", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "PEDLAGLTALQELDVSNLSLQALPSDLSSLFPRLRLLAAAR", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "PEDLAGLTALQELDVSNLSLQALPSDLSSLFPRLRLLAAAR", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "274", "site_seq": "N", "site_lbl": "Asn274", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CZT5-1", "start_pos": 274, "end_pos": 274, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Vasorin", "gene_name": "Vasn", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 673, "chemical_mass": 72261.0 } ] }, { "start_pos": "949", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "N", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "N", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "N", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "N", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "N", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "N", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "949", "site_seq": "N", "site_lbl": "Asn949", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 949, "end_pos": 949, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "CIQPLHNNTTR", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "950", "site_seq": "N", "site_lbl": "Asn950", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8C9W3-1", "start_pos": 950, "end_pos": 950, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 2", "gene_name": "Adamts2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1213, "chemical_mass": 135299.0 } ] }, { "start_pos": "403", "site_seq": "NASTGNQSYMVEDLKPGTSYHFEIIPR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "NASTGNQSYMVEDLKPGTSYHFEIIPR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "NASTGNQSYMVEDLKPGTSYHFEIIPR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "NASTGNQSYMVEDLKPGTSYHFEIIPR", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "403", "site_seq": "N", "site_lbl": "Asn403", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q64455-1", "start_pos": 403, "end_pos": 403, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase eta", "gene_name": "Ptprj", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1238, "chemical_mass": 136769.0 } ] }, { "start_pos": "254", "site_seq": "IFLYSGEPIYLGNETSIFGPK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "IFLYSGEPIYLGNETSIFGPK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "IFLYSGEPIYLGNETSIFGPK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "IFLYSGEPIYLGNETSIFGPK", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "254", "site_seq": "N", "site_lbl": "Asn254", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q3UMW8-1", "start_pos": 254, "end_pos": 254, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Bis(monoacylglycero)phosphate synthase CLN5", "gene_name": "Cln5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 341, "chemical_mass": 39329.0 } ] }, { "start_pos": "1489", "site_seq": "NNAQTMPGEVNSTLGTAAYMAPEVITR", "site_lbl": "Asn1489", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08648-1", "start_pos": 1489, "end_pos": 1489, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "Map3k4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1597, "chemical_mass": 179834.0 } ] }, { "start_pos": "1489", "site_seq": "NNAQTMPGEVNSTLGTAAYMAPEVITR", "site_lbl": "Asn1489", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08648-1", "start_pos": 1489, "end_pos": 1489, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "Map3k4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1597, "chemical_mass": 179834.0 } ] }, { "start_pos": "1489", "site_seq": "NNAQTMPGEVNSTLGTAAYMAPEVITR", "site_lbl": "Asn1489", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08648-1", "start_pos": 1489, "end_pos": 1489, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "Map3k4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1597, "chemical_mass": 179834.0 } ] }, { "start_pos": "1489", "site_seq": "NNAQTMPGEVNSTLGTAAYMAPEVITR", "site_lbl": "Asn1489", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O08648-1", "start_pos": 1489, "end_pos": 1489, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "Map3k4", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1597, "chemical_mass": 179834.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVEnETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVENETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVEnETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVENETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVEnETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVENETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "207124323", "evidence": [ { "id": "P04003", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04003" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVEnETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "FSLLGHASISCTVENETIGVWRPSPPTCEK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "207124323", "evidence": [ { "id": "P04003", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04003" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04003-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 597, "chemical_mass": 67033.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "3", "chr_pos": "149210360", "evidence": [ { "id": "rs757785679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757785679#frequency_tab" }, { "id": "rs757785679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757785679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "3", "chr_pos": "149206185", "evidence": [ { "id": "rs146229133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs146229133" }, { "id": "rs146229133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146229133#frequency_tab" }, { "id": "rs146229133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146229133" } ], "disease": [ { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "3", "chr_pos": "149210360", "evidence": [ { "id": "rs757785679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757785679#frequency_tab" }, { "id": "rs757785679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757785679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "3", "chr_pos": "149206185", "evidence": [ { "id": "rs146229133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs146229133" }, { "id": "rs146229133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146229133#frequency_tab" }, { "id": "rs146229133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146229133" } ], "disease": [ { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "185", "site_seq": "MYHInETR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "185", "site_seq": "MYHInETR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "185", "site_seq": "MYHInETR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "185", "site_seq": "", "site_lbl": "N185", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "11", "chr_pos": "70104012", "evidence": [ { "id": "rs767247517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767247517" }, { "id": "rs767247517", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767247517" }, { "id": "rs767247517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767247517" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "185", "site_seq": "MYHInETR", "site_lbl": "Asn185", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "185", "site_seq": "", "site_lbl": "N185", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "11", "chr_pos": "70104012", "evidence": [ { "id": "rs767247517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767247517" }, { "id": "rs767247517", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767247517" }, { "id": "rs767247517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767247517" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5XXA6-1", "start_pos": 185, "end_pos": 185, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 986, "chemical_mass": 114078.0 } ] }, { "start_pos": "139", "site_seq": "EVSFLnCSLDNGGCTHYCLEEVGWR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "EVFVHPnYSK", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "EVSFLnCSLDNGGCTHYCLEEVGWR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "EVFVHPnYSK", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "EVSFLnCSLDNGGCTHYCLEEVGWR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "EVFVHPnYSK", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "", "site_lbl": "N139", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "2", "chr_pos": "127423288", "evidence": [ { "id": "rs780527584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780527584#frequency_tab" }, { "id": "rs780527584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780527584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->HCS).", "chr_id": "2", "chr_pos": "127423288", "evidence": [ { "id": "rs780527584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780527584#frequency_tab" }, { "id": "rs780527584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780527584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "2", "chr_pos": "127423289", "evidence": [ { "id": "rs950862727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs950862727" }, { "id": "rs950862727", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs950862727#frequency_tab" }, { "id": "rs950862727", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs950862727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "", "site_lbl": "N290", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "2", "chr_pos": "127428428", "evidence": [ { "id": "rs1178818583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1178818583" }, { "id": "rs1178818583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1178818583#frequency_tab" }, { "id": "rs1178818583", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1178818583" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "2", "chr_pos": "127428429", "evidence": [ { "id": "rs1558717703", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1558717703" }, { "id": "rs1558717703", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1558717703" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "EVSFLnCSLDNGGCTHYCLEEVGWR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "N", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "EVFVHPnYSK", "site_lbl": "Asn290", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "139", "site_seq": "", "site_lbl": "N139", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "2", "chr_pos": "127423288", "evidence": [ { "id": "rs780527584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780527584#frequency_tab" }, { "id": "rs780527584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780527584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->HCS).", "chr_id": "2", "chr_pos": "127423288", "evidence": [ { "id": "rs780527584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584" }, { "id": "rs780527584", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780527584#frequency_tab" }, { "id": "rs780527584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780527584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "2", "chr_pos": "127423289", "evidence": [ { "id": "rs950862727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs950862727" }, { "id": "rs950862727", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs950862727#frequency_tab" }, { "id": "rs950862727", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs950862727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "290", "site_seq": "", "site_lbl": "N290", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "2", "chr_pos": "127428428", "evidence": [ { "id": "rs1178818583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1178818583" }, { "id": "rs1178818583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1178818583#frequency_tab" }, { "id": "rs1178818583", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1178818583" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "2", "chr_pos": "127428429", "evidence": [ { "id": "rs1558717703", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1558717703" }, { "id": "rs1558717703", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1558717703" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04070-1", "start_pos": 290, "end_pos": 290, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 461, "chemical_mass": 52071.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "NEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "WFYIASAFRNEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "NEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "WFYIASAFRNEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "NEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "WFYIASAFRNEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "", "site_lbl": "N56", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->HKS).", "chr_id": "9", "chr_pos": "114323714", "evidence": [ { "id": "rs1829721324", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829721324" }, { "id": "rs1829721324", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1829721324#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "9", "chr_pos": "114323716", "evidence": [ { "id": "rs1333212608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333212608" }, { "id": "rs1333212608", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1333212608#frequency_tab" }, { "id": "rs1333212608", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1333212608" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "9", "chr_pos": "114323715", "evidence": [ { "id": "rs775749216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775749216" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "N", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "NEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "WFYIASAFRNEEYnK", "site_lbl": "Asn56", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "56", "site_seq": "", "site_lbl": "N56", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->HKS).", "chr_id": "9", "chr_pos": "114323714", "evidence": [ { "id": "rs1829721324", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829721324" }, { "id": "rs1829721324", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1829721324#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "9", "chr_pos": "114323716", "evidence": [ { "id": "rs1333212608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333212608" }, { "id": "rs1333212608", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1333212608#frequency_tab" }, { "id": "rs1333212608", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1333212608" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "9", "chr_pos": "114323715", "evidence": [ { "id": "rs775749216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775749216" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 56, "end_pos": 56, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "", "site_lbl": "N207", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "16", "chr_pos": "72060289", "evidence": [ { "id": "rs761396788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761396788#frequency_tab" }, { "id": "rs761396788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761396788" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "N", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "NLFLnHSENATAK", "site_lbl": "Asn207", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "207", "site_seq": "", "site_lbl": "N207", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "16", "chr_pos": "72060289", "evidence": [ { "id": "rs761396788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761396788" }, { "id": "rs761396788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761396788#frequency_tab" }, { "id": "rs761396788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761396788" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 207, "end_pos": 207, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "173911863", "evidence": [ { "id": "rs1657783494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657783494" }, { "id": "rs1657783494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657783494#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "173911863", "evidence": [ { "id": "rs1657783494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657783494" }, { "id": "rs1657783494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657783494#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "GVTSVSQIFHSPDLAIRDTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVNASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "VGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "AKVGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "GVTSVSQIFHSPDLAIRDTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVNASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "VGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "AKVGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "GVTSVSQIFHSPDLAIRDTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVNASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "VGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "AKVGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "", "site_lbl": "N238", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->nullAS).", "chr_id": "11", "chr_pos": "57606037", "evidence": [ { "id": "rs2495440431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2495440431" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "", "site_lbl": "N352", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "11", "chr_pos": "57611742", "evidence": [ { "id": "rs776553402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776553402" }, { "id": "rs776553402", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776553402" }, { "id": "rs776553402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776553402" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "GVTSVSQIFHSPDLAIRDTFVnASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "DTFVNASR", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "N", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "VGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "AKVGQLQLSHnLSLVILVPQNLK", "site_lbl": "Asn352", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "238", "site_seq": "", "site_lbl": "N238", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->nullAS).", "chr_id": "11", "chr_pos": "57606037", "evidence": [ { "id": "rs2495440431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2495440431" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 238, "end_pos": 238, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "352", "site_seq": "", "site_lbl": "N352", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "11", "chr_pos": "57611742", "evidence": [ { "id": "rs776553402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776553402" }, { "id": "rs776553402", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776553402" }, { "id": "rs776553402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776553402" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 352, "end_pos": 352, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "NVIFSPLSISTALAFLSLGAHnTTLTEILK", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "NVIFSPLSISTALAFLSLGAHnTTLTEILK", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "NVIFSPLSISTALAFLSLGAHnTTLTEILK", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "14", "chr_pos": "94614821", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" }, { "id": "rs145819878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145819878#frequency_tab" }, { "id": "rs145819878", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145819878" }, { "id": "rs145819878", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145819878" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "14", "chr_pos": "94614718", "evidence": [ { "id": "rs542942614", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs542942614" }, { "id": "rs542942614", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs542942614" }, { "id": "rs542942614", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs542942614" }, { "id": "rs542942614", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs542942614#frequency_tab" }, { "id": "rs542942614", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs542942614" }, { "id": "rs542942614", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs542942614" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "14", "chr_pos": "94614718", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "14", "chr_pos": "94614720", "evidence": [ { "id": "rs1031881430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1031881430" }, { "id": "rs1031881430", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1031881430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "NVIFSPLSISTALAFLSLGAHnTTLTEILK", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "14", "chr_pos": "94614821", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" }, { "id": "rs145819878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145819878#frequency_tab" }, { "id": "rs145819878", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145819878" }, { "id": "rs145819878", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145819878" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "14", "chr_pos": "94614718", "evidence": [ { "id": "rs542942614", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs542942614" }, { "id": "rs542942614", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs542942614" }, { "id": "rs542942614", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs542942614" }, { "id": "rs542942614", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs542942614#frequency_tab" }, { "id": "rs542942614", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs542942614" }, { "id": "rs542942614", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs542942614" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "14", "chr_pos": "94614718", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "14", "chr_pos": "94614720", "evidence": [ { "id": "rs1031881430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1031881430" }, { "id": "rs1031881430", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1031881430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "LQNNENnISCVER", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "LQNNENnISCVER", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "LQNNENnISCVER", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "", "site_lbl": "N126", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "NC_000001.11", "chr_pos": "196826952", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "N", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "LQNNENnISCVER", "site_lbl": "Asn126", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "126", "site_seq": "", "site_lbl": "N126", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "NC_000001.11", "chr_pos": "196826952", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q03591-1", "start_pos": 126, "end_pos": 126, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37651.0 } ] }, { "start_pos": "265", "site_seq": "GPSTPLPEDPNWnVTEFHTTPK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "GPSTPLPEDPNWnVTEFHTTPK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "GPSTPLPEDPNWnVTEFHTTPK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT); n-glyco-sequon-gain (NWN->NWS).", "chr_id": "15", "chr_pos": "89805181", "evidence": [ { "id": "rs2141810244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2141810244" }, { "id": "rs2141810244", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2141810244" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "GPSTPLPEDPNWnVTEFHTTPK", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT); n-glyco-sequon-gain (NWN->NWS).", "chr_id": "15", "chr_pos": "89805181", "evidence": [ { "id": "rs2141810244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2141810244" }, { "id": "rs2141810244", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2141810244" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "GFGVAIVGnYTAALPTEAALR", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "LYHFLLGAWSLnATELDPCPLSPELLGLTK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "GFGVAIVGnYTAALPTEAALR", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "LYHFLLGAWSLnATELDPCPLSPELLGLTK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "GFGVAIVGnYTAALPTEAALR", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "LYHFLLGAWSLnATELDPCPLSPELLGLTK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "", "site_lbl": "N77", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15476441", "evidence": [ { "id": "rs1457765600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457765600" }, { "id": "rs1457765600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457765600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "15476440", "evidence": [ { "id": "Q96PD5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q96PD5" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "N", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "485", "site_seq": "GFGVAIVGnYTAALPTEAALR", "site_lbl": "Asn485", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 485, "end_pos": 485, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "N", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "LYHFLLGAWSLnATELDPCPLSPELLGLTK", "site_lbl": "Asn77", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "77", "site_seq": "", "site_lbl": "N77", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15476441", "evidence": [ { "id": "rs1457765600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457765600" }, { "id": "rs1457765600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457765600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "15476440", "evidence": [ { "id": "Q96PD5", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q96PD5" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 77, "end_pos": 77, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "468", "site_seq": "DGVSAAVVVAEMASYLETMnITLK", "site_lbl": "Asn468", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "DGVSAAVVVAEMASYLETMnITLK", "site_lbl": "Asn468", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "DGVSAAVVVAEMASYLETMnITLK", "site_lbl": "Asn468", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "", "site_lbl": "N468", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "DGVSAAVVVAEMASYLETMnITLK", "site_lbl": "Asn468", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "468", "site_seq": "", "site_lbl": "N468", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "11", "chr_pos": "74342924", "evidence": [ { "id": "rs1393550539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393550539" }, { "id": "rs1393550539", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1393550539#frequency_tab" }, { "id": "rs1393550539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393550539" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6PCE3-1", "start_pos": 468, "end_pos": 468, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glucose 1,6-bisphosphate synthase", "gene_name": "PGM2L1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70442.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HnSTGCLR", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HNSTGCLRMK", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HnSTGCLR", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HNSTGCLRMK", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HnSTGCLR", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HNSTGCLRMK", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "8", "chr_pos": "27605318", "evidence": [ { "id": "rs1343749062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1343749062" }, { "id": "rs1343749062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1343749062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HnSTGCLR", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "HNSTGCLRMK", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "8", "chr_pos": "27605318", "evidence": [ { "id": "rs1343749062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1343749062" }, { "id": "rs1343749062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1343749062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-103.