{ "glytoucan_ac": "G03574QJ", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G11637WL", "url": "https://www.glygen.org/glycan/G11637WL" }, { "database": "Subsumption", "id": "G23897ET", "url": "https://www.glygen.org/glycan/G23897ET" }, { "database": "Subsumption", "id": "G31993QW", "url": "https://www.glygen.org/glycan/G31993QW" }, { "database": "Subsumption", "id": "G78980OK", "url": "https://www.glygen.org/glycan/G78980OK" }, { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G11637WL", "url": "https://www.glygen.org/glycan/G11637WL" }, { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G11637WL", "url": "https://www.glygen.org/glycan/G11637WL" }, { "database": "Subsumption", "id": "G31993QW", "url": "https://www.glygen.org/glycan/G31993QW" }, { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" }, { "database": "Subsumption", "id": "G15402YD", "url": "https://www.glygen.org/glycan/G15402YD" }, { "database": "Subsumption", "id": "G59924QI", "url": "https://www.glygen.org/glycan/G59924QI" }, { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" }, { "database": "GlyCosmos", "id": "G03574QJ", "url": "https://glycosmos.org/glycans/show/G03574QJ" }, { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G11637WL", "url": "https://www.glygen.org/glycan/G11637WL" }, { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" }, { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 7227, "name": "Drosophila melanogaster", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" }, { "database": "Subsumption", "id": "G05384WR", "url": "https://www.glygen.org/glycan/G05384WR" }, { "database": "Subsumption", "id": "G15402YD", "url": "https://www.glygen.org/glycan/G15402YD" }, { "database": "Subsumption", "id": "G19600YQ", "url": "https://www.glygen.org/glycan/G19600YQ" }, { "database": "Subsumption", "id": "G59924QI", "url": "https://www.glygen.org/glycan/G59924QI" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G84820NF", "url": "https://www.glygen.org/glycan/G84820NF" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000341", "url": "http://data.glygen.org/GLY_000341" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 1745.62, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Hybrid", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 3, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "186602056", "evidence": [ { "id": "rs1686923072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686923072" }, { "id": "rs1686923072", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1686923072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "AnTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "ANTTQPGIVEGGQVLK", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "74", "site_seq": "", "site_lbl": "N74", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "2", "chr_pos": "186602056", "evidence": [ { "id": "rs1686923072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1686923072" }, { "id": "rs1686923072", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1686923072" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P06756-1", "start_pos": 74, "end_pos": 74, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1048, "chemical_mass": 116038.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "73", "site_seq": "GRDIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "N", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "DIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "GRDIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "N", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "DIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "GRDIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "N", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "DIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "", "site_lbl": "N73", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->TKS).", "chr_id": "3", "chr_pos": "108080173", "evidence": [ { "id": "rs2108266168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108266168" }, { "id": "rs2108266168", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108266168" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "GRDIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "N", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "DIYTFDGALnK", "site_lbl": "Asn73", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "73", "site_seq": "", "site_lbl": "N73", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->TKS).", "chr_id": "3", "chr_pos": "108080173", "evidence": [ { "id": "rs2108266168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2108266168" }, { "id": "rs2108266168", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2108266168" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08722-1", "start_pos": 73, "end_pos": 73, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 323, "chemical_mass": 35214.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "N", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "nGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "169", "site_seq": "NGSLFAFR", "site_lbl": "Asn169", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04004-1", "start_pos": 169, "end_pos": 169, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Vitronectin", "gene_name": "VTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 478, "chemical_mass": 54306.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "69", "site_seq": "", "site_lbl": "N69", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "19", "chr_pos": "50858029", "evidence": [ { "id": "P07288", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07288-1", "start_pos": 69, "end_pos": 69, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Prostate-specific antigen", "gene_name": "KLK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 261, "chemical_mass": 28741.