{ "glytoucan_ac": "G04672QB", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "305", "url": "https://glyconnect.expasy.org/browser/compositions/305" }, { "database": "PubMed", "id": "10988252", "url": "https://glygen.org/publication/PubMed/10988252" }, { "database": "PubMed", "id": "1898343", "url": "https://glygen.org/publication/PubMed/1898343" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "33139572", "url": "https://glygen.org/publication/PubMed/33139572" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "305", "url": "https://glyconnect.expasy.org/browser/compositions/305" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "305", "url": "https://glyconnect.expasy.org/browser/compositions/305" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "PubMed", "id": "34369795", "url": "https://glygen.org/publication/PubMed/34369795" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 2338.87, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 2, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "114", "site_seq": "N", "site_lbl": "Asn114", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08861-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1898343", "url": "https://glygen.org/publication/PubMed/1898343" }, { "database": "GlyConnect", "id": "125", "url": "https://glyconnect.expasy.org/browser/proteins/125" } ], "protein_name": "Chymotrypsin-like elastase family member 3B", "gene_name": "CELA3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 270, "chemical_mass": 29263.0 } ] }, { "start_pos": "114", "site_seq": "N", "site_lbl": "Asn114", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08861-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1898343", "url": "https://glygen.org/publication/PubMed/1898343" }, { "database": "GlyConnect", "id": "125", "url": "https://glyconnect.expasy.org/browser/proteins/125" } ], "protein_name": "Chymotrypsin-like elastase family member 3B", "gene_name": "CELA3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 270, "chemical_mass": 29263.0 } ] }, { "start_pos": "114", "site_seq": "N", "site_lbl": "Asn114", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08861-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1898343", "url": "https://glygen.org/publication/PubMed/1898343" }, { "database": "GlyConnect", "id": "125", "url": "https://glyconnect.expasy.org/browser/proteins/125" } ], "protein_name": "Chymotrypsin-like elastase family member 3B", "gene_name": "CELA3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 270, "chemical_mass": 29263.0 } ] }, { "start_pos": "114", "site_seq": "N", "site_lbl": "Asn114", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08861-1", "start_pos": 114, "end_pos": 114, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "1898343", "url": "https://glygen.org/publication/PubMed/1898343" }, { "database": "GlyConnect", "id": "125", "url": "https://glyconnect.expasy.org/browser/proteins/125" } ], "protein_name": "Chymotrypsin-like elastase family member 3B", "gene_name": "CELA3B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 270, "chemical_mass": 29263.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "N205", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "N205", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "N205", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "14", "chr_pos": "105587567", "evidence": [ { "id": "rs2085466217", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085466217" }, { "id": "rs2085466217", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085466217#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "14", "chr_pos": "105587568", "evidence": [ { "id": "rs558289293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs558289293" }, { "id": "rs558289293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs558289293" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "N205", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "14", "chr_pos": "105587567", "evidence": [ { "id": "rs2085466217", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085466217" }, { "id": "rs2085466217", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085466217#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "14", "chr_pos": "105587568", "evidence": [ { "id": "rs558289293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs558289293" }, { "id": "rs558289293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs558289293" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01877-2", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 391, "chemical_mass": 42334.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "", "site_lbl": "N1581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "15", "chr_pos": "48467943", "evidence": [ { "id": "rs2505501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505501431" } ], "disease": [ { "disease_id": "DOID:14323", "name": "Marfan syndrome", "description": "A connective tissue disease that is characterized by tall stature, elongated extremities, mitral valve prolapse, aortic dilatation, aortic dissection, and subluxation of the lens.", "url": "http://disease-ontology.org/term/DOID:14323", "evidence": [ { "id": "14323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "", "site_lbl": "N1581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "15", "chr_pos": "48467943", "evidence": [ { "id": "rs2505501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505501431" } ], "disease": [ { "disease_id": "DOID:14323", "name": "Marfan syndrome", "description": "A connective tissue disease that is characterized by tall stature, elongated extremities, mitral valve prolapse, aortic dilatation, aortic dissection, and subluxation of the lens.", "url": "http://disease-ontology.org/term/DOID:14323", "evidence": [ { "id": "14323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "199", "site_seq": "VMYTTQGGGEAWGISVLNPnK", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "N", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "VMYTTQGGGEAWGISVLNPnK", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "N", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "VMYTTQGGGEAWGISVLNPnK", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "N", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "VMYTTQGGGEAWGISVLNPnK", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "199", "site_seq": "N", "site_lbl": "Asn199", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P34810-1", "start_pos": 199, "end_pos": 199, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1483", "url": "https://glyconnect.expasy.org/browser/proteins/1483" } ], "protein_name": "Macrosialin", "gene_name": "CD68", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 354, "chemical_mass": 37408.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "FHLAnR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1587", "url": "https://glyconnect.expasy.org/browser/proteins/1587" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "1", "chr_pos": "40078590", "evidence": [ { "id": "rs746776515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746776515" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "1", "chr_pos": "40078591", "evidence": [ { "id": "rs768490419", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768490419#frequency_tab" }, { "id": "rs768490419", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768490419" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "NC_000001.11", "chr_pos": "40078591", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "FLnDSIVDPVDSEWFGFYR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "1", "chr_pos": "40078590", "evidence": [ { "id": "rs746776515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746776515" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "1", "chr_pos": "40078591", "evidence": [ { "id": "rs768490419", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490419" }, { "id": "rs768490419", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768490419#frequency_tab" }, { "id": "rs768490419", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768490419" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "NC_000001.11", "chr_pos": "40078591", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "KQYDSFTFTASKNGTYK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "KQYDSFTFTASKNGTYK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "KQYDSFTFTASKNGTYK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "5", "chr_pos": "115620566", "evidence": [ { "id": "rs2531893735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2531893735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "KQYDSFTFTASKNGTYK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "5", "chr_pos": "115620566", "evidence": [ { "id": "rs2531893735", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2531893735" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y3B3-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1845", "url": "https://glyconnect.expasy.org/browser/proteins/1845" } ], "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 224, "chemical_mass": 25172.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-145.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "21", "url": "https://glyconnect.expasy.org/browser/proteins/21" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33871970", "url": "https://glygen.org/publication/PubMed/33871970" }, { "database": "GlyConnect", "id": "2956", "url": "https://glyconnect.expasy.org/browser/proteins/2956" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] } ], "record_id": "G04672QB" }