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "291", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-354 and Q-374. Decreases secretion; when associated with Q-354 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "7", "chr_pos": "99968386", "evidence": [ { "id": "rs191613328", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" }, { "id": "rs191613328", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191613328" }, { "id": "rs191613328", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "7", "chr_pos": "99968384", "evidence": [ { "id": "rs8192465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs8192465" }, { "id": "rs8192465", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs8192465#frequency_tab" }, { "id": "rs8192465", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs8192465" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENnRSSGAFWK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "FGCEIENNR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "7", "chr_pos": "99968386", "evidence": [ { "id": "rs191613328", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" }, { "id": "rs191613328", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191613328" }, { "id": "rs191613328", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191613328" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "7", "chr_pos": "99968384", "evidence": [ { "id": "rs8192465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs8192465" }, { "id": "rs8192465", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs8192465" }, { "id": "rs8192465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs8192465#frequency_tab" }, { "id": "rs8192465", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs8192465" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "HnFSHCCSK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "DIENFnSTQK", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "FnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "YAEDKFnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "HnFSHCCSK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "DIENFnSTQK", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "FnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "YAEDKFnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "HnFSHCCSK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "DIENFnSTQK", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "FnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "YAEDKFnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "", "site_lbl": "N33", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST); n-glyco-sequon-gain (NFN->NFS).", "chr_id": "4", "chr_pos": "73483950", "evidence": [ { "id": "rs200353894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200353894" }, { "id": "rs200353894", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200353894#frequency_tab" }, { "id": "rs200353894", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200353894" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "4", "chr_pos": "73483949", "evidence": [ { "id": "rs762960521", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762960521#frequency_tab" }, { "id": "rs762960521", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762960521" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "4", "chr_pos": "73483951", "evidence": [ { "id": "rs752012336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752012336" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "4", "chr_pos": "73485916", "evidence": [ { "id": "rs1248832085", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248832085" }, { "id": "rs1248832085", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1248832085#frequency_tab" }, { "id": "rs1248832085", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248832085" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "4", "chr_pos": "73485917", "evidence": [ { "id": "rs1720888599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1720888599" }, { "id": "rs1720888599", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1720888599" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "", "site_lbl": "N402", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "4", "chr_pos": "73497665", "evidence": [ { "id": "rs763408201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763408201" }, { "id": "rs763408201", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763408201" }, { "id": "rs763408201", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763408201#frequency_tab" }, { "id": "rs763408201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763408201" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "HnFSHCCSK", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "N", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "DIENFnSTQK", "site_lbl": "Asn33", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "N", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "FnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "YAEDKFnETTEK", "site_lbl": "Asn402", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "33", "site_seq": "", "site_lbl": "N33", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST); n-glyco-sequon-gain (NFN->NFS).", "chr_id": "4", "chr_pos": "73483950", "evidence": [ { "id": "rs200353894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200353894" }, { "id": "rs200353894", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200353894" }, { "id": "rs200353894", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200353894#frequency_tab" }, { "id": "rs200353894", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200353894" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "4", "chr_pos": "73483949", "evidence": [ { "id": "rs762960521", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762960521" }, { "id": "rs762960521", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762960521#frequency_tab" }, { "id": "rs762960521", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762960521" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "4", "chr_pos": "73483951", "evidence": [ { "id": "rs752012336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752012336" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 33, "end_pos": 33, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "4", "chr_pos": "73485916", "evidence": [ { "id": "rs1248832085", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248832085" }, { "id": "rs1248832085", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1248832085#frequency_tab" }, { "id": "rs1248832085", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248832085" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "4", "chr_pos": "73485917", "evidence": [ { "id": "rs1720888599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1720888599" }, { "id": "rs1720888599", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1720888599" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "402", "site_seq": "", "site_lbl": "N402", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "4", "chr_pos": "73497665", "evidence": [ { "id": "rs763408201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763408201" }, { "id": "rs763408201", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763408201" }, { "id": "rs763408201", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763408201#frequency_tab" }, { "id": "rs763408201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763408201" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43652-1", "start_pos": 402, "end_pos": 402, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Afamin", "gene_name": "AFM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 599, "chemical_mass": 69069.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "GHVnITR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "nFTENDLLVR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "GHVnITR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "nFTENDLLVR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "GHVnITR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "nFTENDLLVR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "121", "site_seq": "GHVnITR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "N", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "YPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "143", "site_seq": "SRYPHKPEInSTTHPGADLQENFCR", "site_lbl": "Asn143", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 143, "end_pos": 143, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "416", "site_seq": "nFTENDLLVR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00734-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prothrombin", "gene_name": "F2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 622, "chemical_mass": 70037.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "6", "chr_pos": "31947072", "evidence": [ { "id": "rs1297491982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297491982" }, { "id": "rs1297491982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297491982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "6", "chr_pos": "31948038", "evidence": [ { "id": "rs2482685674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2482685674" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "31948926", "evidence": [ { "id": "rs757587163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757587163" }, { "id": "rs757587163", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs757587163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "6", "chr_pos": "31947072", "evidence": [ { "id": "rs1297491982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297491982" }, { "id": "rs1297491982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297491982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "6", "chr_pos": "31948038", "evidence": [ { "id": "rs2482685674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2482685674" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "31948926", "evidence": [ { "id": "rs757587163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757587163" }, { "id": "rs757587163", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs757587163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "433", "site_seq": "N", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "RnHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "nHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "N", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "RnHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "nHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "N", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "RnHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "nHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "N", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "RnHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "433", "site_seq": "nHSCEPCQTLAVR", "site_lbl": "Asn433", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00748-1", "start_pos": 433, "end_pos": 433, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 615, "chemical_mass": 67792.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "17", "chr_pos": "66216813", "evidence": [ { "id": "rs1307136735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307136735" }, { "id": "rs1307136735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1307136735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "LGnWSAMPSCK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWS->KWS).", "chr_id": "17", "chr_pos": "66216813", "evidence": [ { "id": "rs1307136735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307136735" }, { "id": "rs1307136735", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1307136735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTLQSMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTLQSMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTLQSMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->HQS).", "chr_id": "6", "chr_pos": "31356703", "evidence": [ { "id": "rs2113748350", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113748350" }, { "id": "rs2113748350", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113748350" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->IQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "31356701", "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01889" }, { "id": "rs781747083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" }, { "id": "rs781747083", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->TQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTLQSMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->HQS).", "chr_id": "6", "chr_pos": "31356703", "evidence": [ { "id": "rs2113748350", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113748350" }, { "id": "rs2113748350", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113748350" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->IQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "31356701", "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01889" }, { "id": "rs781747083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" }, { "id": "rs781747083", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->TQS).", "chr_id": "6", "chr_pos": "31356702", "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01889-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 362, "chemical_mass": 40460.0 } ] }, { "start_pos": "308", "site_seq": "N", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "IYPGVDFGGEELnVTFVK", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "IVGGTnSSWGEWPWQVSLQVK", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "N", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "IYPGVDFGGEELnVTFVK", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "IVGGTnSSWGEWPWQVSLQVK", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "N", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "IYPGVDFGGEELnVTFVK", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "IVGGTnSSWGEWPWQVSLQVK", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "", "site_lbl": "N396", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "186252060", "evidence": [ { "id": "rs752298362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752298362" }, { "id": "rs752298362", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752298362" }, { "id": "rs752298362", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752298362#frequency_tab" }, { "id": "rs752298362", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752298362" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "N", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "308", "site_seq": "IYPGVDFGGEELnVTFVK", "site_lbl": "Asn308", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 308, "end_pos": 308, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "IVGGTnSSWGEWPWQVSLQVK", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "396", "site_seq": "", "site_lbl": "N396", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "186252060", "evidence": [ { "id": "rs752298362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752298362" }, { "id": "rs752298362", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752298362" }, { "id": "rs752298362", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752298362#frequency_tab" }, { "id": "rs752298362", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752298362" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P03952-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 638, "chemical_mass": 71343.0 } ] }, { "start_pos": "1395", "site_seq": "IPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "N", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "KIPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "IPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "N", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "KIPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "IPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "N", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "KIPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "", "site_lbl": "N1395", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183136454", "evidence": [ { "id": "rs965002510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs965002510" }, { "id": "rs965002510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs965002510#frequency_tab" }, { "id": "rs965002510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs965002510" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "1", "chr_pos": "183136454", "evidence": [ { "id": "rs965002510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs965002510" }, { "id": "rs965002510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs965002510#frequency_tab" }, { "id": "rs965002510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs965002510" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "1", "chr_pos": "183136455", "evidence": [ { "id": "rs781759819", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781759819" }, { "id": "rs781759819", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs781759819" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "IPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "N", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "KIPAInQTITEANEK", "site_lbl": "Asn1395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1395", "site_seq": "", "site_lbl": "N1395", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183136454", "evidence": [ { "id": "rs965002510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs965002510" }, { "id": "rs965002510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs965002510#frequency_tab" }, { "id": "rs965002510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs965002510" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "1", "chr_pos": "183136454", "evidence": [ { "id": "rs965002510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs965002510" }, { "id": "rs965002510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs965002510#frequency_tab" }, { "id": "rs965002510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs965002510" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "1", "chr_pos": "183136455", "evidence": [ { "id": "rs781759819", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781759819" }, { "id": "rs781759819", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs781759819" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1395, "end_pos": 1395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "HAnWTLTPLK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYKGK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "HAnWTLTPLK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYKGK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "HAnWTLTPLK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYKGK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "7", "chr_pos": "95306308", "evidence": [ { "id": "rs762779494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762779494#frequency_tab" }, { "id": "rs762779494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762779494" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "7", "chr_pos": "95306306", "evidence": [ { "id": "P27169", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27169" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "7", "chr_pos": "95306307", "evidence": [ { "id": "rs1807539623", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1807539623" }, { "id": "rs1807539623", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1807539623" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "HAnWTLTPLK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYKGK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "324", "site_seq": "VTQVYAEnGTVLQGSTVASVYK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "7", "chr_pos": "95306308", "evidence": [ { "id": "rs762779494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762779494" }, { "id": "rs762779494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762779494#frequency_tab" }, { "id": "rs762779494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762779494" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "7", "chr_pos": "95306306", "evidence": [ { "id": "P27169", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P27169" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "7", "chr_pos": "95306307", "evidence": [ { "id": "rs1807539623", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1807539623" }, { "id": "rs1807539623", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1807539623" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P27169-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 355, "chemical_mass": 39731.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTIQIMYGCDVGSDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEDGSHTIQIMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTIQIMYGCDVGSDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEDGSHTIQIMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTIQIMYGCDVGSDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEDGSHTIQIMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "29943013", "evidence": [ { "id": "rs199474467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474467" }, { "id": "rs199474467", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474467" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "29943012", "evidence": [ { "id": "rs199474466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474466" }, { "id": "rs199474466", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEAGSHTIQIMYGCDVGSDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "GYYnQSEDGSHTIQIMYGCDVGPDGR", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "N", "site_lbl": "Asn110", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "N110", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "29943013", "evidence": [ { "id": "rs199474467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474467" }, { "id": "rs199474467", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474467" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "29943012", "evidence": [ { "id": "rs199474466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199474466" }, { "id": "rs199474466", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs199474466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "110", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs the recruitment of HLA-A*02 in the peptide-loading complex.", "evidence": [ { "database": "UniProtKB", "id": "P04439", "url": "https://www.uniprot.org/uniprotkb/P04439" }, { "database": "PubMed", "id": "21263072", "url": "https://glygen.org/publication/PubMed/21263072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04439-1", "start_pos": 110, "end_pos": 110, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 40841.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "N", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "GTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "394", "site_seq": "YRGTAGNALMDGASQLMGEnR", "site_lbl": "Asn394", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02675-1", "start_pos": 394, "end_pos": 394, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 491, "chemical_mass": 55928.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "N", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "432", "site_seq": "CGLVPVLAENYnK", "site_lbl": "Asn432", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 432, "end_pos": 432, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "91", "site_seq": "TAFITnFTLTIDGVTYPGNVK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "TAFITnFTLTIDGVTYPGNVK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "TAFITnFTLTIDGVTYPGNVK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "TAFITnFTLTIDGVTYPGNVK", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "91", "site_seq": "N", "site_lbl": "Asn91", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06033-1", "start_pos": 91, "end_pos": 91, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H3", "gene_name": "ITIH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 99849.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "MPSQAPTGNFYPQPLLnSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "GPVKMPSQAPTGNFYPQPLLNSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "MPSQAPTGNFYPQPLLnSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "GPVKMPSQAPTGNFYPQPLLNSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "MPSQAPTGNFYPQPLLnSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "GPVKMPSQAPTGNFYPQPLLNSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "N", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "MPSQAPTGNFYPQPLLnSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "1043", "site_seq": "GPVKMPSQAPTGNFYPQPLLNSSMCLEDSR", "site_lbl": "Asn1043", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 1043, "end_pos": 1043, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPnTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPNTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPnTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPNTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPnTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPNTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "", "site_lbl": "N257", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "X", "chr_pos": "120446400", "evidence": [ { "id": "rs369032377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369032377" }, { "id": "rs369032377", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369032377#frequency_tab" }, { "id": "rs369032377", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369032377" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "X", "chr_pos": "120446399", "evidence": [ { "id": "rs1569369275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569369275" }, { "id": "rs1569369275", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569369275" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->nullTT).", "chr_id": "X", "chr_pos": "120446404", "evidence": [ { "id": "rs2147281483", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2147281483" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "N", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPnTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "VASVININPNTTHSTGSCR", "site_lbl": "Asn257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "257", "site_seq": "", "site_lbl": "N257", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "X", "chr_pos": "120446400", "evidence": [ { "id": "rs369032377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369032377" }, { "id": "rs369032377", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369032377#frequency_tab" }, { "id": "rs369032377", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369032377" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "X", "chr_pos": "120446399", "evidence": [ { "id": "rs1569369275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569369275" }, { "id": "rs1569369275", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569369275" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->nullTT).", "chr_id": "X", "chr_pos": "120446404", "evidence": [ { "id": "rs2147281483", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2147281483" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 257, "end_pos": 257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "741", "site_seq": "AnISHK", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "N", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "AnISHK", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "N", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "AnISHK", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "N", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "", "site_lbl": "N741", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "9", "chr_pos": "121013908", "evidence": [ { "id": "rs2047284065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047284065" }, { "id": "rs2047284065", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2047284065" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "9", "chr_pos": "121013908", "evidence": [ { "id": "rs2047284065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047284065" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "AnISHK", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "N", "site_lbl": "Asn741", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "741", "site_seq": "", "site_lbl": "N741", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "9", "chr_pos": "121013908", "evidence": [ { "id": "rs2047284065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047284065" }, { "id": "rs2047284065", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2047284065" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "9", "chr_pos": "121013908", "evidence": [ { "id": "rs2047284065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2047284065" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01031-1", "start_pos": 741, "end_pos": 741, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C5", "gene_name": "C5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1676, "chemical_mass": 188305.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "2", "chr_pos": "70276841", "evidence": [ { "id": "rs764712210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764712210#frequency_tab" }, { "id": "rs764712210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764712210" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "2", "chr_pos": "70276842", "evidence": [ { "id": "Q9UHG3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UHG3" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "MSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSnITFLNFDPPIEEFHQYYQHIVTTLVK", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "KMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "N", "site_lbl": "Asn323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "323", "site_seq": "", "site_lbl": "N323", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "2", "chr_pos": "70276841", "evidence": [ { "id": "rs764712210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764712210" }, { "id": "rs764712210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764712210#frequency_tab" }, { "id": "rs764712210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764712210" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "2", "chr_pos": "70276842", "evidence": [ { "id": "Q9UHG3", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UHG3" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 323, "end_pos": 323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "166", "site_seq": "GFLALYQTVAVnYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "TAHLHKGFLALYQTVAVNYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "GFLALYQTVAVnYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "TAHLHKGFLALYQTVAVNYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "GFLALYQTVAVnYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "TAHLHKGFLALYQTVAVNYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "12", "chr_pos": "7100019", "evidence": [ { "id": "rs371247527", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371247527" }, { "id": "rs371247527", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371247527" }, { "id": "rs371247527", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371247527#frequency_tab" }, { "id": "rs371247527", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371247527" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "12", "chr_pos": "7100020", "evidence": [ { "id": "rs772751644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772751644#frequency_tab" }, { "id": "rs772751644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751644" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "12", "chr_pos": "7100020", "evidence": [ { "id": "rs772751644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772751644#frequency_tab" }, { "id": "rs772751644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751644" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "GFLALYQTVAVnYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "N", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "TAHLHKGFLALYQTVAVNYSQPISEASR", "site_lbl": "Asn166", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "166", "site_seq": "", "site_lbl": "N166", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "12", "chr_pos": "7100019", "evidence": [ { "id": "rs371247527", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371247527" }, { "id": "rs371247527", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371247527" }, { "id": "rs371247527", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371247527#frequency_tab" }, { "id": "rs371247527", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371247527" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "12", "chr_pos": "7100020", "evidence": [ { "id": "rs772751644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772751644#frequency_tab" }, { "id": "rs772751644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751644" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "12", "chr_pos": "7100020", "evidence": [ { "id": "rs772751644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751644" }, { "id": "rs772751644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772751644#frequency_tab" }, { "id": "rs772751644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751644" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NZP8-1", "start_pos": 166, "end_pos": 166, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 487, "chemical_mass": 53498.