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "19219206", "evidence": [ { "id": "O14594", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14594" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "19219206", "evidence": [ { "id": "O14594", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14594" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "LQLQALQQnGSSVLSEDK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "LQLQALQQnGSSVLSEDK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "LQLQALQQnGSSVLSEDK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "15594883", "evidence": [ { "id": "rs143158922", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143158922#frequency_tab" }, { "id": "rs143158922", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143158922" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "X", "chr_pos": "15594883", "evidence": [ { "id": "rs143158922", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143158922#frequency_tab" }, { "id": "rs143158922", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143158922" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "LQLQALQQnGSSVLSEDK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "15594883", "evidence": [ { "id": "rs143158922", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143158922#frequency_tab" }, { "id": "rs143158922", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143158922" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "X", "chr_pos": "15594883", "evidence": [ { "id": "rs143158922", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143158922" }, { "id": "rs143158922", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143158922#frequency_tab" }, { "id": "rs143158922", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143158922" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32841605", "url": "https://glygen.org/publication/PubMed/32841605" }, { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://glygen.org/publication/DOI/10.1016/j.chom.2020.08.004" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13638-1", "start_pos": 238, "end_pos": 238, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 290, "chemical_mass": 33412.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13638-1", "start_pos": 238, "end_pos": 238, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 290, "chemical_mass": 33412.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13638-1", "start_pos": 238, "end_pos": 238, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 290, "chemical_mass": 33412.0 } ] }, { "start_pos": "238", "site_seq": "N", "site_lbl": "Asn238", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13638-1", "start_pos": 238, "end_pos": 238, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 290, "chemical_mass": 33412.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97710-1", "start_pos": 93, "end_pos": 93, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 509, "chemical_mass": 55691.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97710-1", "start_pos": 93, "end_pos": 93, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 509, "chemical_mass": 55691.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97710-1", "start_pos": 93, "end_pos": 93, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 509, "chemical_mass": 55691.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97710-1", "start_pos": 93, "end_pos": 93, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 509, "chemical_mass": 55691.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68FQ2-1", "start_pos": 192, "end_pos": 192, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Junctional adhesion molecule C", "gene_name": "Jam3", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 310, "chemical_mass": 34783.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68FQ2-1", "start_pos": 192, "end_pos": 192, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Junctional adhesion molecule C", "gene_name": "Jam3", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 310, "chemical_mass": 34783.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68FQ2-1", "start_pos": 192, "end_pos": 192, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Junctional adhesion molecule C", "gene_name": "Jam3", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 310, "chemical_mass": 34783.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q68FQ2-1", "start_pos": 192, "end_pos": 192, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Junctional adhesion molecule C", "gene_name": "Jam3", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 310, "chemical_mass": 34783.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97546-2", "start_pos": 196, "end_pos": 196, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 393, "chemical_mass": 43932.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97546-2", "start_pos": 196, "end_pos": 196, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 393, "chemical_mass": 43932.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97546-2", "start_pos": 196, "end_pos": 196, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 393, "chemical_mass": 43932.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97546-2", "start_pos": 196, "end_pos": 196, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 393, "chemical_mass": 43932.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63345-1", "start_pos": 58, "end_pos": 58, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Myelin-oligodendrocyte glycoprotein", "gene_name": "Mog", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 245, "chemical_mass": 27882.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63345-1", "start_pos": 58, "end_pos": 58, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Myelin-oligodendrocyte glycoprotein", "gene_name": "Mog", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 245, "chemical_mass": 27882.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63345-1", "start_pos": 58, "end_pos": 58, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Myelin-oligodendrocyte glycoprotein", "gene_name": "Mog", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 245, "chemical_mass": 27882.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q63345-1", "start_pos": 58, "end_pos": 58, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Myelin-oligodendrocyte glycoprotein", "gene_name": "Mog", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 245, "chemical_mass": 27882.