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "DFVnASSK", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "nLSMPLLPADFHK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "DFVnASSK", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "nLSMPLLPADFHK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "DFVnASSK", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "nLSMPLLPADFHK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "N", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "188", "site_seq": "DFVnASSK", "site_lbl": "Asn188", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 188, "end_pos": 188, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "49", "site_seq": "nLSMPLLPADFHK", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05546-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 57071.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "HGIQYFNnNTQHSSLFMLNEVK", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "HGIQYFNnNTQHSSLFMLNEVK", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "HGIQYFNnNTQHSSLFMLNEVK", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "", "site_lbl": "N169", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "3", "chr_pos": "186725201", "evidence": [ { "id": "rs2108623231", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623231" }, { "id": "rs2108623231", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623231" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "3", "chr_pos": "186725203", "evidence": [ { "id": "rs2108623237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623237" }, { "id": "rs2108623237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->TNT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "HGIQYFNnNTQHSSLFMLNEVK", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "169", "site_seq": "", "site_lbl": "N169", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "3", "chr_pos": "186725201", "evidence": [ { "id": "rs2108623231", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623231" }, { "id": "rs2108623231", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623231" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->INT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "3", "chr_pos": "186725203", "evidence": [ { "id": "rs2108623237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623237" }, { "id": "rs2108623237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->TNT).", "chr_id": "3", "chr_pos": "186725202", "evidence": [ { "id": "rs2108623235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108623235" }, { "id": "rs2108623235", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108623235" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "44", "site_seq": "AELSnHTRPVILVPGCLGNQLEAK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "AELSnHTRPVILVPGCLGNQLEAK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "AELSnHTRPVILVPGCLGNQLEAK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "", "site_lbl": "N44", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "16", "chr_pos": "67943972", "evidence": [ { "id": "rs2058312669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2058312669" }, { "id": "rs2058312669", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2058312669" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "AELSnHTRPVILVPGCLGNQLEAK", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "N", "site_lbl": "Asn44", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "44", "site_seq": "", "site_lbl": "N44", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "16", "chr_pos": "67943972", "evidence": [ { "id": "rs2058312669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2058312669" }, { "id": "rs2058312669", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2058312669" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 44, "end_pos": 44, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIAnATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIANATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIAnATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIANATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIAnATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIANATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "", "site_lbl": "N390", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "4", "chr_pos": "165493226", "evidence": [ { "id": "P16870", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16870" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIAnATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "DLQGNPIANATISVEGIDHDVTSAK", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "390", "site_seq": "", "site_lbl": "N390", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "4", "chr_pos": "165493226", "evidence": [ { "id": "P16870", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16870" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "", "site_lbl": "N341", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "P56199", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P56199" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "rs1415396844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415396844" }, { "id": "rs1415396844", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415396844#frequency_tab" }, { "id": "rs1415396844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415396844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "", "site_lbl": "N341", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "P56199", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P56199" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "rs1415396844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415396844" }, { "id": "rs1415396844", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415396844#frequency_tab" }, { "id": "rs1415396844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415396844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "1029", "site_seq": "N", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "AGEQVTYTCATYYKMDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASNVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "N", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTInSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTINSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGKWSSPPQCEGLPCK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEENETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "N", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "AGEQVTYTCATYYKMDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASNVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "N", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTInSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTINSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGKWSSPPQCEGLPCK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEENETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "N", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "AGEQVTYTCATYYKMDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASNVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "N", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTInSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTINSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGKWSSPPQCEGLPCK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEENETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "", "site_lbl": "N911", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "196737610", "evidence": [ { "id": "rs1240893783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1240893783" }, { "id": "rs1240893783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1240893783" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "N", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "AGEQVTYTCATYYKMDGASnVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1029", "site_seq": "MDGASNVTCINSR", "site_lbl": "Asn1029", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1029, "end_pos": 1029, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "N", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTInSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "882", "site_seq": "IPCSQPPQIEHGTINSSR", "site_lbl": "Asn882", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 882, "end_pos": 882, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "N", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEEnETTCYMGKWSSPPQCEGLPCK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "ISEENETTCYMGK", "site_lbl": "Asn911", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "911", "site_seq": "", "site_lbl": "N911", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "196737610", "evidence": [ { "id": "rs1240893783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1240893783" }, { "id": "rs1240893783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1240893783" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 911, "end_pos": 911, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNnGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNNGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSInSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSINSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPnDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPNDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNnGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNNGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSInSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSINSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPnDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPNDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNnGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNNGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSInSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSINSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPnDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPNDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "4", "chr_pos": "109761646", "evidence": [ { "id": "P05156", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05156" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->IST).", "chr_id": "4", "chr_pos": "109761645", "evidence": [ { "id": "P05156", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05156" }, { "id": "rs753060374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753060374" }, { "id": "rs753060374", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753060374" }, { "id": "rs753060374", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753060374#frequency_tab" }, { "id": "rs753060374", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753060374" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "", "site_lbl": "N464", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "4", "chr_pos": "109746259", "evidence": [ { "id": "rs759927335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759927335" }, { "id": "rs759927335", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759927335" }, { "id": "rs759927335", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759927335#frequency_tab" }, { "id": "rs759927335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759927335" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNnGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "103", "site_seq": "FLNNGTCTAEGK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSInSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "LSDLSINSTECLHVHCR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "N", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPnDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "SIPACVPWSPYLFQPNDTCIVSGWGR", "site_lbl": "Asn464", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "4", "chr_pos": "109761646", "evidence": [ { "id": "P05156", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05156" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->IST).", "chr_id": "4", "chr_pos": "109761645", "evidence": [ { "id": "P05156", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05156" }, { "id": "rs753060374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753060374" }, { "id": "rs753060374", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753060374" }, { "id": "rs753060374", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753060374#frequency_tab" }, { "id": "rs753060374", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753060374" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0110025", "name": "age related macular degeneration 13", "description": "An age related macular degeneration conferred by heterozygous mutation in the CFI gene on chromosome 4q25.", "url": "http://disease-ontology.org/term/DOID:0110025", "evidence": [ { "id": "615439", "database": "MIM", "url": "https://www.omim.org/entry/615439" }, { "id": "0110025", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110025" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] }, { "disease_id": "DOID:0050419", "name": "complement factor I deficiency", "description": "A complement deficiency that is characterized by recurrent pyogenic bacterial infections that is the result of complement component 3 deficiency.", "url": "http://disease-ontology.org/term/DOID:0050419", "evidence": [ { "id": "610984", "database": "MIM", "url": "https://www.omim.org/entry/610984" }, { "id": "0050419", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050419" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "464", "site_seq": "", "site_lbl": "N464", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "4", "chr_pos": "109746259", "evidence": [ { "id": "rs759927335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759927335" }, { "id": "rs759927335", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759927335" }, { "id": "rs759927335", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759927335#frequency_tab" }, { "id": "rs759927335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759927335" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05156-1", "start_pos": 464, "end_pos": 464, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor I", "gene_name": "CFI", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65750.