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01830-1", "start_pos": 42, "end_pos": 42, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 161, "chemical_mass": 18172.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01830-1", "start_pos": 42, "end_pos": 42, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 161, "chemical_mass": 18172.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01830-1", "start_pos": 42, "end_pos": 42, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 161, "chemical_mass": 18172.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01830-1", "start_pos": 42, "end_pos": 42, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 161, "chemical_mass": 18172.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97829-1", "start_pos": 80, "end_pos": 80, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 303, "chemical_mass": 32995.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97829-1", "start_pos": 80, "end_pos": 80, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 303, "chemical_mass": 32995.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97829-1", "start_pos": 80, "end_pos": 80, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 303, "chemical_mass": 32995.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97829-1", "start_pos": 80, "end_pos": 80, "residue": "asn", "evidence": [ { "database": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" }, { "database": "UniCarbKB", "id": "GLY_000221", "url": "http://data.glygen.org/GLY_000221" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10116, "tax_name": "Rattus norvegicus", "tax_common_name": "Rat", "length": 303, "chemical_mass": 32995.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1074/mcp.RA120.002295", "url": "https://glygen.org/publication/DOI/10.1074/mcp.RA120.002295" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1074/mcp.RA120.002295", "url": "https://glygen.org/publication/DOI/10.1074/mcp.RA120.002295" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1074/mcp.RA120.002295", "url": "https://glygen.org/publication/DOI/10.1074/mcp.RA120.002295" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "149", "site_seq": "N", "site_lbl": "Asn149", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 149, "end_pos": 149, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1074/mcp.RA120.002295", "url": "https://glygen.org/publication/DOI/10.1074/mcp.RA120.002295" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "717", "site_seq": "N", "site_lbl": "Asn717", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 717, "end_pos": 717, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Increased resistance to neutralizing antibodies.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33064451", "url": "https://glygen.org/publication/PubMed/33064451" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1021/acs.analchem.0c03301", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.0c03301" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "DOI", "id": "10.1074/mcp.RA120.002295", "url": "https://glygen.org/publication/DOI/10.1074/mcp.RA120.002295" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "DOI", "id": "10.1126/science.abb9983", "url": "https://glygen.org/publication/DOI/10.1126/science.abb9983" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "UniCarbKB", "id": "GLY_000479", "url": "http://data.glygen.org/GLY_000479" }, { "database": "DOI", "id": "10.1101/2020.03.28.013276", "url": "https://glygen.org/publication/DOI/10.1101/2020.03.28.013276" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "N", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "EEQYNSTYR", "site_lbl": "Asn180", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "180", "site_seq": "", "site_lbl": "N180", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105742024", "evidence": [ { "id": "P01857", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01857" }, { "id": "rs1241201658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241201658" }, { "id": "rs1241201658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1241201658#frequency_tab" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01857-2", "start_pos": 180, "end_pos": 180, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 399, "chemical_mass": 43912.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "", "site_lbl": "N139", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "4", "chr_pos": "165464499", "evidence": [ { "id": "rs140774899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140774899" }, { "id": "rs140774899", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140774899#frequency_tab" }, { "id": "rs140774899", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140774899" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "4", "chr_pos": "165464498", "evidence": [ { "id": "rs1732065580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1732065580" }, { "id": "rs1732065580", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1732065580" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "N", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "GNETIVNLIHSTR", "site_lbl": "Asn139", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] }, { "start_pos": "139", "site_seq": "", "site_lbl": "N139", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "4", "chr_pos": "165464499", "evidence": [ { "id": "rs140774899", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140774899" }, { "id": "rs140774899", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140774899#frequency_tab" }, { "id": "rs140774899", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140774899" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "4", "chr_pos": "165464498", "evidence": [ { "id": "rs1732065580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1732065580" }, { "id": "rs1732065580", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1732065580" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16870-1", "start_pos": 139, "end_pos": 139, "residue": "Asn", "evidence": [ { "database": "GPTwiki", "id": "G03574QJ", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/G03574QJ" } ], "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 53151.0 } ] } ], "record_id": "G03574QJ" }