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "SHEIWTHSCPQSPGnGTDASH", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "SHEIWTHSCPQSPGnGTDASH", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "SHEIWTHSCPQSPGnGTDASH", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "N", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "396", "site_seq": "SHEIWTHSCPQSPGnGTDASH", "site_lbl": "Asn396", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04278-1", "start_pos": 396, "end_pos": 396, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 402, "chemical_mass": 43779.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "VVGVPYQGnATALFILPSEGK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "VVGVPYQGnATALFILPSEGK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "VVGVPYQGnATALFILPSEGK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94590205", "evidence": [ { "id": "P05154", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05154" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "VVGVPYQGnATALFILPSEGK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94590205", "evidence": [ { "id": "P05154", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05154" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05154-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45675.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "LPTQnITFQTESSVAEQEAEFQSPK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "LPTQnITFQTESSVAEQEAEFQSPK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "LPTQnITFQTESSVAEQEAEFQSPK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "3", "chr_pos": "52829129", "evidence": [ { "id": "rs1700528685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1700528685" }, { "id": "rs1700528685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1700528685#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "N", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "517", "site_seq": "LPTQnITFQTESSVAEQEAEFQSPK", "site_lbl": "Asn517", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 517, "end_pos": 517, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "3", "chr_pos": "52829129", "evidence": [ { "id": "rs1700528685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1700528685" }, { "id": "rs1700528685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1700528685#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "GYFYIPPLATHTICDRnHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "NHTWLPVSDDACYR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on cytoprotective function. No effect on Neisseria binding. No effect on Measles virus binding.", "evidence": [ { "database": "UniProtKB", "id": "P15529", "url": "https://www.uniprot.org/uniprotkb/P15529" }, { "database": "PubMed", "id": "11260136", "url": "https://glygen.org/publication/PubMed/11260136" }, { "database": "PubMed", "id": "9759896", "url": "https://glygen.org/publication/PubMed/9759896" }, { "database": "PubMed", "id": "8764003", "url": "https://glygen.org/publication/PubMed/8764003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15529-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 43747.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "VCREAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGnHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "EAGNHTSGAGLVQINK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "12", "chr_pos": "8945513", "evidence": [ { "id": "P20645", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P20645" }, { "id": "rs751187988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751187988" }, { "id": "rs751187988", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751187988" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20645-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-dependent mannose-6-phosphate receptor", "gene_name": "M6PR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30993.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "13", "chr_pos": "113309766", "evidence": [ { "id": "rs757261971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757261971#frequency_tab" }, { "id": "rs757261971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757261971" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "13", "chr_pos": "113309767", "evidence": [ { "id": "rs2042619552", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2042619552" }, { "id": "rs2042619552", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2042619552" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "13", "chr_pos": "113309820", "evidence": [ { "id": "rs1483329400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483329400" }, { "id": "rs1483329400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1483329400#frequency_tab" }, { "id": "rs1483329400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1483329400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "13", "chr_pos": "113309766", "evidence": [ { "id": "rs757261971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757261971#frequency_tab" }, { "id": "rs757261971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757261971" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "13", "chr_pos": "113309767", "evidence": [ { "id": "rs2042619552", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2042619552" }, { "id": "rs2042619552", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2042619552" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "13", "chr_pos": "113309820", "evidence": [ { "id": "rs1483329400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483329400" }, { "id": "rs1483329400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1483329400#frequency_tab" }, { "id": "rs1483329400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1483329400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "45892473", "evidence": [ { "id": "rs1256294756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256294756" }, { "id": "rs1256294756", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256294756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "45892473", "evidence": [ { "id": "rs1256294756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256294756" }, { "id": "rs1256294756", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256294756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "FVQGnSTEVACHPGYGLPK", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "FVQGnSTEVACHPGYGLPK", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "FVQGnSTEVACHPGYGLPK", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "108", "site_seq": "FVQGnSTEVACHPGYGLPK", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q02985-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 330, "chemical_mass": 37323.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "2400", "site_seq": "DFVEIWDnHTSGNILGR", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "N", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "DFVEIWDnHTSGNILGR", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "N", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "DFVEIWDnHTSGNILGR", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "N", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "", "site_lbl": "N2400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "10", "chr_pos": "16915832", "evidence": [ { "id": "rs749612844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749612844" }, { "id": "rs749612844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749612844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "DFVEIWDnHTSGNILGR", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "N", "site_lbl": "Asn2400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2400", "site_seq": "", "site_lbl": "N2400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->SHT).", "chr_id": "10", "chr_pos": "16915832", "evidence": [ { "id": "rs749612844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749612844" }, { "id": "rs749612844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749612844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2400, "end_pos": 2400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "214", "site_seq": "LNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "KLNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "LNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "KLNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "LNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "KLNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "LNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "214", "site_seq": "KLNnLTFLYLDHNALESVPLNLPESLR", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20774-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mimecan", "gene_name": "OGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 33922.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "134", "site_seq": "LGEMWnNTAADDKQPYEK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "GEHPGLSIGDVAKKLGEMWNNTAADDK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "LGEMWnNTAADDKQPYEK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "GEHPGLSIGDVAKKLGEMWNNTAADDK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "LGEMWnNTAADDKQPYEK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "GEHPGLSIGDVAKKLGEMWNNTAADDK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "LGEMWnNTAADDKQPYEK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "GEHPGLSIGDVAKKLGEMWNNTAADDK", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "134", "site_seq": "N", "site_lbl": "Asn134", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09429-1", "start_pos": 134, "end_pos": 134, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 215, "chemical_mass": 24894.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "nISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NnATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "nISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NnATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "nISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NnATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "", "site_lbl": "N242", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "17", "chr_pos": "28368973", "evidence": [ { "id": "rs1555583488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555583488" }, { "id": "rs1555583488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555583488" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "17", "chr_pos": "28369780", "evidence": [ { "id": "rs2067937096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2067937096" }, { "id": "rs2067937096", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2067937096#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "N", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "nISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR", "site_lbl": "Asn242", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NnATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "242", "site_seq": "", "site_lbl": "N242", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "17", "chr_pos": "28368973", "evidence": [ { "id": "rs1555583488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555583488" }, { "id": "rs1555583488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555583488" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 242, "end_pos": 242, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "17", "chr_pos": "28369780", "evidence": [ { "id": "rs2067937096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2067937096" }, { "id": "rs2067937096", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2067937096#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "AFHYnVSSHGCQLLPWTQHSPHTR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "AFHYnVSSHGCQLLPWTQHSPHTR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "AFHYnVSSHGCQLLPWTQHSPHTR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "72", "site_seq": "AFHYnVSSHGCQLLPWTQHSPHTR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P26927-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatocyte growth factor-like protein", "gene_name": "MST1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 711, "chemical_mass": 80320.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "EHETCLAPELYNGnYSTTQK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "N", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "HGVIISSTVDTYEnGSSVEYR", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "EHETCLAPELYNGnYSTTQK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "N", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "HGVIISSTVDTYEnGSSVEYR", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "EHETCLAPELYNGnYSTTQK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "N", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "HGVIISSTVDTYEnGSSVEYR", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "", "site_lbl": "N162", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS); n-glyco-sequon-gain (NGN->NGS).", "chr_id": "1", "chr_pos": "197061042", "evidence": [ { "id": "rs981223160", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs981223160" }, { "id": "rs981223160", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs981223160" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "", "site_lbl": "N545", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "1", "chr_pos": "197050800", "evidence": [ { "id": "rs1009314384", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009314384" }, { "id": "rs1009314384", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009314384#frequency_tab" }, { "id": "rs1009314384", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009314384" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "N", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "EHETCLAPELYNGnYSTTQK", "site_lbl": "Asn162", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "N", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "HGVIISSTVDTYEnGSSVEYR", "site_lbl": "Asn545", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "162", "site_seq": "", "site_lbl": "N162", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS); n-glyco-sequon-gain (NGN->NGS).", "chr_id": "1", "chr_pos": "197061042", "evidence": [ { "id": "rs981223160", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs981223160" }, { "id": "rs981223160", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs981223160" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 162, "end_pos": 162, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "545", "site_seq": "", "site_lbl": "N545", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "1", "chr_pos": "197050800", "evidence": [ { "id": "rs1009314384", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009314384" }, { "id": "rs1009314384", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009314384#frequency_tab" }, { "id": "rs1009314384", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009314384" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05160-1", "start_pos": 545, "end_pos": 545, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 661, "chemical_mass": 75511.0 } ] }, { "start_pos": "108", "site_seq": "SQILEGLGFnLTELSESDVHR", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "SQILEGLGFnLTELSESDVHR", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "SQILEGLGFnLTELSESDVHR", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "", "site_lbl": "N108", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "14", "chr_pos": "94563805", "evidence": [ { "id": "rs1902111155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1902111155" }, { "id": "rs1902111155", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1902111155#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "94563806", "evidence": [ { "id": "rs768543200", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768543200" }, { "id": "rs768543200", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768543200" }, { "id": "rs768543200", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768543200#frequency_tab" }, { "id": "rs768543200", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768543200" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "14", "chr_pos": "94563805", "evidence": [ { "id": "rs1902111155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1902111155" }, { "id": "rs1902111155", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1902111155#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "SQILEGLGFnLTELSESDVHR", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "N", "site_lbl": "Asn108", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "108", "site_seq": "", "site_lbl": "N108", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "14", "chr_pos": "94563805", "evidence": [ { "id": "rs1902111155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1902111155" }, { "id": "rs1902111155", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1902111155#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "14", "chr_pos": "94563806", "evidence": [ { "id": "rs768543200", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768543200" }, { "id": "rs768543200", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768543200" }, { "id": "rs768543200", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768543200#frequency_tab" }, { "id": "rs768543200", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768543200" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "14", "chr_pos": "94563805", "evidence": [ { "id": "rs1902111155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1902111155" }, { "id": "rs1902111155", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1902111155#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P29622-1", "start_pos": 108, "end_pos": 108, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kallistatin", "gene_name": "SERPINA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 427, "chemical_mass": 48542.0 } ] }, { "start_pos": "390", "site_seq": "QVVEnMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVENMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVEnMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVENMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVEnMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVENMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVEnMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "N", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "390", "site_seq": "QVVENMTR", "site_lbl": "Asn390", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10253-1", "start_pos": 390, "end_pos": 390, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "GAA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 952, "chemical_mass": 105324.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "", "site_lbl": "N536", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "5", "chr_pos": "31317469", "evidence": [ { "id": "rs1738356471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1738356471" }, { "id": "rs1738356471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1738356471#frequency_tab" }, { "id": "rs1738356471", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1738356471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "", "site_lbl": "N536", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "5", "chr_pos": "31317469", "evidence": [ { "id": "rs1738356471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1738356471" }, { "id": "rs1738356471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1738356471#frequency_tab" }, { "id": "rs1738356471", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1738356471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "1261", "site_seq": "FNMnISGVFHPNGLEVIINTEIWDLR", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "1261", "site_seq": "FNMnISGVFHPNGLEVIINTEIWDLR", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "1261", "site_seq": "FNMnISGVFHPNGLEVIINTEIWDLR", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "1261", "site_seq": "", "site_lbl": "N1261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS); n-glyco-sequon-gain (NMN->NMS).", "chr_id": "3", "chr_pos": "51414679", "evidence": [ { "id": "rs782112358", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782112358" }, { "id": "rs782112358", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782112358" }, { "id": "rs782112358", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782112358" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "1261", "site_seq": "FNMnISGVFHPNGLEVIINTEIWDLR", "site_lbl": "Asn1261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "1261", "site_seq": "", "site_lbl": "N1261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS); n-glyco-sequon-gain (NMN->NMS).", "chr_id": "3", "chr_pos": "51414679", "evidence": [ { "id": "rs782112358", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782112358" }, { "id": "rs782112358", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782112358" }, { "id": "rs782112358", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782112358" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4B6-1", "start_pos": 1261, "end_pos": 1261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "DDB1- and CUL4-associated factor 1", "gene_name": "DCAF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1507, "chemical_mass": 169007.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "AVnITSENLIDDVVSLIR", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "AVnITSENLIDDVVSLIR", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "AVnITSENLIDDVVSLIR", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "415", "site_seq": "AVnITSENLIDDVVSLIR", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02748-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement component C9", "gene_name": "C9", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 559, "chemical_mass": 63173.0 } ] }, { "start_pos": "119", "site_seq": "VSEHIPVYQQEEnQTDVWTLLNGSK", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSnISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSNISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "VSEHIPVYQQEEnQTDVWTLLNGSK", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSnISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSNISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "VSEHIPVYQQEEnQTDVWTLLNGSK", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSnISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSNISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "5", "chr_pos": "42806955", "evidence": [ { "id": "rs1760343477", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1760343477" }, { "id": "rs1760343477", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1760343477" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "5", "chr_pos": "42807065", "evidence": [ { "id": "rs776973904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776973904" }, { "id": "rs776973904", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776973904" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "VSEHIPVYQQEEnQTDVWTLLNGSK", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSnISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "EGYSNISYIVVNHQGISSR", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "5", "chr_pos": "42806955", "evidence": [ { "id": "rs1760343477", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1760343477" }, { "id": "rs1760343477", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1760343477" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "5", "chr_pos": "42807065", "evidence": [ { "id": "rs776973904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776973904" }, { "id": "rs776973904", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776973904" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P49908-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 381, "chemical_mass": 43174.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "N", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "AnLSSQALQMSLDYGFVTPLTSMSIR", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "N", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "AnLSSQALQMSLDYGFVTPLTSMSIR", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "N", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "AnLSSQALQMSLDYGFVTPLTSMSIR", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "", "site_lbl": "N588", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "3", "chr_pos": "52786975", "evidence": [ { "id": "rs1410645678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410645678" }, { "id": "rs1410645678", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410645678" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "N", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "AnLSSQALQMSLDYGFVTPLTSMSIR", "site_lbl": "Asn588", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "588", "site_seq": "", "site_lbl": "N588", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "3", "chr_pos": "52786975", "evidence": [ { "id": "rs1410645678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410645678" }, { "id": "rs1410645678", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410645678" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 588, "end_pos": 588, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "2790", "site_seq": "TEPMQVALHCTnGSVVYHEVLNAMECK", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "N", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "TEPMQVALHCTnGSVVYHEVLNAMECK", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "N", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "TEPMQVALHCTnGSVVYHEVLNAMECK", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "N", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "", "site_lbl": "N2790", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "12", "chr_pos": "5949088", "evidence": [ { "id": "rs1943146800", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1943146800" }, { "id": "rs1943146800", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1943146800" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "TEPMQVALHCTnGSVVYHEVLNAMECK", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "N", "site_lbl": "Asn2790", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2790", "site_seq": "", "site_lbl": "N2790", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "12", "chr_pos": "5949088", "evidence": [ { "id": "rs1943146800", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1943146800" }, { "id": "rs1943146800", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1943146800" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2790, "end_pos": 2790, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "EDNAVQPnSSYTYVWHATER", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "EDNAVQPnSSYTYVWHATER", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "EDNAVQPnSSYTYVWHATER", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "", "site_lbl": "N1703", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "169530886", "evidence": [ { "id": "rs1433281334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1433281334" }, { "id": "rs1433281334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1433281334" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "1", "chr_pos": "169530887", "evidence": [ { "id": "rs2101811635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2101811635" }, { "id": "rs2101811635", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2101811635" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "EDNAVQPnSSYTYVWHATER", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "1703", "site_seq": "", "site_lbl": "N1703", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "1", "chr_pos": "169530886", "evidence": [ { "id": "rs1433281334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1433281334" }, { "id": "rs1433281334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1433281334" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "1", "chr_pos": "169530887", "evidence": [ { "id": "rs2101811635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2101811635" }, { "id": "rs2101811635", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2101811635" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12259-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2224, "chemical_mass": 251703.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "EHEAQSnASLDVFLGHTNVEELMK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "EHEAQSnASLDVFLGHTNVEELMK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "EHEAQSnASLDVFLGHTNVEELMK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "", "site_lbl": "N514", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "12", "chr_pos": "7081108", "evidence": [ { "id": "rs762138868", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762138868#frequency_tab" }, { "id": "rs762138868", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762138868" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "12", "chr_pos": "7081109", "evidence": [ { "id": "rs1305246309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305246309" }, { "id": "rs1305246309", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305246309#frequency_tab" }, { "id": "rs1305246309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305246309" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "N", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "EHEAQSnASLDVFLGHTNVEELMK", "site_lbl": "Asn514", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "514", "site_seq": "", "site_lbl": "N514", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "12", "chr_pos": "7081108", "evidence": [ { "id": "rs762138868", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762138868" }, { "id": "rs762138868", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762138868#frequency_tab" }, { "id": "rs762138868", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762138868" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "12", "chr_pos": "7081109", "evidence": [ { "id": "rs1305246309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305246309" }, { "id": "rs1305246309", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305246309#frequency_tab" }, { "id": "rs1305246309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305246309" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00736-1", "start_pos": 514, "end_pos": 514, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 705, "chemical_mass": 80119.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "TELFSSSCPGGIMLnETGQGYQR", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "TELFSSSCPGGIMLnETGQGYQR", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "TELFSSSCPGGIMLnETGQGYQR", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "", "site_lbl": "N135", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "31657440", "evidence": [ { "id": "rs552461480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs552461480" }, { "id": "rs552461480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs552461480#frequency_tab" }, { "id": "rs552461480", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs552461480" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "N", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "TELFSSSCPGGIMLnETGQGYQR", "site_lbl": "Asn135", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "", "site_lbl": "N135", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "31657440", "evidence": [ { "id": "rs552461480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs552461480" }, { "id": "rs552461480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552461480" }, { "id": "rs552461480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs552461480#frequency_tab" }, { "id": "rs552461480", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs552461480" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "135", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O95445", "url": "https://www.uniprot.org/uniprotkb/O95445" }, { "database": "PubMed", "id": "11418126", "url": "https://glygen.org/publication/PubMed/11418126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95445-1", "start_pos": 135, "end_pos": 135, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein M", "gene_name": "APOM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 188, "chemical_mass": 21253.0 } ] }, { "start_pos": "79", "site_seq": "QYNPILSMLTnQTGEAGR", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "QYNPILSMLTnQTGEAGR", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "QYNPILSMLTnQTGEAGR", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "QYNPILSMLTnQTGEAGR", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "79", "site_seq": "N", "site_lbl": "Asn79", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NY97-1", "start_pos": 79, "end_pos": 79, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 46022.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "6", "chr_pos": "112207132", "evidence": [ { "id": "Q16363", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16363" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "6", "chr_pos": "112207132", "evidence": [ { "id": "Q16363", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16363" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHnK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHNK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHnK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHNK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHnK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHNK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHnK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "294", "site_seq": "VTYQNHNK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32004-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1CAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1257, "chemical_mass": 140003.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFnFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFNFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFnFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFNFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFnFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFNFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFnFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "119", "site_seq": "DVQIIVFPEDGIHGFNFTR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43251-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biotinidase", "gene_name": "BTD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 543, "chemical_mass": 61133.0 } ] }, { "start_pos": "353", "site_seq": "IFSnCSFEDFAHFISK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "IFSnCSFEDFAHFISK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "IFSnCSFEDFAHFISK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "IFSnCSFEDFAHFISK", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "353", "site_seq": "N", "site_lbl": "Asn353", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99965-1", "start_pos": 353, "end_pos": 353, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 2", "gene_name": "ADAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 735, "chemical_mass": 82457.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "GAFISnFSMTVDGK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "GAFISnFSMTVDGK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "GAFISnFSMTVDGK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->IFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "10", "chr_pos": "7709183", "evidence": [ { "id": "rs768596600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768596600#frequency_tab" }, { "id": "rs768596600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768596600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "P19823", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19823" }, { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" }, { "id": "rs749501304", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs749501304" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "N", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "GAFISnFSMTVDGK", "site_lbl": "Asn118", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "118", "site_seq": "", "site_lbl": "N118", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->IFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "10", "chr_pos": "7709183", "evidence": [ { "id": "rs768596600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768596600" }, { "id": "rs768596600", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768596600#frequency_tab" }, { "id": "rs768596600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768596600" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "10", "chr_pos": "7709182", "evidence": [ { "id": "P19823", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P19823" }, { "id": "rs749501304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749501304" }, { "id": "rs749501304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749501304#frequency_tab" }, { "id": "rs749501304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749501304" }, { "id": "rs749501304", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs749501304" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19823-1", "start_pos": 118, "end_pos": 118, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H2", "gene_name": "ITIH2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 946, "chemical_mass": 106463.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "HSHNnNSSDLHPHK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "HSHNnNSSDLHPHK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "HSHNnNSSDLHPHK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "N", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "344", "site_seq": "HSHNnNSSDLHPHK", "site_lbl": "Asn344", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 344, "end_pos": 344, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "3895", "site_seq": "N", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "FEVDSPVYnATWSASLK", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "N", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "FEVDSPVYnATWSASLK", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "N", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "FEVDSPVYnATWSASLK", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "", "site_lbl": "N3895", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "2", "chr_pos": "21005185", "evidence": [ { "id": "rs2103350346", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103350346" }, { "id": "rs2103350346", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103350346" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "2", "chr_pos": "21005184", "evidence": [ { "id": "rs1434488061", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434488061" }, { "id": "rs1434488061", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1434488061#frequency_tab" }, { "id": "rs1434488061", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434488061" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "N", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "FEVDSPVYnATWSASLK", "site_lbl": "Asn3895", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3895", "site_seq": "", "site_lbl": "N3895", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "2", "chr_pos": "21005185", "evidence": [ { "id": "rs2103350346", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2103350346" }, { "id": "rs2103350346", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2103350346" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "2", "chr_pos": "21005184", "evidence": [ { "id": "rs1434488061", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434488061" }, { "id": "rs1434488061", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1434488061#frequency_tab" }, { "id": "rs1434488061", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434488061" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3895, "end_pos": 3895, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "325", "site_seq": "MFSQnDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQNDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQnDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQNDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQnDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQNDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQnDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "N", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "325", "site_seq": "MFSQNDTR", "site_lbl": "Asn325", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02750-1", "start_pos": 325, "end_pos": 325, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 347, "chemical_mass": 38178.0 } ] }, { "start_pos": "165", "site_seq": "TLYETEVFSTDFSnISAAK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "TLYETEVFSTDFSnISAAK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "TLYETEVFSTDFSnISAAK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "", "site_lbl": "N165", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "X", "chr_pos": "106036564", "evidence": [ { "id": "rs369350028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369350028" }, { "id": "rs369350028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369350028" }, { "id": "rs369350028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369350028#frequency_tab" }, { "id": "rs369350028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369350028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "23", "chr_pos": "106036565", "evidence": [ { "id": "P05543", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05543" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "TLYETEVFSTDFSnISAAK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "165", "site_seq": "", "site_lbl": "N165", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "X", "chr_pos": "106036564", "evidence": [ { "id": "rs369350028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369350028" }, { "id": "rs369350028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369350028" }, { "id": "rs369350028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369350028#frequency_tab" }, { "id": "rs369350028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369350028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "23", "chr_pos": "106036565", "evidence": [ { "id": "P05543", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05543" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05543-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 415, "chemical_mass": 46325.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "2558", "site_seq": "QLINALQInNTAVGHALVLPAGR", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "N", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "QLINALQInNTAVGHALVLPAGR", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "N", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "QLINALQInNTAVGHALVLPAGR", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "N", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "", "site_lbl": "N2558", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "237342157", "evidence": [ { "id": "P12111", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P12111" }, { "id": "rs1022266665", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1022266665" }, { "id": "rs1022266665", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1022266665" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "QLINALQInNTAVGHALVLPAGR", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "N", "site_lbl": "Asn2558", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "2558", "site_seq": "", "site_lbl": "N2558", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "237342157", "evidence": [ { "id": "P12111", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P12111" }, { "id": "rs1022266665", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1022266665" }, { "id": "rs1022266665", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1022266665" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12111-1", "start_pos": 2558, "end_pos": 2558, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-3(VI) chain", "gene_name": "COL6A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3177, "chemical_mass": 343669.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "", "site_lbl": "N186", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "1", "chr_pos": "206937582", "evidence": [ { "id": "rs1487109329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487109329" }, { "id": "rs1487109329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487109329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "", "site_lbl": "N186", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "1", "chr_pos": "206937582", "evidence": [ { "id": "rs1487109329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487109329" }, { "id": "rs1487109329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487109329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] } ], "record_id": "G04854VP" }